Homologs in group_1596

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10410 FBDBKF_10410 93.1 Morganella morganii S1 aroK shikimate kinase AroK
EHELCC_14745 EHELCC_14745 93.1 Morganella morganii S2 aroK shikimate kinase AroK
NLDBIP_14575 NLDBIP_14575 93.1 Morganella morganii S4 aroK shikimate kinase AroK
LHKJJB_14770 LHKJJB_14770 93.1 Morganella morganii S3 aroK shikimate kinase AroK
HKOGLL_13390 HKOGLL_13390 93.1 Morganella morganii S5 aroK shikimate kinase AroK
F4V73_RS14105 F4V73_RS14105 93.6 Morganella psychrotolerans aroK shikimate kinase AroK

Distribution of the homologs in the orthogroup group_1596

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1596

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JIQ3 3.89e-111 316 90 0 173 3 aroK Shikimate kinase 1 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664L9 3.89e-111 316 90 0 173 3 aroK Shikimate kinase 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGU1 3.89e-111 316 90 0 173 3 aroK Shikimate kinase 1 Yersinia pestis (strain Pestoides F)
Q1CCN9 3.89e-111 316 90 0 173 3 aroK Shikimate kinase 1 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4B0 3.89e-111 316 90 0 173 3 aroK Shikimate kinase 1 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJF7 3.89e-111 316 90 0 173 3 aroK Shikimate kinase 1 Yersinia pestis
B2K5T5 3.89e-111 316 90 0 173 3 aroK Shikimate kinase 1 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2P2 3.89e-111 316 90 0 173 3 aroK Shikimate kinase 1 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNT6 3.89e-111 316 90 0 173 3 aroK Shikimate kinase 1 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JSD4 1.84e-110 315 89 0 173 3 aroK Shikimate kinase 1 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKQ8 1.84e-110 315 89 0 173 3 aroK Shikimate kinase 1 Serratia proteamaculans (strain 568)
B2VJW8 3.34e-110 314 89 0 173 3 aroK Shikimate kinase 1 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P63601 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63602 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella typhi
B4TY47 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella schwarzengrund (strain CVM19633)
B5BH30 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella paratyphi A (strain AKU_12601)
Q5PLX1 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SVI9 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella newport (strain SL254)
B4TKR3 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella heidelberg (strain SL476)
B5R7M7 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2D6 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella enteritidis PT4 (strain P125109)
B5FJR0 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella dublin (strain CT_02021853)
Q57IY7 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella choleraesuis (strain SC-B67)
B5F8K1 4.84e-110 313 89 0 173 3 aroK Shikimate kinase 1 Salmonella agona (strain SL483)
A8AQU4 5.97e-110 313 89 0 173 3 aroK Shikimate kinase 1 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q6CZQ8 1.42e-109 312 89 0 173 3 aroK Shikimate kinase 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7LS91 1.95e-109 312 88 0 173 3 aroK Shikimate kinase 1 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WFH8 2.3e-109 311 89 0 173 3 aroK Shikimate kinase 1 Enterobacter sp. (strain 638)
Q3YWN3 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Shigella sonnei (strain Ss046)
P0A6E0 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Shigella flexneri
Q32AK2 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VP4 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Shigella boydii serotype 4 (strain Sb227)
B2U3J6 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7NDZ4 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6D7 3.49e-109 311 88 0 173 1 aroK Shikimate kinase 1 Escherichia coli (strain K12)
B1IP75 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6D8 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A5J7 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Escherichia coli O9:H4 (strain HS)
B1X737 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Escherichia coli (strain K12 / DH10B)
B7M1U2 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Escherichia coli O8 (strain IAI1)
B7NMF3 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0A6D9 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Escherichia coli O157:H7
B7MD01 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZSR5 3.49e-109 311 88 0 173 3 aroK Shikimate kinase 1 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q2NQJ1 3.98e-108 308 87 0 173 3 aroK Shikimate kinase 1 Sodalis glossinidius (strain morsitans)
