Homologs in group_953

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05200 FBDBKF_05200 42.9 Morganella morganii S1 ydeI putative periplasmic protein YdeI with OB-fold, BOF family
EHELCC_12390 EHELCC_12390 42.9 Morganella morganii S2 ydeI putative periplasmic protein YdeI with OB-fold, BOF family
NLDBIP_12730 NLDBIP_12730 42.9 Morganella morganii S4 ydeI putative periplasmic protein YdeI with OB-fold, BOF family
LHKJJB_12590 LHKJJB_12590 42.9 Morganella morganii S3 ydeI putative periplasmic protein YdeI with OB-fold, BOF family
HKOGLL_11205 HKOGLL_11205 42.9 Morganella morganii S5 ydeI putative periplasmic protein YdeI with OB-fold, BOF family
F4V73_RS05660 F4V73_RS05660 46.3 Morganella psychrotolerans - NirD/YgiW/YdeI family stress tolerance protein

Distribution of the homologs in the orthogroup group_953

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_953

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADU5 3.02e-39 131 50 2 130 1 ygiW Protein YgiW Escherichia coli (strain K12)
P0ADU6 3.02e-39 131 50 2 130 3 ygiW Protein YgiW Escherichia coli O157:H7
P44293 5.31e-13 64 36 1 91 1 HI_1709 Uncharacterized protein HI_1709 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9I6H1 3.85e-11 59 35 0 81 3 carO Calcium-regulated OB-fold protein CarO Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P31130 4.57e-09 54 33 2 100 3 ydeI Uncharacterized protein YdeI Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15310
Feature type CDS
Gene -
Product YgiW/YdeI family stress tolerance OB fold protein
Location 3396170 - 3396574 (strand: -1)
Length 405 (nucleotides) / 134 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_953
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04076 Bacterial OB fold (BOF) protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3111 Function unknown (S) S Predicted periplasmic protein YdeI with OB-fold, BOF family

Protein Sequence

MKKILVLLIGSTLAFASQANSNQQNSGGFVAPQSAITTTEQGGFKGPSISETTVAKAKTLSDDTWVILTGKITKKIGDELYVFEDTTGAINVEIDQKRWRGQTVTPENTVKIEGKIDKEWTSTEIDVKQLSIVK

Flanking regions ( +/- flanking 50bp)

AGAATTAATCTATCTCTAAGTGAATGTTTAAACCAATAAGCGAGCCTATTATGAAAAAAATACTAGTTTTATTAATTGGTAGTACATTGGCTTTTGCATCTCAAGCCAATTCAAACCAACAAAATAGCGGTGGTTTTGTTGCCCCACAAAGCGCTATCACCACCACAGAGCAAGGTGGATTTAAAGGTCCTTCAATTAGCGAAACCACCGTTGCTAAAGCAAAAACACTTTCAGATGATACTTGGGTTATCTTAACAGGCAAAATCACCAAAAAAATTGGTGATGAGCTTTATGTTTTTGAAGACACAACAGGTGCTATTAATGTTGAAATAGACCAAAAAAGATGGCGTGGTCAAACCGTTACGCCTGAGAATACCGTAAAAATTGAAGGTAAGATCGATAAAGAGTGGACAAGTACTGAAATCGATGTAAAACAACTGAGCATTGTTAAATAACTATACTCTTTAAAAAGACATATAAAGATTAAAACATTATGTGTCTTTTT