Homologs in group_2086

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15600 FBDBKF_15600 75.0 Morganella morganii S1 yidC membrane protein insertase YidC
EHELCC_15960 EHELCC_15960 75.0 Morganella morganii S2 yidC membrane protein insertase YidC
NLDBIP_16410 NLDBIP_16410 75.0 Morganella morganii S4 yidC membrane protein insertase YidC
LHKJJB_16395 LHKJJB_16395 75.0 Morganella morganii S3 yidC membrane protein insertase YidC
HKOGLL_16165 HKOGLL_16165 75.0 Morganella morganii S5 yidC membrane protein insertase YidC
F4V73_RS17555 F4V73_RS17555 75.2 Morganella psychrotolerans yidC membrane protein insertase YidC

Distribution of the homologs in the orthogroup group_2086

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2086

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8Z9U3 0.0 810 71 4 549 3 yidC Membrane protein insertase YidC Yersinia pestis
C6DK98 0.0 807 70 7 556 3 yidC Membrane protein insertase YidC Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BF61 0.0 806 70 4 549 3 yidC Membrane protein insertase YidC Edwardsiella ictaluri (strain 93-146)
B2VCE6 0.0 804 70 5 550 3 yidC Membrane protein insertase YidC Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6CYR0 0.0 803 70 7 556 3 yidC Membrane protein insertase YidC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8ACL7 0.0 798 70 6 551 3 yidC Membrane protein insertase YidC Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8G7P8 0.0 796 68 4 549 3 yidC Membrane protein insertase YidC Serratia proteamaculans (strain 568)
Q8ZKY4 0.0 791 70 6 551 3 yidC Membrane protein insertase YidC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TN10 0.0 791 70 6 551 3 yidC Membrane protein insertase YidC Salmonella schwarzengrund (strain CVM19633)
C0Q2L3 0.0 791 70 6 551 3 yidC Membrane protein insertase YidC Salmonella paratyphi C (strain RKS4594)
B5RFY3 0.0 790 70 6 551 3 yidC Membrane protein insertase YidC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUQ4 0.0 790 70 6 551 3 yidC Membrane protein insertase YidC Salmonella enteritidis PT4 (strain P125109)
B5BIL8 0.0 790 70 6 551 3 yidC Membrane protein insertase YidC Salmonella paratyphi A (strain AKU_12601)
A9MX83 0.0 790 70 6 551 3 yidC Membrane protein insertase YidC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKU2 0.0 790 70 6 551 3 yidC Membrane protein insertase YidC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5EYX5 0.0 790 70 6 551 3 yidC Membrane protein insertase YidC Salmonella agona (strain SL483)
B4TAV2 0.0 790 69 6 551 3 yidC Membrane protein insertase YidC Salmonella heidelberg (strain SL476)
A9MJT7 0.0 790 70 6 551 3 yidC Membrane protein insertase YidC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B4SYB1 0.0 789 69 6 551 3 yidC Membrane protein insertase YidC Salmonella newport (strain SL254)
Q57HZ7 0.0 789 69 6 551 3 yidC Membrane protein insertase YidC Salmonella choleraesuis (strain SC-B67)
B5FN13 0.0 788 69 6 551 3 yidC Membrane protein insertase YidC Salmonella dublin (strain CT_02021853)
A4WGH2 0.0 788 69 6 551 3 yidC Membrane protein insertase YidC Enterobacter sp. (strain 638)
Q8Z2N7 0.0 786 69 5 550 3 yidC Membrane protein insertase YidC Salmonella typhi
Q3YWA8 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Shigella sonnei (strain Ss046)
Q1R4M9 0.0 785 69 5 550 1 yidC Membrane protein insertase YidC Escherichia coli (strain UTI89 / UPEC)
B1LL32 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli (strain SMS-3-5 / SECEC)
B6I3T8 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli (strain SE11)
B7NF23 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IX33 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P65624 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TB02 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHN9 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O1:K1 / APEC
A8A6G7 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O9:H4 (strain HS)
B7M558 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O8 (strain IAI1)
B7N210 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O81 (strain ED1a)
B7NR08 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXA9 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O157:H7 (strain EC4115 / EHEC)
P65625 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O157:H7
B7L849 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli (strain 55989 / EAEC)
B7MGC7 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMH2 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P25714 0.0 785 69 5 550 1 yidC Membrane protein insertase YidC Escherichia coli (strain K12)
B1X9T4 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli (strain K12 / DH10B)
C4ZYY3 0.0 785 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli (strain K12 / MC4100 / BW2952)
P59783 0.0 784 69 5 550 3 yidC Membrane protein insertase YidC Shigella flexneri
Q31UV9 0.0 783 69 5 550 3 yidC Membrane protein insertase YidC Shigella boydii serotype 4 (strain Sb227)
B2TUS3 0.0 783 69 5 550 3 yidC Membrane protein insertase YidC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LK48 0.0 783 69 5 550 3 yidC Membrane protein insertase YidC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A7MN02 0.0 783 68 5 551 3 yidC Membrane protein insertase YidC Cronobacter sakazakii (strain ATCC BAA-894)
Q329B2 0.0 783 69 5 550 3 yidC Membrane protein insertase YidC Shigella dysenteriae serotype 1 (strain Sd197)
A7ZTR1 0.0 782 69 5 550 3 yidC Membrane protein insertase YidC Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TG08 0.0 759 67 7 552 3 yidC Membrane protein insertase YidC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZP5 0.0 759 67 7 552 3 yidC Membrane protein insertase YidC Klebsiella pneumoniae (strain 342)
A0KQZ7 0.0 653 55 5 553 3 yidC Membrane protein insertase YidC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
P29431 0.0 651 57 4 542 3 yidC Membrane protein insertase YidC Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A5UD72 0.0 649 56 7 550 3 yidC Membrane protein insertase YidC Haemophilus influenzae (strain PittEE)
P44973 0.0 648 56 7 550 3 yidC Membrane protein insertase YidC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QLR0 0.0 647 56 7 550 3 yidC Membrane protein insertase YidC Haemophilus influenzae (strain 86-028NP)
B8D8H9 0.0 643 59 7 542 3 yidC Membrane protein insertase YidC Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A4STS5 0.0 643 54 5 553 3 yidC Membrane protein insertase YidC Aeromonas salmonicida (strain A449)