Q7NA55 9.94e-103 295 91 0 173 3 aroK Shikimate kinase 1 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1LU61 3.39e-102 293 81 0 173 3 aroK Shikimate kinase Baumannia cicadellinicola subsp. Homalodisca coagulata
A4SK24 3.21e-99 286 80 0 170 3 aroK Shikimate kinase Aeromonas salmonicida (strain A449)
A0KN29 4.98e-99 285 79 0 170 3 aroK Shikimate kinase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q9KNV1 1.5e-97 282 80 1 173 3 aroK Shikimate kinase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F523 1.5e-97 282 80 1 173 3 aroK Shikimate kinase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MH83 1.29e-96 280 80 1 173 3 aroK Shikimate kinase Vibrio vulnificus (strain YJ016)
Q8DCM1 1.29e-96 280 80 1 173 3 aroK Shikimate kinase Vibrio vulnificus (strain CMCP6)
Q87L67 2.82e-96 278 79 1 172 3 aroK Shikimate kinase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5FBN2 9.61e-96 277 79 1 172 3 aroK Shikimate kinase Aliivibrio fischeri (strain MJ11)
Q5E2F9 9.61e-96 277 79 1 172 3 aroK Shikimate kinase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MSY3 1.16e-95 277 79 1 172 3 aroK Shikimate kinase Vibrio campbellii (strain ATCC BAA-1116)
P57605 2.53e-95 276 78 0 171 3 aroK Shikimate kinase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B6EM43 4.56e-95 275 79 1 172 3 aroK Shikimate kinase Aliivibrio salmonicida (strain LFI1238)
C4K6R0 7.56e-95 275 77 0 172 3 aroK Shikimate kinase 1 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A1SB14 9.19e-95 275 78 1 170 3 aroK Shikimate kinase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q6LVF6 1.51e-94 274 78 1 172 3 aroK Shikimate kinase Photobacterium profundum (strain SS9)
Q8K938 2.64e-94 274 77 0 172 3 aroK Shikimate kinase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q65R34 5.58e-94 273 74 0 171 3 aroK Shikimate kinase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1RPQ7 6.98e-94 273 78 1 170 3 aroK Shikimate kinase Shewanella sp. (strain W3-18-1)
A4YBT1 6.98e-94 273 78 1 170 3 aroK Shikimate kinase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK20 8.69e-94 272 77 1 170 3 aroK Shikimate kinase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L695 1.36e-93 272 78 1 170 3 aroK Shikimate kinase Shewanella baltica (strain OS195)
A6WTR2 1.36e-93 272 78 1 170 3 aroK Shikimate kinase Shewanella baltica (strain OS185)
A3DA15 1.36e-93 272 78 1 170 3 aroK Shikimate kinase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A0L243 2.26e-93 271 77 1 170 3 aroK Shikimate kinase Shewanella sp. (strain ANA-3)
Q0I053 2.46e-93 271 77 1 170 3 aroK Shikimate kinase Shewanella sp. (strain MR-7)
Q0HDV6 2.46e-93 271 77 1 170 3 aroK Shikimate kinase Shewanella sp. (strain MR-4)
Q3IJC5 5.86e-93 270 77 0 171 3 aroK Shikimate kinase Pseudoalteromonas translucida (strain TAC 125)
B0TL77 6.98e-93 270 77 1 170 3 aroK Shikimate kinase Shewanella halifaxensis (strain HAW-EB4)
Q5QV48 8.47e-93 270 77 0 171 3 aroK Shikimate kinase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A8GZ29 9.81e-93 270 77 1 170 3 aroK Shikimate kinase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q12SL9 2.72e-92 268 77 1 170 3 aroK Shikimate kinase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A6VKZ6 3.48e-92 268 74 0 171 3 aroK Shikimate kinase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B1KP71 4.31e-92 268 77 1 170 3 aroK Shikimate kinase Shewanella woodyi (strain ATCC 51908 / MS32)
Q8D1X8 5.26e-92 268 74 0 172 3 aroK Shikimate kinase Wigglesworthia glossinidia brevipalpis
A3Q9D7 7.45e-92 267 76 1 170 3 aroK Shikimate kinase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8G196 1.71e-91 266 75 1 170 3 aroK Shikimate kinase Shewanella sediminis (strain HAW-EB3)
P57925 1.94e-91 266 74 0 171 3 aroK Shikimate kinase Pasteurella multocida (strain Pm70)
Q088S7 3.06e-91 266 75 1 170 3 aroK Shikimate kinase Shewanella frigidimarina (strain NCIMB 400)
B0UTE7 5.21e-91 265 74 0 171 3 aroK Shikimate kinase Histophilus somni (strain 2336)
Q489N4 2.6e-90 263 73 0 171 3 aroK Shikimate kinase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
P43880 3.85e-90 263 73 0 171 3 aroK Shikimate kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UG09 3.85e-90 263 73 0 171 3 aroK Shikimate kinase Haemophilus influenzae (strain PittGG)
A5UAU9 3.98e-90 263 73 0 171 3 aroK Shikimate kinase Haemophilus influenzae (strain PittEE)
Q4QNY3 6.81e-90 263 73 0 171 3 aroK Shikimate kinase Haemophilus influenzae (strain 86-028NP)
Q15Y43 9.99e-89 259 73 1 168 3 aroK Shikimate kinase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
