Homologs in group_136

Help

10 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS02640 PMI_RS02640 23.2 Proteus mirabilis HI4320 - fimbria/pilus outer membrane usher protein
PMI_RS05165 PMI_RS05165 20.5 Proteus mirabilis HI4320 pefC PefC/AfrB family outer membrane usher protein
PMI_RS05725 PMI_RS05725 22.4 Proteus mirabilis HI4320 - fimbria/pilus outer membrane usher protein
PMI_RS05765 PMI_RS05765 18.0 Proteus mirabilis HI4320 - fimbria/pilus outer membrane usher protein
PMI_RS07095 PMI_RS07095 22.3 Proteus mirabilis HI4320 - fimbria/pilus outer membrane usher protein
PMI_RS10900 PMI_RS10900 23.6 Proteus mirabilis HI4320 - fimbria/pilus outer membrane usher protein
PMI_RS12525 PMI_RS12525 23.0 Proteus mirabilis HI4320 - fimbria/pilus outer membrane usher protein
PMI_RS13455 PMI_RS13455 21.5 Proteus mirabilis HI4320 - fimbria/pilus outer membrane usher protein
PMI_RS16660 PMI_RS16660 21.8 Proteus mirabilis HI4320 - fimbria/pilus outer membrane usher protein
PMI_RS17130 PMI_RS17130 22.2 Proteus mirabilis HI4320 - fimbria/pilus outer membrane usher protein

Distribution of the homologs in the orthogroup group_136

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_136

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45420 1.41e-51 194 26 21 652 3 yhcD Uncharacterized outer membrane usher protein YhcD Escherichia coli (strain K12)
P43662 3.19e-31 133 23 18 655 3 lpfC Outer membrane usher protein LpfC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P33388 9.37e-31 132 25 23 665 3 sefC Outer membrane usher protein SefC Salmonella enteritidis
P45997 5.96e-27 120 22 23 660 3 hifC Outer membrane usher protein HifC Haemophilus influenzae
P53514 1.56e-26 119 23 20 670 3 pmfC Outer membrane usher protein PmfC Proteus mirabilis (strain HI4320)
Q56983 7.95e-26 116 23 28 686 3 psaC Outer membrane usher protein PsaC Yersinia pseudotuberculosis serotype I (strain IP32953)
P31527 7.95e-26 116 23 28 686 3 psaC Outer membrane usher protein PsaC Yersinia pestis
P33397 1.45e-25 115 22 22 653 3 hifC Outer membrane usher protein HifC Haemophilus influenzae
P53512 1.63e-25 115 25 22 644 3 cssD Outer membrane usher protein CssD Escherichia coli
P53513 1.67e-25 115 25 23 644 3 cssD Outer membrane usher protein CssD Escherichia coli
P46009 2.12e-25 115 23 23 677 3 focD Outer membrane usher protein FocD Escherichia coli
P33410 2.38e-25 115 22 16 634 3 fimC Outer membrane usher protein FimC Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P45998 2.71e-25 115 22 24 655 3 hifC Outer membrane usher protein HifC Haemophilus influenzae
P33408 3.8e-24 111 22 23 662 3 myfC Outer membrane usher protein MyfC Yersinia enterocolitica
P53517 6.52e-24 110 23 23 677 3 afaC Outer membrane usher protein AfaC Escherichia coli
P33129 1.31e-23 109 23 25 654 1 htrE Outer membrane usher protein HtrE Escherichia coli (strain K12)
P30130 6.4e-23 107 22 24 687 1 fimD Outer membrane usher protein FimD Escherichia coli (strain K12)
P15484 5.64e-21 101 25 15 555 3 None Outer membrane usher protein CS3-2 Escherichia coli
P21647 6.67e-21 101 22 24 651 3 mrkC Outer membrane usher protein MrkC Klebsiella pneumoniae
P37924 8.16e-21 100 21 24 670 3 fimD Outer membrane usher protein FimD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75857 4.94e-20 98 23 26 684 2 elfC Probable outer membrane usher protein ElfC Escherichia coli (strain K12)
P46005 5.46e-20 98 21 25 676 3 aggC Outer membrane usher protein AggC Escherichia coli
P33341 1.04e-19 97 20 19 660 2 yehB Outer membrane usher protein YehB Escherichia coli (strain K12)
Q8XDD1 1.76e-19 96 22 20 677 2 elfC Probable outer membrane usher protein ElfC Escherichia coli O157:H7
P77468 2.39e-19 96 20 21 666 2 sfmD Outer membrane usher protein SfmD Escherichia coli (strain K12)
P76655 6.34e-19 95 23 23 618 5 yqiG Putative outer membrane usher protein YqiG Escherichia coli (strain K12)
P77196 1.25e-18 94 21 20 673 5 yfcU Putative outer membrane usher protein YfcU Escherichia coli (strain K12)
P42915 1.82e-18 93 23 25 654 2 yraJ Outer membrane usher protein YraJ Escherichia coli (strain K12)
P07110 2.07e-18 93 22 23 690 1 papC Outer membrane usher protein PapC Escherichia coli
P37868 2.78e-18 92 23 25 634 3 pefC Outer membrane usher protein PefC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P46000 1.89e-17 90 22 22 644 3 fasD Outer membrane usher protein FasD Escherichia coli
P26949 1.9e-16 87 21 20 654 1 caf1A F1 capsule-anchoring protein Yersinia pestis
P75750 2.67e-16 86 21 17 614 3 ybgQ Uncharacterized outer membrane usher protein YbgQ Escherichia coli (strain K12)
Q8X5K7 1e-12 73 31 2 146 2 lpfC Probable outer membrane usher protein LpfC Escherichia coli O157:H7
P12050 8.88e-12 72 22 23 613 3 fanD Outer membrane usher protein FanD Escherichia coli
P06970 1.25e-09 65 29 5 153 3 faeD Outer membrane usher protein FaeD Escherichia coli
Q7DBJ9 3.76e-08 59 25 16 363 4 ydeT Fimbrial usher domain-containing protein YdeT Escherichia coli O157:H7
Q8X5K8 5.43e-06 53 21 13 373 2 lpfC' Probable outer membrane usher protein LpfC' Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15280
Feature type CDS
Gene -
Product fimbria/pilus outer membrane usher protein
Location 3389729 - 3391642 (strand: -1)
Length 1914 (nucleotides) / 637 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_136
Orthogroup size 11
N. genomes 1