B8D6T3 0.0 641 59 7 542 3 yidC Membrane protein insertase YidC Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57131 0.0 640 58 7 542 3 yidC Membrane protein insertase YidC Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q65VC2 0.0 637 55 7 550 3 yidC Membrane protein insertase YidC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CLQ2 0.0 632 56 8 550 3 yidC Membrane protein insertase YidC Pasteurella multocida (strain Pm70)
A6VR61 0.0 631 56 7 548 3 yidC Membrane protein insertase YidC Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q6LW55 0.0 630 58 8 548 3 yidC Membrane protein insertase YidC Photobacterium profundum (strain SS9)
B3H2D6 0.0 630 56 8 553 3 yidC Membrane protein insertase YidC Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BR23 0.0 629 56 8 553 3 yidC Membrane protein insertase YidC Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
C4LDZ4 0.0 624 57 5 552 3 yidC Membrane protein insertase YidC Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B6EP40 0.0 621 56 9 554 3 yidC Membrane protein insertase YidC Aliivibrio salmonicida (strain LFI1238)
C3LP77 0.0 617 56 11 553 3 yidC Membrane protein insertase YidC Vibrio cholerae serotype O1 (strain M66-2)
Q9KVY4 0.0 617 56 11 553 3 yidC Membrane protein insertase YidC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F484 0.0 617 56 11 553 3 yidC Membrane protein insertase YidC Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7VPM2 0.0 615 55 7 547 3 yidC Membrane protein insertase YidC Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0URU3 0.0 613 53 6 553 3 yidC Membrane protein insertase YidC Histophilus somni (strain 2336)
B8F6M2 0.0 613 53 6 556 3 yidC Membrane protein insertase YidC Glaesserella parasuis serovar 5 (strain SH0165)
Q87TR5 0.0 613 57 11 553 3 yidC Membrane protein insertase YidC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q0I0Z1 0.0 612 53 6 553 3 yidC Membrane protein insertase YidC Histophilus somni (strain 129Pt)
A7N0X9 0.0 608 57 11 553 3 yidC Membrane protein insertase YidC Vibrio campbellii (strain ATCC BAA-1116)
Q7MQK5 0.0 607 57 9 549 3 yidC Membrane protein insertase YidC Vibrio vulnificus (strain YJ016)
Q8DDI2 0.0 606 57 9 549 3 yidC Membrane protein insertase YidC Vibrio vulnificus (strain CMCP6)
B7VGH7 0.0 602 56 10 552 3 yidC Membrane protein insertase YidC Vibrio atlanticus (strain LGP32)
B0TQH1 0.0 590 52 6 553 3 yidC Membrane protein insertase YidC Shewanella halifaxensis (strain HAW-EB4)
Q8EKT6 0.0 590 53 6 550 3 yidC Membrane protein insertase YidC Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8HAI0 0.0 587 51 6 553 3 yidC Membrane protein insertase YidC Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1RQE9 0.0 586 52 6 549 3 yidC Membrane protein insertase YidC Shewanella sp. (strain W3-18-1)
Q0HPE6 0.0 586 52 6 549 3 yidC Membrane protein insertase YidC Shewanella sp. (strain MR-7)
A4YCM2 0.0 586 52 6 549 3 yidC Membrane protein insertase YidC Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B1KQ65 0.0 585 53 6 552 3 yidC Membrane protein insertase YidC Shewanella woodyi (strain ATCC 51908 / MS32)
Q0HD64 0.0 585 52 6 549 3 yidC Membrane protein insertase YidC Shewanella sp. (strain MR-4)
A9KX20 0.0 584 52 6 549 3 yidC Membrane protein insertase YidC Shewanella baltica (strain OS195)
A6WUK4 0.0 584 52 6 549 3 yidC Membrane protein insertase YidC Shewanella baltica (strain OS185)
A3DAS8 0.0 584 52 6 549 3 yidC Membrane protein insertase YidC Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EDW5 0.0 584 52 6 549 3 yidC Membrane protein insertase YidC Shewanella baltica (strain OS223)
A3QJT1 0.0 582 52 6 550 3 yidC Membrane protein insertase YidC Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A0KR32 0.0 582 52 7 552 3 yidC Membrane protein insertase YidC Shewanella sp. (strain ANA-3)
Q12HM8 0.0 582 52 7 552 3 yidC Membrane protein insertase YidC Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1T0M9 0.0 581 55 5 504 3 yidC Membrane protein insertase YidC Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8D3I8 0.0 579 49 5 544 3 yidC Membrane protein insertase YidC Wigglesworthia glossinidia brevipalpis
Q07VS6 0.0 578 52 6 549 3 yidC Membrane protein insertase YidC Shewanella frigidimarina (strain NCIMB 400)
A8FP42 0.0 573 52 6 552 3 yidC Membrane protein insertase YidC Shewanella sediminis (strain HAW-EB3)
A1S1G5 0.0 566 50 6 549 3 yidC Membrane protein insertase YidC Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8CH68 0.0 564 50 7 551 3 yidC Membrane protein insertase YidC Shewanella piezotolerans (strain WP3 / JCM 13877)
Q89B34 0.0 555 50 5 530 3 yidC Membrane protein insertase YidC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q3IK55 0.0 554 50 7 554 3 yidC Membrane protein insertase YidC Pseudoalteromonas translucida (strain TAC 125)
Q15MS7 0.0 546 48 8 553 3 yidC Membrane protein insertase YidC Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P22833 4.3e-172 488 100 0 237 3 yidC Membrane protein insertase YidC (Fragment) Proteus mirabilis
Q7U351 3.12e-168 491 48 7 560 3 yidC Membrane protein insertase YidC Blochmanniella floridana
B1JFV4 4.34e-165 483 44 9 559 3 yidC Membrane protein insertase YidC Pseudomonas putida (strain W619)
A5WBB7 1.1e-164 482 44 9 559 3 yidC Membrane protein insertase YidC Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P0A141 1.92e-164 481 44 9 559 3 yidC Membrane protein insertase YidC Pseudomonas putida
P0A140 1.92e-164 481 44 9 559 3 yidC Membrane protein insertase YidC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q4K395 6.5e-164 480 44 11 565 3 yidC Membrane protein insertase YidC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B0KRC1 1.58e-163 479 43 9 559 3 yidC Membrane protein insertase YidC Pseudomonas putida (strain GB-1)
Q1I2H4 4.49e-163 478 43 10 560 3 yidC Membrane protein insertase YidC Pseudomonas entomophila (strain L48)
C3K1G2 1.22e-162 477 43 9 559 3 yidC Membrane protein insertase YidC Pseudomonas fluorescens (strain SBW25)
A6W3V1 1.46e-161 474 43 9 561 3 yidC Membrane protein insertase YidC Marinomonas sp. (strain MWYL1)
A4VS82 2.31e-161 473 43 9 558 3 yidC Membrane protein insertase YidC Stutzerimonas stutzeri (strain A1501)
Q3K428 5.88e-160 470 42 8 559 3 yidC Membrane protein insertase YidC Pseudomonas fluorescens (strain Pf0-1)
C1DNF7 3.19e-158 466 42 10 563 3 yidC Membrane protein insertase YidC Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B3PIU1 7.42e-156 459 43 9 555 3 yidC Membrane protein insertase YidC Cellvibrio japonicus (strain Ueda107)
A1U7J4 8.8e-156 459 42 8 566 3 yidC Membrane protein insertase YidC Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q87TS1 1.25e-155 459 42 10 564 3 yidC Membrane protein insertase YidC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZL11 5.28e-155 457 42 10 567 3 yidC Membrane protein insertase YidC Pseudomonas syringae pv. syringae (strain B728a)