C4LB08 2.93e-88 258 73 0 170 3 aroK Shikimate kinase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B4S0F6 3.26e-88 258 73 1 167 3 aroK Shikimate kinase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0BSJ7 2.48e-87 256 72 1 171 3 aroK Shikimate kinase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3MYR6 2.48e-87 256 72 1 171 3 aroK Shikimate kinase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VNR4 2.51e-86 253 71 2 172 3 aroK Shikimate kinase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q492A4 1.39e-85 252 71 1 176 3 aroK Shikimate kinase Blochmanniella pennsylvanica (strain BPEN)
P59488 5.44e-83 245 68 1 171 3 aroK Shikimate kinase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1SRB6 8.58e-82 242 67 1 171 3 aroK Shikimate kinase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7VRN2 1.72e-79 236 62 1 178 3 aroK Shikimate kinase Blochmanniella floridana
Q5WXX6 1.24e-69 211 60 1 166 3 aroK Shikimate kinase Legionella pneumophila (strain Lens)
Q5ZX01 1.24e-69 211 60 1 166 3 aroK Shikimate kinase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IFY0 1.24e-69 211 60 1 166 3 aroK Shikimate kinase Legionella pneumophila (strain Corby)
Q5X6H1 1.24e-69 211 60 1 166 3 aroK Shikimate kinase Legionella pneumophila (strain Paris)
Q0BMF5 5.57e-64 197 57 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A419 5.57e-64 197 57 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. holarctica (strain LVS)
A7NBG9 5.57e-64 197 57 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IYJ0 1.52e-63 196 57 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFS0 1.52e-63 196 57 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q707 1.52e-63 196 57 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. novicida (strain U112)
B2SGC8 1.52e-63 196 57 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14H72 1.52e-63 196 57 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. tularensis (strain FSC 198)
B0TXQ6 1.16e-62 194 56 2 171 3 aroK Shikimate kinase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q60BY3 3.6e-60 187 53 1 173 3 aroK Shikimate kinase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q87V14 6.47e-60 186 56 1 166 3 aroK Shikimate kinase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48PH1 1.79e-59 186 56 1 166 3 aroK Shikimate kinase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1WZB0 4.81e-59 184 53 2 174 3 aroK Shikimate kinase Halorhodospira halophila (strain DSM 244 / SL1)
Q4ZZE4 6.08e-59 184 55 1 166 3 aroK Shikimate kinase Pseudomonas syringae pv. syringae (strain B728a)
A6VDG0 4.64e-58 182 52 1 167 3 aroK Shikimate kinase Pseudomonas aeruginosa (strain PA7)
Q4KJI9 1.61e-57 181 52 1 168 3 aroK Shikimate kinase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P34003 1.82e-57 180 52 1 167 3 aroK Shikimate kinase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EX8 1.82e-57 180 52 1 167 3 aroK Shikimate kinase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3D2 1.82e-57 180 52 1 167 3 aroK Shikimate kinase Pseudomonas aeruginosa (strain LESB58)
B0V8M8 5.54e-57 179 52 2 171 3 aroK Shikimate kinase Acinetobacter baumannii (strain AYE)
B0VQ33 5.54e-57 179 52 2 171 3 aroK Shikimate kinase Acinetobacter baumannii (strain SDF)
Q1IGA8 7.94e-57 179 52 1 168 3 aroK Shikimate kinase Pseudomonas entomophila (strain L48)
Q88CV1 8.04e-56 176 51 1 168 3 aroK Shikimate kinase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WAB2 8.04e-56 176 51 1 168 3 aroK Shikimate kinase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B8GPV2 1.41e-55 176 54 1 166 3 aroK Shikimate kinase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q4FQI2 1.5e-55 176 50 1 168 3 aroK Shikimate kinase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q8Q8 2.11e-55 176 51 1 168 3 aroK Shikimate kinase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1QZY3 6.61e-55 174 53 1 162 3 aroK Shikimate kinase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q31DP8 9.56e-55 174 51 1 168 3 aroK Shikimate kinase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3KJA2 1.57e-54 173 51 1 166 3 aroK Shikimate kinase Pseudomonas fluorescens (strain Pf0-1)
Q2S9Q5 4.47e-54 172 49 1 167 3 aroK Shikimate kinase Hahella chejuensis (strain KCTC 2396)
Q3JEG4 5.52e-54 172 52 1 167 3 aroK Shikimate kinase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q6F7E4 1.26e-53 171 53 1 165 3 aroK Shikimate kinase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q7NZU3 4.02e-53 170 52 1 165 3 aroK Shikimate kinase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A5WCG4 5.61e-53 169 47 1 168 3 aroK Shikimate kinase Psychrobacter sp. (strain PRwf-1)