Actions

Genomic region

Domains

PF00577 Outer membrane usher protein
PF13953 PapC C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3188 Cell motility (N)
Extracellular structures (W)		 NW Outer membrane usher protein FimD/PapC

Protein Sequence

MKLNGSNNRNFYQGDFKTGINFYNWILRNNSSFSSGDGKTYYRFNETTLSRTIERIKAILQLGQITSNSELLDSADVNGFQLYSDSSYQNSKLTVPITGMSEKPATVEVTQNNRLLYRTIIPAGPFQLNNISGVSSSQPLHVKVIQDDGTIQEFDVITSNKDLKNPQSSTSFNFFMGKYRKNSSDERIHTPFITGFEGGINYLNHNFLGGMEISSKYKSIVGSVNSVFGEHRPLSTGFGIKYASSSNKGDGFQANANLSLPVSVFSLGLSTIYRSRNYSTLYESLQIDNIEDPLDDNLANNQTKTSSSLSLSLGNQRYGSLSYSLSYSQYYGDKKDNYSNTISYGKRFPFMSFNISYQKSSNFEDRTFVNINVPINNSSSFSTQYQHYKTSSLTTNYSNYHNDLFRYSIGATADKDSKDKNISGNINATTAYSQISATGSFSNSNQKSAMLTASGAIAYSDGLFATSPVELGDTFGILRVPGQSGILVNSMGGGTTITNHFGTAVIPNLPVNKKTTVLLNTKNLPLNVMLGTTSFDIALAKGTVFSREIPVNTMKQVLLEIKKPDGKPVNTANSVIDDKGNLIGVIMGDGNVIISNEQIGKPLKVKSDNGDICSVDYSVPEEFNPDFLYEKVDAICK

Flanking regions ( +/- flanking 50bp)