Q48BF2 1.15e-154 457 42 9 568 3 yidC Membrane protein insertase YidC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q02DE0 8.15e-154 455 41 10 579 3 yidC Membrane protein insertase YidC Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V7A5 8.15e-154 455 41 10 579 3 yidC Membrane protein insertase YidC Pseudomonas aeruginosa (strain LESB58)
Q9HT06 8.98e-154 455 41 10 579 3 yidC Membrane protein insertase YidC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6VF45 3.16e-153 453 40 10 579 3 yidC Membrane protein insertase YidC Pseudomonas aeruginosa (strain PA7)
A4Y1A0 2.96e-149 443 40 12 589 3 yidC Membrane protein insertase YidC Pseudomonas mendocina (strain ymp)
Q3J6L8 3.56e-149 442 41 10 562 3 yidC Membrane protein insertase YidC Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
C5BKL7 1.07e-148 441 41 10 565 3 yidC Membrane protein insertase YidC Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q21DG0 8.38e-148 439 40 10 569 3 yidC Membrane protein insertase YidC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2S6M5 1.82e-146 436 41 8 510 3 yidC Membrane protein insertase YidC Hahella chejuensis (strain KCTC 2396)
Q5ZR81 3.84e-146 434 43 10 548 3 yidC Membrane protein insertase YidC Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X0M2 4.47e-146 434 43 10 548 3 yidC Membrane protein insertase YidC Legionella pneumophila (strain Paris)
A5IIK4 7.86e-146 434 43 10 549 3 yidC Membrane protein insertase YidC Legionella pneumophila (strain Corby)
Q5WSE9 1.29e-145 433 43 10 548 3 yidC Membrane protein insertase YidC Legionella pneumophila (strain Lens)
Q477Q4 7.52e-140 418 38 10 562 3 yidC Membrane protein insertase YidC Dechloromonas aromatica (strain RCB)
Q0VKU7 1.25e-139 419 39 11 584 3 yidC Membrane protein insertase YidC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q602M6 4.49e-139 416 42 9 548 3 yidC Membrane protein insertase YidC Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0A4L5 2.03e-137 412 39 7 550 3 yidC Membrane protein insertase YidC Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2Y5A8 1.28e-136 410 39 10 578 3 yidC Membrane protein insertase YidC Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B8GRD1 8.62e-135 405 42 11 566 3 yidC Membrane protein insertase YidC Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q5P4P4 1.17e-134 405 37 8 553 3 yidC Membrane protein insertase YidC Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B6J2B4 1.75e-134 405 38 8 561 3 yidC Membrane protein insertase YidC Coxiella burnetii (strain CbuG_Q212)
P45650 9.17e-134 403 38 8 561 3 yidC Membrane protein insertase YidC Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBA5 9.17e-134 403 38 8 561 3 yidC Membrane protein insertase YidC Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J8U7 1.13e-133 403 38 8 561 3 yidC Membrane protein insertase YidC Coxiella burnetii (strain CbuK_Q154)
A9KBT1 1.27e-133 403 38 8 561 3 yidC Membrane protein insertase YidC Coxiella burnetii (strain Dugway 5J108-111)
Q2KTI5 9.77e-133 400 38 13 574 3 yidC Membrane protein insertase YidC Bordetella avium (strain 197N)
A9IJB7 1.06e-132 400 41 9 493 3 yidC Membrane protein insertase YidC Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1WWE3 5.58e-132 398 39 12 556 3 yidC Membrane protein insertase YidC Halorhodospira halophila (strain DSM 244 / SL1)
Q7W2K1 1.61e-131 397 40 11 494 3 yidC Membrane protein insertase YidC Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P65622 3.78e-131 396 40 11 494 3 yidC Membrane protein insertase YidC Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P65623 3.78e-131 396 40 11 494 3 yidC Membrane protein insertase YidC Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B2T7U1 2.44e-130 394 38 11 558 3 yidC Membrane protein insertase YidC Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q13SH4 6.81e-130 393 37 12 560 3 yidC Membrane protein insertase YidC Paraburkholderia xenovorans (strain LB400)
B2JJR8 6.19e-129 390 37 14 567 3 yidC Membrane protein insertase YidC Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q1GXL6 1.09e-128 390 38 8 552 3 yidC Membrane protein insertase YidC Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q63YW1 2.39e-127 386 40 8 480 3 yidC Membrane protein insertase YidC Burkholderia pseudomallei (strain K96243)
A3N477 2.39e-127 386 40 8 480 3 yidC Membrane protein insertase YidC Burkholderia pseudomallei (strain 668)
Q3JXI3 2.39e-127 386 40 8 480 3 yidC Membrane protein insertase YidC Burkholderia pseudomallei (strain 1710b)
A3NPX1 2.39e-127 386 40 8 480 3 yidC Membrane protein insertase YidC Burkholderia pseudomallei (strain 1106a)
A1V7D5 5.44e-127 385 40 8 480 3 yidC Membrane protein insertase YidC Burkholderia mallei (strain SAVP1)
Q62EM4 5.44e-127 385 40 8 480 3 yidC Membrane protein insertase YidC Burkholderia mallei (strain ATCC 23344)
A2S8D6 5.44e-127 385 40 8 480 3 yidC Membrane protein insertase YidC Burkholderia mallei (strain NCTC 10229)
A3MS20 5.44e-127 385 40 8 480 3 yidC Membrane protein insertase YidC Burkholderia mallei (strain NCTC 10247)
Q2STM0 7.42e-126 382 40 8 480 3 yidC Membrane protein insertase YidC Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A1AXT7 1.43e-125 381 39 13 560 3 yidC Membrane protein insertase YidC Ruthia magnifica subsp. Calyptogena magnifica
B1YQJ7 4.01e-123 375 39 10 485 3 yidC Membrane protein insertase YidC Burkholderia ambifaria (strain MC40-6)
Q0BAQ2 4.47e-123 375 39 10 485 3 yidC Membrane protein insertase YidC Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q39BQ2 1.83e-122 374 40 11 486 3 yidC Membrane protein insertase YidC Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E7D5 3.03e-122 373 39 10 485 3 yidC Membrane protein insertase YidC Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B1K0Y4 3.12e-122 373 39 10 485 3 yidC Membrane protein insertase YidC Burkholderia orbicola (strain MC0-3)
Q8Y3H6 4.4e-122 373 36 15 571 3 yidC Membrane protein insertase YidC Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
O51829 5.1e-122 361 69 0 234 3 yidC Membrane protein insertase YidC (Fragment) Buchnera aphidicola subsp. Myzus persicae
P59810 5.33e-122 375 37 10 563 3 yidC Membrane protein insertase YidC Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1BSF7 7.49e-122 372 39 10 485 3 yidC Membrane protein insertase YidC Burkholderia orbicola (strain AU 1054)
A0KBN3 7.49e-122 372 39 10 485 3 yidC Membrane protein insertase YidC Burkholderia cenocepacia (strain HI2424)
A9ACA0 1.09e-121 372 40 11 483 3 yidC Membrane protein insertase YidC Burkholderia multivorans (strain ATCC 17616 / 249)
C1D6H8 1.76e-121 371 37 8 561 3 yidC Membrane protein insertase YidC Laribacter hongkongensis (strain HLHK9)