Q3SM89 2.56e-49 160 50 1 158 3 aroK Shikimate kinase Thiobacillus denitrificans (strain ATCC 25259)
Q39KC5 4.4e-49 159 49 1 166 3 aroK Shikimate kinase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2SU71 9.09e-48 156 48 1 166 3 aroK Shikimate kinase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q56 1.26e-47 155 48 1 166 3 aroK Shikimate kinase Burkholderia pseudomallei (strain K96243)
Q3JMW0 1.26e-47 155 48 1 166 3 aroK Shikimate kinase Burkholderia pseudomallei (strain 1710b)
Q62GA9 1.26e-47 155 48 1 166 3 aroK Shikimate kinase Burkholderia mallei (strain ATCC 23344)
A6W2T4 3.52e-47 154 44 2 175 3 aroK Shikimate kinase Marinomonas sp. (strain MWYL1)
Q46WJ3 7.28e-47 154 47 1 168 3 aroK Shikimate kinase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8XV61 1.67e-46 153 47 1 166 3 aroK Shikimate kinase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2L1Z2 7.54e-46 152 46 1 165 3 aroK Shikimate kinase Bordetella avium (strain 197N)
Q2YBB2 2.03e-45 150 46 1 169 3 aroK Shikimate kinase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A9KBB0 3.56e-45 149 45 2 164 3 aroK Shikimate kinase Coxiella burnetii (strain Dugway 5J108-111)
B6J4A3 4.65e-45 149 45 2 164 3 aroK Shikimate kinase Coxiella burnetii (strain CbuK_Q154)
Q7VT94 4.85e-45 150 47 2 166 3 aroK Shikimate kinase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2B7 4.85e-45 150 47 2 166 3 aroK Shikimate kinase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q47JK7 4.93e-45 149 47 2 168 3 aroK Shikimate kinase Dechloromonas aromatica (strain RCB)
Q7WR85 5.65e-45 150 47 2 166 3 aroK Shikimate kinase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5P5P2 1.82e-44 147 50 1 146 3 aroK Shikimate kinase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q83AJ3 1.6e-43 145 45 2 164 1 aroK Shikimate kinase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B6J3I0 1.6e-43 145 45 2 164 3 aroK Shikimate kinase Coxiella burnetii (strain CbuG_Q212)
A9NB80 1.85e-43 145 45 2 164 3 aroK Shikimate kinase Coxiella burnetii (strain RSA 331 / Henzerling II)
Q5H3H3 1.73e-42 142 41 1 167 3 aroK Shikimate kinase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SK35 1.73e-42 142 41 1 167 3 aroK Shikimate kinase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P6C8 1.73e-42 142 41 1 167 3 aroK Shikimate kinase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BQS2 2.06e-42 142 41 1 167 3 aroK Shikimate kinase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PI88 3.33e-42 142 41 1 167 3 aroK Shikimate kinase Xanthomonas axonopodis pv. citri (strain 306)
B2FQI7 3.92e-41 139 43 3 171 3 aroK Shikimate kinase Stenotrophomonas maltophilia (strain K279a)
B0U6C8 4.72e-41 139 38 1 167 3 aroK Shikimate kinase Xylella fastidiosa (strain M12)
Q87DU8 5.68e-41 139 38 1 167 3 aroK Shikimate kinase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9G1 5.68e-41 139 38 1 167 3 aroK Shikimate kinase Xylella fastidiosa (strain M23)
B4SSA3 7.29e-41 138 42 2 168 3 aroK Shikimate kinase Stenotrophomonas maltophilia (strain R551-3)
Q9PDP4 8.96e-41 138 38 1 167 3 aroK Shikimate kinase Xylella fastidiosa (strain 9a5c)
Q8P6X4 1.13e-39 135 40 2 168 3 aroK Shikimate kinase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UX85 1.13e-39 135 40 2 168 3 aroK Shikimate kinase Xanthomonas campestris pv. campestris (strain 8004)
Q5FAD3 1.45e-38 132 44 1 150 3 aroK Shikimate kinase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P63600 1.5e-38 132 44 1 150 3 aroK Putative shikimate kinase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P63599 1.5e-38 132 44 1 150 3 aroK Putative shikimate kinase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M1U5 1.5e-38 132 44 1 150 3 aroK Shikimate kinase Neisseria meningitidis serogroup C (strain 053442)
Q82TC0 7.6e-38 132 41 1 168 3 aroK Shikimate kinase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q3B009 2.76e-34 122 40 4 167 3 aroK Shikimate kinase Synechococcus sp. (strain CC9902)
Q6G1H5 4.39e-34 122 38 2 165 3 aroK Shikimate kinase Bartonella quintana (strain Toulouse)
A1TKW2 1.64e-33 120 47 2 149 3 aroK Shikimate kinase Paracidovorax citrulli (strain AAC00-1)
Q0S0N1 3.76e-33 118 41 3 170 3 aroK Shikimate kinase Rhodococcus jostii (strain RHA1)
Q98FY0 4.33e-33 119 38 2 170 3 aroK Shikimate kinase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2W095 6.13e-33 119 40 2 164 3 aroK Shikimate kinase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q8FY59 2.59e-32 117 37 2 167 3 aroK Shikimate kinase Brucella suis biovar 1 (strain 1330)
B0CJD1 2.59e-32 117 37 2 167 3 aroK Shikimate kinase Brucella suis (strain ATCC 23445 / NCTC 10510)