AATTAACCTATGGTGGCTTAGGGGTATTCAACAACTATAGAATCTATGGTATGAAGTTAAATGGCTCTAATAATAGGAATTTTTATCAAGGTGATTTTAAAACAGGTATAAATTTTTATAATTGGATTTTACGTAATAACAGTAGCTTTTCTTCAGGTGATGGGAAAACTTACTATAGATTTAATGAAACAACGCTTTCACGTACAATAGAACGCATCAAAGCCATTTTACAATTAGGCCAAATTACATCTAATAGTGAGTTATTAGATAGTGCTGATGTGAATGGTTTTCAATTATATTCAGATAGTAGCTATCAAAACAGTAAGTTGACAGTTCCTATTACTGGGATGTCTGAAAAACCGGCTACCGTTGAAGTCACACAAAATAATCGATTGTTATATAGAACGATAATACCTGCAGGCCCTTTCCAATTAAATAACATTAGTGGTGTATCATCAAGTCAACCATTACATGTCAAAGTTATTCAAGATGATGGTACTATTCAAGAATTTGATGTTATTACATCAAATAAAGACTTAAAAAATCCACAGAGTAGTACCAGCTTTAACTTTTTTATGGGGAAATATAGAAAAAACTCAAGTGATGAACGCATACATACTCCTTTTATTACCGGTTTTGAAGGTGGCATTAATTATTTAAATCATAATTTTCTAGGGGGTATGGAAATATCATCAAAATATAAGTCCATTGTAGGTAGCGTAAATAGCGTTTTTGGTGAACATCGTCCTTTATCTACTGGCTTTGGTATTAAATATGCATCTTCTTCTAATAAAGGTGATGGCTTCCAAGCAAATGCTAATTTAAGTTTACCTGTATCAGTATTCTCACTAGGCTTATCAACAATATATCGTTCACGTAACTATTCGACACTCTATGAATCTCTACAAATAGATAATATAGAAGACCCATTAGATGATAATCTTGCTAATAATCAGACAAAAACATCAAGCTCATTATCTCTAAGCTTAGGAAATCAACGTTATGGATCACTGAGTTATAGCCTTAGCTATAGCCAATATTATGGTGATAAAAAAGACAATTATTCAAATACCATTTCTTATGGAAAAAGATTTCCATTTATGTCTTTTAATATTAGCTATCAAAAAAGTAGTAATTTTGAAGATCGTACATTTGTAAACATCAACGTACCTATTAATAATTCATCATCATTTAGTACTCAATACCAACATTATAAAACATCATCTTTAACAACAAATTATAGTAATTATCATAATGATTTATTTAGATATTCTATCGGGGCAACTGCTGATAAAGACAGTAAAGATAAGAATATTAGCGGTAATATCAATGCAACAACCGCTTACAGCCAAATTAGTGCGACAGGCTCCTTTAGTAATAGTAATCAAAAATCGGCGATGCTGACAGCATCTGGTGCTATTGCTTATAGTGATGGATTATTTGCTACTTCTCCTGTGGAGTTAGGAGATACTTTCGGTATTTTACGTGTTCCAGGACAATCTGGTATTTTAGTTAACTCTATGGGTGGTGGTACGACAATAACTAATCACTTTGGTACCGCCGTTATTCCTAACTTACCTGTAAATAAAAAAACAACTGTTCTATTAAATACTAAAAATTTACCACTCAATGTTATGTTAGGCACAACATCCTTTGATATTGCATTGGCAAAAGGTACTGTTTTTTCTCGTGAGATCCCTGTCAATACAATGAAGCAAGTTTTATTAGAAATAAAAAAACCAGATGGTAAACCTGTTAATACAGCAAATAGTGTTATTGATGATAAGGGAAATCTAATAGGTGTTATTATGGGGGACGGTAATGTTATAATAAGTAATGAGCAAATCGGTAAGCCACTAAAAGTAAAATCAGATAATGGTGACATCTGTTCTGTTGATTATTCAGTTCCAGAAGAATTTAATCCAGACTTTTTATATGAAAAAGTTGATGCAATTTGTAAGTAATACAAAGAGGATAGTCTAATTATGAAAATACTAAAAGGAATGATTTTTCT