Q0AE56 3.91e-121 372 36 9 563 3 yidC Membrane protein insertase YidC Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q0K5C1 2.39e-120 368 41 11 477 3 yidC Membrane protein insertase YidC Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A5CVI2 2.78e-120 368 39 15 556 3 yidC Membrane protein insertase YidC Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B2U820 3.1e-120 368 41 11 478 3 yidC Membrane protein insertase YidC Ralstonia pickettii (strain 12J)
B3R883 8.16e-120 367 38 14 565 3 yidC Membrane protein insertase YidC Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A4JJ46 3.69e-119 365 39 11 483 3 yidC Membrane protein insertase YidC Burkholderia vietnamiensis (strain G4 / LMG 22486)
A0Q419 4.23e-119 365 37 13 553 3 yidC Membrane protein insertase YidC Francisella tularensis subsp. novicida (strain U112)
A4J015 1.13e-118 364 37 13 553 3 yidC Membrane protein insertase YidC Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NI56 1.13e-118 364 37 13 553 3 yidC Membrane protein insertase YidC Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JK8 1.13e-118 364 37 13 553 3 yidC Membrane protein insertase YidC Francisella tularensis subsp. tularensis (strain FSC 198)
B2SE60 1.24e-118 364 37 13 553 3 yidC Membrane protein insertase YidC Francisella tularensis subsp. mediasiatica (strain FSC147)
B0TW73 1.35e-118 363 39 9 510 3 yidC Membrane protein insertase YidC Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0BNY1 1.75e-118 363 37 14 553 3 yidC Membrane protein insertase YidC Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5M8 1.75e-118 363 37 14 553 3 yidC Membrane protein insertase YidC Francisella tularensis subsp. holarctica (strain LVS)
A7N9L6 1.75e-118 363 37 14 553 3 yidC Membrane protein insertase YidC Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q1LH91 3.07e-117 360 38 13 560 3 yidC Membrane protein insertase YidC Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3SF38 2.71e-116 358 36 8 549 3 yidC Membrane protein insertase YidC Thiobacillus denitrificans (strain ATCC 25259)
Q7NPT8 1.34e-115 356 37 12 552 3 yidC Membrane protein insertase YidC Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q46VL6 3.03e-113 350 41 11 477 3 yidC Membrane protein insertase YidC Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A4T0N2 4.39e-113 350 35 15 567 3 yidC Membrane protein insertase YidC Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B1XSN7 7.95e-111 344 34 8 562 3 yidC Membrane protein insertase YidC Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A6T4D7 1.63e-110 343 32 11 585 3 yidC Membrane protein insertase YidC Janthinobacterium sp. (strain Marseille)
Q8P338 4.27e-110 342 36 14 578 3 yidC Membrane protein insertase YidC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UNK8 8.59e-110 342 36 14 578 3 yidC Membrane protein insertase YidC Xanthomonas campestris pv. campestris (strain 8004)
A9M152 5.44e-107 333 37 8 501 3 yidC Membrane protein insertase YidC Neisseria meningitidis serogroup C (strain 053442)
Q9JW48 9.11e-107 333 36 8 501 3 yidC Membrane protein insertase YidC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8PEH7 9.59e-107 334 36 13 577 3 yidC Membrane protein insertase YidC Xanthomonas axonopodis pv. citri (strain 306)
Q9P9U1 1.31e-106 333 35 11 556 3 yidC Membrane protein insertase YidC Xylella fastidiosa (strain 9a5c)
A1KRZ8 2.52e-106 332 37 7 490 3 yidC Membrane protein insertase YidC Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JXS4 2.52e-106 332 37 7 490 3 yidC Membrane protein insertase YidC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q3BLZ7 3.05e-106 333 36 13 577 3 yidC Membrane protein insertase YidC Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B4RJJ2 1.32e-105 330 37 8 490 3 yidC Membrane protein insertase YidC Neisseria gonorrhoeae (strain NCCP11945)
Q5F4W6 1.6e-105 330 37 7 491 3 yidC Membrane protein insertase YidC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B0U6I1 2.13e-105 330 35 12 568 3 yidC Membrane protein insertase YidC Xylella fastidiosa (strain M12)
A4GAN3 2.19e-105 330 35 9 509 3 yidC Membrane protein insertase YidC Herminiimonas arsenicoxydans
Q879S3 1.19e-104 328 35 11 556 3 yidC Membrane protein insertase YidC Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IAR7 1.19e-104 328 35 11 556 3 yidC Membrane protein insertase YidC Xylella fastidiosa (strain M23)
B0RMM6 3.8e-104 327 36 14 580 3 yidC Membrane protein insertase YidC Xanthomonas campestris pv. campestris (strain B100)
B4SPG0 1.34e-103 326 35 10 559 3 yidC Membrane protein insertase YidC Stenotrophomonas maltophilia (strain R551-3)
B2FPA5 3.62e-103 325 35 11 559 3 yidC Membrane protein insertase YidC Stenotrophomonas maltophilia (strain K279a)
Q5GTT3 1.87e-98 312 35 13 577 3 yidC Membrane protein insertase YidC Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SUW0 1.87e-98 312 35 13 577 3 yidC Membrane protein insertase YidC Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NX52 2.46e-96 307 35 13 581 3 yidC Membrane protein insertase YidC Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A0LE49 5.36e-91 292 32 13 566 3 yidC Membrane protein insertase YidC Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A6U5K9 2.4e-82 271 29 17 589 3 yidC Membrane protein insertase YidC Sinorhizobium medicae (strain WSM419)
B5EGX9 1.66e-81 267 35 9 481 3 yidC Membrane protein insertase YidC Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B8DP11 1.69e-81 267 31 13 566 3 yidC Membrane protein insertase YidC Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
C6DYS1 7.75e-81 265 34 10 518 3 yidC Membrane protein insertase YidC Geobacter sp. (strain M21)
C3MF49 4.33e-80 265 31 15 522 3 yidC Membrane protein insertase YidC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q92SF5 5.2e-80 265 31 13 521 3 yidC Membrane protein insertase YidC Rhizobium meliloti (strain 1021)
Q8FV29 1.13e-79 264 31 13 525 3 yidC Membrane protein insertase YidC Brucella suis biovar 1 (strain 1330)
Q8YDA3 1.28e-79 264 31 13 525 3 yidC Membrane protein insertase YidC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q746Q2 1.32e-79 262 36 12 480 3 yidC Membrane protein insertase YidC Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q30YQ5 4.05e-79 261 32 14 533 3 yidC Membrane protein insertase YidC Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A5G9V4 1.99e-78 259 36 7 411 3 yidC Membrane protein insertase YidC Geotalea uraniireducens (strain Rf4)
A1VER7 2.58e-78 259 31 13 556 3 yidC Membrane protein insertase YidC Nitratidesulfovibrio vulgaris (strain DP4)
Q72D53 2.58e-78 259 31 13 556 3 yidC Membrane protein insertase YidC Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B3E3S0 3.17e-78 258 39 8 392 3 yidC Membrane protein insertase YidC Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q8UIB3 3.62e-78 260 30 12 510 3 yidC Membrane protein insertase YidC Agrobacterium fabrum (strain C58 / ATCC 33970)