C0RFS0 2.59e-32 117 37 2 167 3 aroK Shikimate kinase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9B4 2.59e-32 117 37 2 167 3 aroK Shikimate kinase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57AM8 2.59e-32 117 37 2 167 3 aroK Shikimate kinase Brucella abortus biovar 1 (strain 9-941)
Q2YR42 2.59e-32 117 37 2 167 3 aroK Shikimate kinase Brucella abortus (strain 2308)
B2S8S9 2.59e-32 117 37 2 167 3 aroK Shikimate kinase Brucella abortus (strain S19)
Q3AH55 4.61e-32 116 37 4 169 3 aroK Shikimate kinase Synechococcus sp. (strain CC9605)
Q6NCG8 8.05e-32 116 38 2 167 3 aroK Shikimate kinase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7U469 8.85e-32 115 38 4 169 3 aroK Shikimate kinase Parasynechococcus marenigrum (strain WH8102)
A2C650 1.74e-31 115 40 4 169 3 aroK Shikimate kinase Prochlorococcus marinus (strain MIT 9303)
Q5LSY0 7.08e-31 113 38 2 158 3 aroK Shikimate kinase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q6G1N9 7.61e-31 114 33 2 165 3 aroK Shikimate kinase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B8H331 1.27e-30 113 38 2 166 3 aroK Shikimate kinase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A435 1.27e-30 113 38 2 166 3 aroK Shikimate kinase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9X5D1 2.04e-30 111 40 3 165 3 aroK Shikimate kinase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q7V904 3.76e-30 111 39 4 169 3 aroK Shikimate kinase Prochlorococcus marinus (strain MIT 9313)
Q3SVM9 4.6e-30 112 44 2 168 3 aroK Shikimate kinase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q89XW7 4.79e-30 112 39 2 169 3 aroK Shikimate kinase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P72796 1.03e-29 110 39 4 163 3 aroK Shikimate kinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q47QY8 1.2e-29 109 37 3 170 3 aroK Shikimate kinase Thermobifida fusca (strain YX)
A0LUH0 1.54e-29 109 39 3 164 3 aroK Shikimate kinase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q2RI74 2.03e-29 109 42 3 166 3 aroK Shikimate kinase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8FT30 2.78e-29 108 38 4 170 3 aroK Shikimate kinase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A4XLN3 3.36e-29 108 34 2 165 3 aroK Shikimate kinase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q3MFQ9 3.4e-29 108 36 4 166 3 aroK Shikimate kinase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
C0QR76 3.47e-29 108 37 2 163 3 aroK Shikimate kinase Persephonella marina (strain DSM 14350 / EX-H1)
O67925 3.51e-29 108 34 3 163 1 aroK Shikimate kinase Aquifex aeolicus (strain VF5)
B9MKD6 9.78e-29 107 34 2 165 3 aroK Shikimate kinase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B2V895 1.11e-28 107 36 3 163 3 aroK Shikimate kinase Sulfurihydrogenibium sp. (strain YO3AOP1)
Q46HR4 1.23e-28 108 36 4 168 3 aroK Shikimate kinase Prochlorococcus marinus (strain NATL2A)
A5GQN5 2.79e-28 107 37 4 166 3 aroK Shikimate kinase Synechococcus sp. (strain RCC307)
B5ZSI5 4.12e-28 106 36 2 166 3 aroK Shikimate kinase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q8YXG9 6.11e-28 105 35 4 164 3 aroK Shikimate kinase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q2RMW1 1.35e-27 105 37 2 158 3 aroK Shikimate kinase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B5YHI3 1.37e-27 104 38 2 168 3 aroK Shikimate kinase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q2G733 1.48e-27 105 35 4 174 3 aroK Shikimate kinase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B2IX35 3.42e-27 103 36 4 166 3 aroK Shikimate kinase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q6NH03 3.56e-27 103 37 3 165 3 aroK Shikimate kinase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A4FBE7 4.09e-27 103 38 2 160 3 aroK Shikimate kinase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q7VE85 4.44e-27 103 39 4 168 3 aroK Shikimate kinase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q8RF94 4.45e-27 103 36 0 155 3 aroK Shikimate kinase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
C0ZZB5 6e-27 102 39 2 168 3 aroK Shikimate kinase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q3J2I9 7.18e-27 103 33 2 167 3 aroK Shikimate kinase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q5NPY7 8.45e-27 102 37 2 168 3 aroK Shikimate kinase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A9BCW6 1.68e-26 102 40 4 160 3 aroK Shikimate kinase Prochlorococcus marinus (strain MIT 9211)
B1I3D6 2.36e-26 102 39 2 167 3 aroK Shikimate kinase Desulforudis audaxviator (strain MP104C)
Q72IW2 2.4e-26 101 42 3 152 3 aroK Shikimate kinase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q5SII4 3.35e-26 101 42 3 152 3 aroK Shikimate kinase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q92ME6 3.55e-26 101 35 2 164 3 aroK Shikimate kinase Rhizobium meliloti (strain 1021)
Q3ZZK9 4.53e-26 100 34 1 172 3 aroK Shikimate kinase Dehalococcoides mccartyi (strain CBDB1)
A5FRZ4 4.53e-26 100 34 1 172 3 aroK Shikimate kinase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q8RAE8 5.05e-26 100 36 2 163 3 aroK Shikimate kinase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A1JNV2 5.51e-26 100 37 5 171 3 aroL Shikimate kinase 2 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4TPJ4 6.91e-26 100 37 5 171 3 aroL Shikimate kinase 2 Yersinia pestis (strain Pestoides F)
Q1CLC0 6.91e-26 100 37 5 171 3 aroL Shikimate kinase 2 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2W3 6.91e-26 100 37 5 171 3 aroL Shikimate kinase 2 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC15 6.91e-26 100 37 5 171 3 aroL Shikimate kinase 2 Yersinia pestis
Q1C4F3 6.91e-26 100 37 5 171 3 aroL Shikimate kinase 2 Yersinia pestis bv. Antiqua (strain Antiqua)
A9VH19 9.49e-26 99 36 3 162 3 aroK Shikimate kinase Bacillus mycoides (strain KBAB4)
C3LKR2 1.24e-25 99 36 3 164 3 aroK Shikimate kinase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8E3 1.24e-25 99 36 3 164 3 aroK Shikimate kinase Bacillus anthracis (strain A0248)
B1JIG7 1.38e-25 99 37 5 171 3 aroL Shikimate kinase 2 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DY2 1.38e-25 99 37 5 171 3 aroL Shikimate kinase 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K6Q9 1.38e-25 99 37 5 171 3 aroL Shikimate kinase 2 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FLH5 1.38e-25 99 37 5 171 3 aroL Shikimate kinase 2 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q5N4D3 1.55e-25 99 36 4 166 3 aroK Shikimate kinase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31PU5 1.55e-25 99 36 4 166 3 aroK Shikimate kinase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q834S1 4.34e-25 98 37 3 168 3 aroK Shikimate kinase Enterococcus faecalis (strain ATCC 700802 / V583)
C1ERV8 4.52e-25 97 35 3 164 3 aroK Shikimate kinase Bacillus cereus (strain 03BB102)
Q9CCS5 4.59e-25 99 38 6 173 3 aroK Shikimate kinase Mycobacterium leprae (strain TN)
Q3A2J4 4.85e-25 98 41 5 173 3 aroK2 Shikimate kinase 2 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q72DN7 5.77e-25 97 35 2 164 3 aroK Shikimate kinase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q7NH27 6.9e-25 97 40 4 153 3 aroK Shikimate kinase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B3DXL1 6.92e-25 97 37 2 155 3 aroK Shikimate kinase Methylacidiphilum infernorum (isolate V4)
B7JZT6 7.05e-25 98 39 3 147 3 aroK Shikimate kinase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q2JKT7 1.23e-24 97 37 4 148 3 aroK Shikimate kinase Synechococcus sp. (strain JA-2-3B'a(2-13))
P9WPY3 1.3e-24 97 37 4 172 1 aroK Shikimate kinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPY2 1.3e-24 97 37 4 172 3 aroK Shikimate kinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U5N8 1.3e-24 97 37 4 172 3 aroK Shikimate kinase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KLN6 1.3e-24 97 37 4 172 3 aroK Shikimate kinase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A4Z3 1.3e-24 97 37 4 172 3 aroK Shikimate kinase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B7JMV9 1.3e-24 96 35 3 164 3 aroK Shikimate kinase Bacillus cereus (strain AH820)
A6LFQ8 1.54e-24 96 32 4 173 3 aroK Shikimate kinase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q3Z991 1.57e-24 96 34 1 166 3 aroK Shikimate kinase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A5D373 1.76e-24 96 34 2 169 3 aroK Shikimate kinase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q9KXQ5 1.87e-24 96 38 5 166 3 aroK Shikimate kinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P10880 2.29e-24 96 36 3 160 1 aroL Shikimate kinase 2 Dickeya chrysanthemi
B0JFW8 3.25e-24 96 38 3 151 3 aroK Shikimate kinase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q2NVB6 4.01e-24 95 37 4 157 3 aroL Shikimate kinase 2 Sodalis glossinidius (strain morsitans)
C6DB04 4.65e-24 95 35 3 161 3 aroL Shikimate kinase 2 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q2JRJ6 5.37e-24 95 34 5 159 3 aroK Shikimate kinase Synechococcus sp. (strain JA-3-3Ab)
B7IXM2 8.06e-24 94 35 3 164 3 aroK Shikimate kinase Bacillus cereus (strain G9842)
Q67N09 9.78e-24 94 40 2 169 3 aroK Shikimate kinase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q827R9 1.11e-23 94 36 3 165 3 aroK Shikimate kinase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8DKH7 1.26e-23 94 35 4 166 3 aroK Shikimate kinase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q4JVG1 1.82e-23 94 33 3 164 3 aroK Shikimate kinase Corynebacterium jeikeium (strain K411)