A0LLH3 5.65e-78 258 34 8 426 3 yidC Membrane protein insertase YidC Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q1QH68 2.98e-77 258 29 16 599 3 yidC Membrane protein insertase YidC Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B9M7R9 3.52e-77 256 32 10 505 3 yidC Membrane protein insertase YidC Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
C6C0J6 3.52e-77 256 30 12 563 3 yidC Membrane protein insertase YidC Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q39PQ8 1.71e-76 254 34 12 481 3 yidC Membrane protein insertase YidC Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q2LSF9 9.02e-76 252 34 15 531 3 yidC Membrane protein insertase YidC Syntrophus aciditrophicus (strain SB)
B1Z8E7 9.04e-76 254 29 16 574 3 yidC Membrane protein insertase YidC Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q98D88 9.59e-76 254 28 14 592 3 yidC Membrane protein insertase YidC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1MM58 1.2e-75 253 29 10 528 3 yidC Membrane protein insertase YidC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q4FNF1 1.61e-75 252 30 17 575 3 yidC Membrane protein insertase YidC Pelagibacter ubique (strain HTCC1062)
A9W590 9.16e-75 251 29 15 572 3 yidC Membrane protein insertase YidC Methylorubrum extorquens (strain PA1)
B8EPG5 1.23e-74 251 30 17 556 3 yidC Membrane protein insertase YidC Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B7L2I5 1.94e-74 251 29 15 572 3 yidC Membrane protein insertase YidC Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A1B0E4 2.09e-74 251 33 17 530 3 yidC Membrane protein insertase YidC Paracoccus denitrificans (strain Pd 1222)
A8EXB6 2.76e-74 249 31 17 524 3 yidC Membrane protein insertase YidC Rickettsia canadensis (strain McKiel)
Q1MPF3 9.91e-74 246 29 15 564 3 yidC Membrane protein insertase YidC Lawsonia intracellularis (strain PHE/MN1-00)
Q9ZE97 1.18e-73 247 30 13 520 3 yidC Membrane protein insertase YidC Rickettsia prowazekii (strain Madrid E)
C4XNJ6 2e-73 246 40 7 335 3 yidC Membrane protein insertase YidC Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
C3PM83 2.05e-73 246 29 12 525 3 yidC Membrane protein insertase YidC Rickettsia africae (strain ESF-5)
B1LTW1 3.95e-73 247 30 14 533 3 yidC Membrane protein insertase YidC Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B9JZK8 5.29e-73 247 29 12 542 3 yidC Membrane protein insertase YidC Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q92JJ3 7.22e-73 245 30 12 506 3 yidC Membrane protein insertase YidC Rickettsia conorii (strain ATCC VR-613 / Malish 7)
O25989 1.3e-72 244 37 6 333 3 yidC Membrane protein insertase YidC Helicobacter pylori (strain ATCC 700392 / 26695)
Q9PNX7 1.73e-72 243 36 10 413 3 yidC Membrane protein insertase YidC Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P60037 1.96e-72 243 48 0 229 3 yidC Membrane protein insertase YidC Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
C4K168 2.39e-72 244 30 12 506 3 yidC Membrane protein insertase YidC Rickettsia peacockii (strain Rustic)
A8GQK8 2.49e-72 244 30 12 525 3 yidC Membrane protein insertase YidC Rickettsia rickettsii (strain Sheila Smith)
Q68XS4 2.9e-72 243 30 11 513 3 yidC Membrane protein insertase YidC Rickettsia typhi (strain ATCC VR-144 / Wilmington)
B2IDV5 3.47e-72 244 30 13 555 3 yidC Membrane protein insertase YidC Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q89BQ0 6.14e-72 244 31 13 545 3 yidC Membrane protein insertase YidC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1RKM2 6.18e-72 243 30 10 508 3 yidC Membrane protein insertase YidC Rickettsia bellii (strain RML369-C)
A8GUC7 6.18e-72 243 30 10 508 3 yidC Membrane protein insertase YidC Rickettsia bellii (strain OSU 85-389)
A8GLY9 6.6e-72 243 30 12 520 3 yidC Membrane protein insertase YidC Rickettsia akari (strain Hartford)
A8F0F4 1.13e-71 242 29 12 525 3 yidC Membrane protein insertase YidC Rickettsia massiliae (strain Mtu5)
Q4UN76 1.33e-71 242 30 12 502 3 yidC Membrane protein insertase YidC Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B8IMM9 1.48e-71 243 29 17 590 3 yidC Membrane protein insertase YidC Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A1AV44 1.66e-71 241 33 15 516 3 yidC Membrane protein insertase YidC Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B0BVZ4 2.32e-71 241 33 7 416 3 yidC Membrane protein insertase YidC Rickettsia rickettsii (strain Iowa)
A5G0F8 2.44e-71 242 33 8 428 3 yidC Membrane protein insertase YidC Acidiphilium cryptum (strain JF-5)
A3PNB1 2.46e-71 243 31 16 595 3 yidC Membrane protein insertase YidC Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B9KNZ6 2.59e-71 243 31 16 597 3 yidC Membrane protein insertase YidC Cereibacter sphaeroides (strain KD131 / KCTC 12085)
B0UHI1 3.03e-71 242 31 17 536 3 yidC Membrane protein insertase YidC Methylobacterium sp. (strain 4-46)
Q3IYY6 6.08e-71 241 31 16 597 3 yidC Membrane protein insertase YidC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9ZJG8 6.67e-71 239 37 5 334 3 yidC Membrane protein insertase YidC Helicobacter pylori (strain J99 / ATCC 700824)
B3Q040 4.29e-70 239 30 11 519 3 yidC Membrane protein insertase YidC Rhizobium etli (strain CIAT 652)
Q16AA1 1e-69 238 31 18 593 3 yidC Membrane protein insertase YidC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B4RDV5 1.38e-69 237 30 13 509 3 yidC Membrane protein insertase YidC Phenylobacterium zucineum (strain HLK1)
Q0ASI6 3.26e-68 233 28 18 591 3 yidC Membrane protein insertase YidC Maricaulis maris (strain MCS10)
Q1GJX6 8.56e-67 230 31 14 520 3 yidC Membrane protein insertase YidC Ruegeria sp. (strain TM1040)
Q0BU78 3.57e-66 228 33 10 423 3 yidC Membrane protein insertase YidC Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q28UQ8 7.33e-65 225 29 19 615 3 yidC Membrane protein insertase YidC Jannaschia sp. (strain CCS1)
Q9RNL5 1.56e-64 223 35 8 350 3 yidC Membrane protein insertase YidC Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q7VJY0 7.11e-64 222 46 1 233 3 yidC Membrane protein insertase YidC Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q5LW11 4.64e-62 218 31 20 595 3 yidC Membrane protein insertase YidC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B8JDK5 3.01e-58 206 36 4 288 3 yidC Membrane protein insertase YidC Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IHR0 3.04e-58 206 36 4 288 3 yidC Membrane protein insertase YidC Anaeromyxobacter dehalogenans (strain 2CP-C)
B4UKG1 4.06e-58 205 36 4 288 3 yidC Membrane protein insertase YidC Anaeromyxobacter sp. (strain K)
A8LMA0 6.99e-58 206 30 16 595 3 yidC Membrane protein insertase YidC Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B8H1E8 2.78e-57 204 29 21 608 3 yidC Membrane protein insertase YidC Caulobacter vibrioides (strain NA1000 / CB15N)