A7GSP5 2.21e-23 93 38 4 163 3 aroK Shikimate kinase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q74BL5 3.43e-23 93 35 2 172 3 aroK Shikimate kinase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
O50467 3.75e-23 92 40 1 121 3 aroK Shikimate kinase (Fragment) Neisseria gonorrhoeae
A4SFH8 3.99e-23 93 37 4 158 3 aroK Shikimate kinase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B9IXM6 4.26e-23 92 34 3 164 3 aroK Shikimate kinase Bacillus cereus (strain Q1)
B7HPD4 4.26e-23 92 34 3 164 3 aroK Shikimate kinase Bacillus cereus (strain AH187)
A8MFK5 4.32e-23 92 34 1 164 3 aroK Shikimate kinase Alkaliphilus oremlandii (strain OhILAs)
Q8G5X4 6.76e-23 97 29 2 176 3 aroB Bifunctional shikimate kinase/3-dehydroquinate synthase Bifidobacterium longum (strain NCC 2705)
Q3AR93 6.86e-23 92 38 5 174 3 aroK Shikimate kinase Chlorobium chlorochromatii (strain CaD3)
B6YQJ0 8.98e-23 92 41 2 126 3 aroK Shikimate kinase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q6D872 1.31e-22 91 34 3 161 3 aroL Shikimate kinase 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B8E0Z4 1.33e-22 91 35 3 166 3 aroK Shikimate kinase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q741J8 1.89e-22 91 39 5 174 3 aroK Shikimate kinase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QI60 1.89e-22 91 39 5 174 3 aroK Shikimate kinase Mycobacterium avium (strain 104)
Q83M66 1.95e-22 91 32 3 160 3 aroL Shikimate kinase 2 Shigella flexneri
B2U3Z0 1.95e-22 91 32 3 160 3 aroL Shikimate kinase 2 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3Z522 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Shigella sonnei (strain Ss046)
Q0T7K0 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Shigella flexneri serotype 5b (strain 8401)
Q325L0 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Shigella boydii serotype 4 (strain Sb227)
B1LIS2 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain SMS-3-5 / SECEC)
B6HZI8 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain SE11)
B7N8U0 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6E1 2.01e-22 91 32 3 160 1 aroL Shikimate kinase 2 Escherichia coli (strain K12)
B1J060 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6E2 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKQ3 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZX38 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O9:H4 (strain HS)
B1XEX7 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain K12 / DH10B)
C4ZTE7 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M333 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O8 (strain IAI1)
B5Z2U0 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6E3 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O157:H7
B7L543 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain 55989 / EAEC)
B7UJL2 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZID7 2.01e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O139:H28 (strain E24377A / ETEC)
B7NJB4 2.24e-22 91 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B3EIT1 2.45e-22 91 37 4 163 3 aroK Shikimate kinase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B2GCQ8 2.56e-22 90 34 2 166 3 aroK Shikimate kinase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B7MPE9 3.39e-22 90 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O81 (strain ED1a)
Q32JD7 4.3e-22 90 32 3 160 3 aroL Shikimate kinase 2 Shigella dysenteriae serotype 1 (strain Sd197)
A7MLV5 6.88e-22 90 36 4 168 3 aroL Shikimate kinase 2 Cronobacter sakazakii (strain ATCC BAA-894)
B0K0S9 8.63e-22 89 33 2 164 3 aroK Shikimate kinase Thermoanaerobacter sp. (strain X514)
B0K9C2 1.38e-21 89 33 2 164 3 aroK Shikimate kinase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q4L6N8 1.59e-21 89 33 4 172 3 aroK Shikimate kinase Staphylococcus haemolyticus (strain JCSC1435)
Q3B316 1.96e-21 89 33 2 158 3 aroK Shikimate kinase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q1RFF6 2.48e-21 88 31 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain UTI89 / UPEC)
A1A860 2.48e-21 88 31 3 160 3 aroL Shikimate kinase 2 Escherichia coli O1:K1 / APEC
B7MD47 2.48e-21 88 31 3 160 3 aroL Shikimate kinase 2 Escherichia coli O45:K1 (strain S88 / ExPEC)
Q8A2B2 3.15e-21 88 36 2 141 1 aroK Shikimate kinase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q64ZU2 3.46e-21 88 34 2 143 3 aroK Shikimate kinase Bacteroides fragilis (strain YCH46)
Q5LIQ7 3.46e-21 88 34 2 143 3 aroK Shikimate kinase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B3EPX3 3.99e-21 88 32 2 158 3 aroK Shikimate kinase Chlorobium phaeobacteroides (strain BS1)