Q9AA40 2.78e-57 204 29 21 608 3 yidC Membrane protein insertase YidC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B1GZ50 2.12e-56 200 36 4 293 3 yidC Membrane protein insertase YidC Endomicrobium trichonymphae
B0T872 1.06e-55 201 27 12 542 3 yidC Membrane protein insertase YidC Caulobacter sp. (strain K31)
A7HIY8 6.7e-55 197 30 9 391 3 yidC Membrane protein insertase YidC Anaeromyxobacter sp. (strain Fw109-5)
B3QYV6 4.15e-52 190 29 21 534 3 yidC Membrane protein insertase YidC Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
O66561 2.6e-50 183 37 4 267 3 yidC Membrane protein insertase YidC Aquifex aeolicus (strain VF5)
B3EIM7 1.83e-48 180 26 22 571 3 yidC Membrane protein insertase YidC Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A1BJZ7 4.56e-48 179 26 20 560 3 yidC Membrane protein insertase YidC Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B4S6X1 1.49e-45 172 27 19 542 3 yidC Membrane protein insertase YidC Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B4SHH0 2.56e-45 171 25 19 598 3 yidC Membrane protein insertase YidC Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B3QLY4 1.68e-44 169 28 18 511 3 yidC Membrane protein insertase YidC Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q3ANZ7 3.58e-44 168 25 18 562 3 yidC Membrane protein insertase YidC Chlorobium chlorochromatii (strain CaD3)
Q3B110 3.62e-44 168 30 14 398 3 yidC Membrane protein insertase YidC Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A4SH20 1.65e-42 163 26 21 573 3 yidC Membrane protein insertase YidC Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B3EQF7 4.29e-42 162 34 7 302 3 yidC Membrane protein insertase YidC Chlorobium phaeobacteroides (strain BS1)
Q8KGG2 9.12e-42 161 26 14 496 3 yidC Membrane protein insertase YidC Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B2S0E5 2.53e-39 154 36 4 230 3 yidC Membrane protein insertase YidC Borrelia hermsii (strain HS1 / DAH)
A1QZM8 8.38e-39 152 36 4 230 3 yidC Membrane protein insertase YidC Borrelia turicatae (strain 91E135)
B5RLZ9 5.21e-38 150 32 8 290 3 yidC Membrane protein insertase YidC Borrelia duttonii (strain Ly)
B5RRP5 7.12e-38 150 32 8 290 3 yidC Membrane protein insertase YidC Borrelia recurrentis (strain A1)
Q9PKE3 1.15e-37 151 35 4 244 3 yidC Membrane protein insertase YidC Chlamydia muridarum (strain MoPn / Nigg)
B3ER28 1.28e-37 149 25 15 479 3 yidC Membrane protein insertase YidC Amoebophilus asiaticus (strain 5a2)
Q81JH1 2.12e-37 142 37 6 215 3 yidC2 Membrane protein insertase YidC 2 Bacillus anthracis
B7J208 8.25e-37 147 37 5 230 3 yidC Membrane protein insertase YidC Borreliella burgdorferi (strain ZS7)
O51398 1.04e-36 146 37 5 230 3 yidC Membrane protein insertase YidC Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q814F4 1.38e-36 139 36 6 215 3 yidC2 Membrane protein insertase YidC 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q661H9 2.11e-35 142 37 6 224 3 yidC Membrane protein insertase YidC Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q04XE2 2.77e-35 143 29 17 420 3 yidC Membrane protein insertase YidC Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04W30 2.77e-35 143 29 17 420 3 yidC Membrane protein insertase YidC Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
P97041 3.05e-35 143 27 13 415 3 yidC Membrane protein insertase YidC Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q0SN67 3.08e-35 142 37 6 224 3 yidC Membrane protein insertase YidC Borreliella afzelii (strain PKo)
Q7UFZ2 3.1e-35 144 29 10 336 3 yidC Membrane protein insertase YidC Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q72VY8 4.41e-35 142 27 13 415 3 yidC Membrane protein insertase YidC Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
P59809 2.21e-34 141 34 4 246 3 yidC Membrane protein insertase YidC Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q81XH4 4.58e-34 132 37 7 221 3 yidC1 Membrane protein insertase YidC 1 Bacillus anthracis
A6L9D2 5.37e-34 139 27 21 518 3 yidC Membrane protein insertase YidC Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q815V9 1.38e-33 131 36 7 222 3 yidC1 Membrane protein insertase YidC 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q7VQ46 3.02e-33 138 33 5 256 3 yidC Membrane protein insertase YidC Chlamydia pneumoniae
O84253 3.44e-33 138 35 4 244 3 yidC Membrane protein insertase YidC Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
O66103 7.29e-33 136 36 4 231 3 yidC Membrane protein insertase YidC Treponema pallidum (strain Nichols)
O87567 7.69e-32 126 39 4 183 3 yidC Membrane protein insertase YidC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q926Q5 1.68e-31 126 37 5 207 3 yidC2 Membrane protein insertase YidC 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y3I2 1.15e-30 124 37 5 207 3 yidC2 Membrane protein insertase YidC 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71VQ8 1.15e-30 124 37 5 207 3 yidC1 Membrane protein insertase YidC 1 Listeria monocytogenes serotype 4b (strain F2365)
Q01625 2.01e-30 122 35 6 226 1 misCA Membrane protein insertase MisCA Bacillus subtilis (strain 168)
Q9KDP2 3.88e-30 122 33 8 226 1 yidC2 Membrane protein insertase YidC 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8R6K6 3.93e-30 120 35 4 202 3 yidC Membrane protein insertase YidC Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q64T26 4.75e-30 127 22 16 553 3 yidC Membrane protein insertase YidC Bacteroides fragilis (strain YCH46)
Q9RCA5 6.45e-30 121 38 5 194 3 yidC1 Membrane protein insertase YidC 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5LC41 1.38e-29 126 26 10 356 3 yidC Membrane protein insertase YidC Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q8RHA4 3.01e-29 117 38 3 199 3 yidC Membrane protein insertase YidC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q97CW0 5.31e-29 118 38 4 177 3 yidC Membrane protein insertase YidC Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A6L5L6 1.07e-28 124 24 20 567 3 yidC Membrane protein insertase YidC Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q11S04 2.11e-28 123 31 15 351 3 yidC Membrane protein insertase YidC Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q8AA76 2.23e-28 122 24 15 503 3 yidC Membrane protein insertase YidC Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8EKU1 2.71e-28 116 34 5 197 3 yidC Membrane protein insertase YidC Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q73JM1 7.1e-28 121 27 10 358 3 yidC Membrane protein insertase YidC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8LBP4 4.7e-26 114 30 6 239 1 ALB3 Inner membrane protein ALBINO3, chloroplastic Arabidopsis thaliana
Q8XH28 1.1e-25 108 38 3 164 3 yidC Membrane protein insertase YidC Clostridium perfringens (strain 13 / Type A)
Q9CJ72 7.61e-25 107 32 6 198 3 yidC1 Membrane protein insertase YidC 1 Lactococcus lactis subsp. lactis (strain IL1403)
Q9FY06 9.24e-25 110 30 5 239 2 PPF-1 Inner membrane protein PPF-1, chloroplastic Pisum sativum
P59811 2.38e-24 108 29 6 247 3 yidC Membrane protein insertase YidC Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8CX16 3.26e-24 105 37 4 185 3 yidC1 Membrane protein insertase YidC 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
O54569 4.15e-24 108 30 7 247 3 yidC Membrane protein insertase YidC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8E6W4 6.74e-24 104 37 4 185 3 yidC1 Membrane protein insertase YidC 1 Streptococcus agalactiae serotype III (strain NEM316)
Q03D58 1.08e-23 104 37 4 190 3 yidC Membrane protein insertase YidC Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q9X1H2 3.83e-23 105 31 6 222 1 yidC Membrane protein insertase YidC Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B6YQF9 5.74e-23 106 24 27 560 3 yidC Membrane protein insertase YidC Azobacteroides pseudotrichonymphae genomovar. CFP2
Q82YV1 1.35e-22 101 37 7 196 3 yidC Membrane protein insertase YidC Enterococcus faecalis (strain ATCC 700802 / V583)
Q8LKI3 1.11e-21 101 30 4 206 2 ALB3.2 Inner membrane ALBINO3-like protein 2, chloroplastic Chlamydomonas reinhardtii
Q8YRM9 1.34e-21 100 39 2 120 3 yidC Membrane protein insertase YidC Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P0DC87 6.22e-21 96 36 7 191 3 yidC1 Membrane protein insertase YidC 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC86 6.22e-21 96 36 7 191 3 yidC1 Membrane protein insertase YidC 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P65631 6.22e-21 96 36 7 191 3 yidC1 Membrane protein insertase YidC 1 Streptococcus pyogenes serotype M1
B2RKS0 7.43e-21 100 25 12 347 3 yidC Membrane protein insertase YidC Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q8P2P8 9.03e-21 95 36 7 191 3 yidC1 Membrane protein insertase YidC 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDY9 9.29e-21 95 36 7 191 3 yidC1 Membrane protein insertase YidC 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8S339 1.63e-20 98 27 7 246 3 ALB3.1 Inner membrane ALBINO3-like protein 1, chloroplastic Chlamydomonas reinhardtii
P60036 1.64e-20 99 25 11 345 3 yidC Membrane protein insertase YidC Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q899S4 2.39e-20 93 31 7 209 3 yidC Membrane protein insertase YidC Clostridium tetani (strain Massachusetts / E88)
Q9RSH5 3.63e-20 96 31 5 194 3 yidC Membrane protein insertase YidC Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P54544 1.01e-19 92 33 11 222 1 misCB Membrane protein insertase MisCB Bacillus subtilis (strain 168)
Q88RX1 2.29e-19 91 33 7 215 3 yidC2 Membrane protein insertase YidC 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8DVX3 4.57e-19 90 35 5 174 3 yidC1 Membrane protein insertase YidC 1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q97NI6 8.19e-19 90 31 5 192 3 yidC2 Membrane protein insertase YidC 2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9FYL3 8.61e-19 93 26 5 238 1 ALB4 ALBINO3-like protein 1, chloroplastic Arabidopsis thaliana
Q8DN93 9.06e-19 90 31 5 192 1 yidC2 Membrane protein insertase YidC 2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A4W485 1.76e-18 89 36 6 174 3 yidC Membrane protein insertase YidC Streptococcus suis (strain 98HAH33)
Q8CMK4 5.34e-18 87 31 10 224 3 yidC2 Membrane protein insertase YidC 2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLG6 5.34e-18 87 31 10 224 3 yidC1 Membrane protein insertase YidC 1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P74155 2.58e-17 87 37 2 120 1 yidC Membrane protein insertase YidC Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5HMD1 4.04e-17 85 30 11 225 3 yidC2 Membrane protein insertase YidC 2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CMK8 4.66e-17 85 30 11 225 3 yidC1 Membrane protein insertase YidC 1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q71ZU1 2.12e-16 83 30 8 203 3 yidC2 Membrane protein insertase YidC 2 Listeria monocytogenes serotype 4b (strain F2365)
Q8Y7A9 2.12e-16 83 30 8 203 3 yidC1 Membrane protein insertase YidC 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92BX6 2.27e-16 82 30 8 203 3 yidC1 Membrane protein insertase YidC 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q88WR8 2.64e-16 83 29 10 237 3 yidC1 Membrane protein insertase YidC 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q4L7X2 2.7e-16 83 29 11 212 3 yidC Membrane protein insertase YidC Staphylococcus haemolyticus (strain JCSC1435)
Q9L7M1 3.39e-16 83 24 7 262 3 yidC Membrane protein insertase YidC Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q50205 7.39e-16 83 24 8 270 3 yidC Membrane protein insertase YidC Mycobacterium leprae (strain TN)
P9WIT5 1.37e-15 82 34 2 109 1 yidC Membrane protein insertase YidC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIT4 1.37e-15 82 34 2 109 3 yidC Membrane protein insertase YidC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65627 1.37e-15 82 34 2 109 3 yidC Membrane protein insertase YidC Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q83MN6 1.93e-14 77 23 9 258 3 yidC Membrane protein insertase YidC Tropheryma whipplei (strain Twist)
Q7V610 2.86e-14 78 34 2 108 3 yidC Membrane protein insertase YidC Prochlorococcus marinus (strain MIT 9313)
Q7U522 3.18e-14 78 34 2 108 3 yidC Membrane protein insertase YidC Parasynechococcus marenigrum (strain WH8102)
Q83N53 3.96e-14 77 23 9 258 3 yidC Membrane protein insertase YidC Tropheryma whipplei (strain TW08/27)
Q42191 6.82e-14 77 27 7 224 2 OXA1 Mitochondrial inner membrane protein OXA1 Arabidopsis thaliana
Q8DL96 7.52e-14 77 29 2 120 3 yidC Membrane protein insertase YidC Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8G6J6 1.76e-13 75 33 3 112 3 yidC Membrane protein insertase YidC Bifidobacterium longum (strain NCC 2705)
Q7V0R8 2.33e-13 75 31 3 116 3 yidC Membrane protein insertase YidC Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q9SKD3 2.87e-13 75 30 8 203 2 OXA1L Mitochondrial inner membrane protein OXA1-like Arabidopsis thaliana
P0DC89 3.82e-13 73 30 10 233 3 yidC2 Membrane protein insertase YidC 2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC88 3.82e-13 73 30 10 233 3 yidC2 Membrane protein insertase YidC 2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A1C3 4e-13 73 30 10 233 3 yidC2 Membrane protein insertase YidC 2 Streptococcus pyogenes serotype M1
Q8P2D8 4.68e-13 73 30 10 233 3 yidC2 Membrane protein insertase YidC 2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDQ5 4.68e-13 73 30 10 233 3 yidC2 Membrane protein insertase YidC 2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8DSP8 5.7e-13 73 28 8 214 3 yidC2 Membrane protein insertase YidC 2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q7VB00 2.91e-12 72 32 2 108 3 yidC Membrane protein insertase YidC Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q49Z38 1.03e-11 69 29 9 175 3 yidC Membrane protein insertase YidC Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9RGS4 1.68e-11 68 30 8 166 3 yidC Membrane protein insertase YidC Staphylococcus carnosus (strain TM300)
Q8BGA9 2.41e-11 69 26 9 205 1 Oxa1l Mitochondrial inner membrane protein OXA1L Mus musculus
P65630 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain MW2)
Q6G7M0 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain MSSA476)
Q6GEY5 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain MRSA252)
P65629 1.59e-10 65 29 8 161 1 yidC Membrane protein insertase YidC Staphylococcus aureus (strain N315)
P65628 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QIT4 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain Newman)
Q5HEA9 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain COL)
Q2YUI9 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IUN6 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain JH9)
Q2FWG4 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FF36 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain USA300)
A6U3H6 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain JH1)
A7X4S6 1.59e-10 65 29 8 161 3 yidC Membrane protein insertase YidC Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q15070 2.03e-10 66 28 9 206 1 OXA1L Mitochondrial inner membrane protein OXA1L Homo sapiens
O43092 2.29e-10 66 25 5 237 2 oxa102 Mitochondrial inner membrane protein oxa1-2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9CHZ9 1.84e-09 62 29 8 203 3 yidC2 Membrane protein insertase YidC 2 Lactococcus lactis subsp. lactis (strain IL1403)
O14300 2.9e-09 62 24 5 191 2 oxa101 Mitochondrial inner membrane protein oxa1-1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3SYV3 3.51e-09 62 25 6 205 2 OXA1L Mitochondrial inner membrane protein OXA1L Bos taurus
Q8DNE1 6.8e-09 60 28 5 155 3 yidC1 Membrane protein insertase YidC 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
C1CTN0 9.6e-09 60 28 5 155 3 yidC Membrane protein insertase YidC Streptococcus pneumoniae (strain Taiwan19F-14)
Q97NP5 9.6e-09 60 28 5 155 3 yidC1 Membrane protein insertase YidC 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DY84 2.94e-08 58 25 5 170 3 yidC2 Membrane protein insertase YidC 2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E3U9 3.3e-08 58 25 5 170 3 yidC2 Membrane protein insertase YidC 2 Streptococcus agalactiae serotype III (strain NEM316)
Q8NLK2 5.92e-08 58 30 3 117 3 yidC Membrane protein insertase YidC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8VC74 1.68e-07 57 25 7 220 1 Cox18 Cytochrome c oxidase assembly protein COX18, mitochondrial Mus musculus
Q5R7D0 3.16e-07 56 24 8 234 2 COX18 Cytochrome c oxidase assembly protein COX18, mitochondrial Pongo abelii
Q8FLS3 4.82e-07 55 32 1 93 3 yidC Membrane protein insertase YidC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8N8Q8 2.7e-06 53 23 7 233 1 COX18 Cytochrome c oxidase assembly protein COX18, mitochondrial Homo sapiens
P39952 5.88e-06 52 22 9 257 1 OXA1 Mitochondrial inner membrane protein OXA1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O13375 0.000216 47 19 6 198 3 OXA1 Mitochondrial inner membrane protein OXA1 Monosporozyma servazzii
Q98R58 0.001 45 23 6 195 3 yidC Membrane protein insertase YidC Mycoplasmopsis pulmonis (strain UAB CTIP)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15485
Feature type CDS
Gene yidC
Product membrane protein insertase YidC
Location 3442710 - 3444350 (strand: -1)
Length 1641 (nucleotides) / 546 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2086
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02096 60Kd inner membrane protein
PF14849 YidC periplasmic domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0706 Cell wall/membrane/envelope biogenesis (M) M Membrane protein insertase Oxa1/YidC/SpoIIIJ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03217 YidC/Oxa1 family membrane protein insertase Quorum sensing
Protein export
Bacterial secretion system		 -

Protein Sequence

MDSQRNLLFIALLFVSFLIWQQWEGDKVSQNTTTTTQVSQQADMPSSDSLAVTGNSNEQAKLITVKTDVLDLRINTQGGTIDEADLLAYPAELNSKTPFRLLETTPQFLYQAQSGLIGPDGPDQKSRPVYSATQQEFILGENQDELRVPMTFVNEEGVKFVKTFILKKGQYDIGIEYKVENPTDKTLTMNFYGQLKQSVKLPEHRDTGSSNFALHTYRGAAYSSDETNYKKYSFGDIEDKNLSITTNNGWIAMLQQYFATAWIPAKDSQNNNFYSITLDNKSIALIGYKSAPITVAPNSTQDITSTLWVGPEIQSEMSAIAPHLDLSVDYGWLWFISQPLFKLLKFLHSFIGNWGFSIIMITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAALRERIGDDKQRMSQEMMALYKQEKVNPLGGCLPLIIQMPIFLALYYMLMGSVELRHAPFILWIQDLSAQDPYYILPLLMGVTMFIIQKLSPTAVTDPMQQKIMTFMPVVFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGLHSRDKK

Flanking regions ( +/- flanking 50bp)

GATGATCCTGTCCCACCTAGAAAAAACGACGATAACAGAGAAAATTAACGATGGATTCGCAACGCAATCTTCTATTCATCGCTTTACTGTTCGTTTCTTTCCTGATCTGGCAGCAGTGGGAGGGTGATAAAGTATCACAAAACACCACCACTACTACTCAGGTCTCGCAACAAGCGGACATGCCAAGCAGTGATAGTCTTGCTGTGACTGGTAACAGCAATGAGCAGGCAAAATTGATTACCGTAAAAACTGACGTACTTGATCTTCGTATCAATACTCAGGGCGGTACTATCGATGAGGCTGATTTGTTAGCCTATCCCGCCGAGCTTAATTCAAAAACCCCTTTCCGTTTACTGGAAACTACACCTCAATTCCTGTATCAGGCTCAAAGTGGCTTAATTGGCCCTGATGGTCCAGATCAGAAATCTCGCCCTGTCTACAGTGCCACACAACAAGAATTTATCTTAGGTGAAAACCAAGATGAATTACGTGTACCTATGACTTTTGTGAATGAAGAAGGCGTGAAATTCGTCAAAACCTTTATTCTGAAAAAAGGTCAGTATGACATTGGTATTGAATACAAAGTTGAGAACCCAACAGATAAAACACTGACAATGAACTTTTATGGTCAGTTAAAACAATCTGTTAAGTTACCAGAACACCGTGATACTGGAAGTAGCAACTTTGCGCTACATACCTATCGTGGTGCGGCTTATTCATCAGATGAAACCAACTATAAAAAATATAGCTTTGGTGATATCGAAGATAAAAACCTTTCTATCACAACCAACAATGGTTGGATTGCGATGTTACAACAATACTTCGCAACCGCGTGGATCCCAGCTAAAGATAGTCAGAATAACAACTTCTACTCTATCACTTTAGATAATAAATCTATCGCACTGATTGGTTATAAATCAGCACCTATTACTGTTGCACCAAATAGCACACAGGATATCACTTCAACATTATGGGTCGGGCCTGAGATCCAGTCTGAAATGTCTGCAATCGCACCACATTTAGACCTATCTGTTGACTATGGTTGGTTATGGTTTATCTCTCAGCCACTGTTTAAGCTGCTGAAATTCCTGCACAGCTTTATCGGTAACTGGGGTTTCTCCATCATCATGATCACCTTTATCGTTCGTGGTATTATGTATCCACTCACGAAAGCGCAATACACCTCTATGGCGAAAATGCGTTTACTGCAACCAAAACTGGCGGCACTTCGTGAGCGTATTGGTGATGATAAACAACGTATGAGCCAAGAAATGATGGCGTTATACAAACAAGAGAAAGTTAATCCTCTTGGTGGTTGTTTACCGCTGATTATCCAGATGCCAATCTTCCTTGCCTTATACTATATGTTAATGGGCTCGGTTGAATTACGTCATGCACCATTTATATTATGGATCCAAGACTTATCAGCACAAGATCCGTACTATATCCTGCCATTATTAATGGGTGTGACGATGTTCATCATTCAGAAACTGTCACCAACAGCAGTCACTGATCCGATGCAACAAAAAATTATGACCTTTATGCCGGTTGTATTTACTGTATTCTTCCTGTGGTTCCCATCAGGTCTGGTTCTGTACTATATCGTCAGTAACCTAGTAACCATTATCCAGCAGCAGTTAATCTACCGCGGTCTGGAAAAACGTGGGCTACATAGTAGAGACAAAAAATAAGGTCACATCAGGAAAAACCTCTTCTTTGGTTACATTCAAAGAAAAGTGAC