B9E6S1 5.11e-21 87 33 2 154 3 aroK Shikimate kinase Macrococcus caseolyticus (strain JCSC5402)
Q8KCL0 5.45e-21 88 33 3 171 3 aroK Shikimate kinase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q7UU71 6.36e-21 87 31 2 170 3 aroK Shikimate kinase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
P37944 7.22e-21 87 34 4 169 3 aroK Shikimate kinase Bacillus subtilis (strain 168)
A4W763 1.07e-20 87 29 3 166 3 aroL Shikimate kinase 2 Enterobacter sp. (strain 638)
A8GAI2 1.33e-20 86 34 4 170 3 aroL Shikimate kinase 2 Serratia proteamaculans (strain 568)
Q39X05 1.47e-20 86 34 2 167 3 aroK Shikimate kinase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q7N7B0 2.1e-20 86 32 3 158 3 aroL Shikimate kinase 2 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B3QMM3 3.24e-20 85 33 2 164 3 aroK Shikimate kinase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A8LY07 3.27e-20 85 39 5 139 3 aroK Shikimate kinase Salinispora arenicola (strain CNS-205)
A8F9S1 3.6e-20 85 33 4 170 3 aroK Shikimate kinase Bacillus pumilus (strain SAFR-032)
B4TZG1 3.94e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella schwarzengrund (strain CVM19633)
B4S8Z9 3.95e-20 85 33 3 162 3 aroK Shikimate kinase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A1BER1 3.98e-20 85 33 2 162 3 aroK Shikimate kinase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q3A3N8 3.99e-20 85 33 4 168 3 aroK1 Shikimate kinase 1 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
P63603 4.2e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63604 4.2e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella typhi
B5BDE5 4.2e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella paratyphi A (strain AKU_12601)
A9MX50 4.2e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFV5 4.2e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5R5X9 4.2e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTD7 4.2e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella enteritidis PT4 (strain P125109)
B5EWS0 4.2e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella agona (strain SL483)
B4SW28 4.43e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella newport (strain SL254)
B4T8M7 4.43e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella heidelberg (strain SL476)
B3QSZ9 4.46e-20 85 32 2 162 3 aroK Shikimate kinase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q8ENM6 4.74e-20 85 32 3 168 3 aroK Shikimate kinase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A6L011 4.99e-20 85 34 2 141 3 aroK Shikimate kinase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
C0Q7R1 6.86e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella paratyphi C (strain RKS4594)
B5FKP3 6.86e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella dublin (strain CT_02021853)
Q57SH6 6.86e-20 85 32 3 166 3 aroL Shikimate kinase 2 Salmonella choleraesuis (strain SC-B67)
Q2J827 1.28e-19 85 39 2 148 3 aroK Shikimate kinase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A4X608 1.37e-19 84 36 3 166 3 aroK Shikimate kinase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q7VIH7 1.4e-19 84 34 5 170 3 aroK Shikimate kinase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q00497 1.59e-19 86 36 4 144 1 SK Shikimate kinase, chloroplastic Solanum lycopersicum
Q30XS2 2.62e-19 83 33 4 169 3 aroK Shikimate kinase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B1KT67 2.72e-19 83 32 2 158 3 aroK Shikimate kinase Clostridium botulinum (strain Loch Maree / Type A3)
A4IPN9 3.15e-19 83 32 4 170 3 aroK Shikimate kinase Geobacillus thermodenitrificans (strain NG80-2)
Q9RW93 3.9e-19 83 35 3 153 3 aroK Shikimate kinase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
C3KXE0 5.8e-19 82 31 2 158 3 aroK Shikimate kinase Clostridium botulinum (strain 657 / Type Ba4)
B2VIT0 6.22e-19 82 33 5 170 3 aroL Shikimate kinase 2 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q8NWC8 6.35e-19 82 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain MW2)
Q6G928 6.35e-19 82 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain MSSA476)
A4VTX6 6.51e-19 82 33 4 165 3 aroK Shikimate kinase Streptococcus suis (strain 05ZYH33)
A4W070 6.51e-19 82 33 4 165 3 aroK Shikimate kinase Streptococcus suis (strain 98HAH33)
Q65NN5 9.96e-19 81 30 5 171 3 aroK Shikimate kinase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A8Z477 1.05e-18 81 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain USA300 / TCH1516)
A6QH82 1.05e-18 81 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain Newman)
Q5HFM1 1.05e-18 81 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain COL)
Q2FY32 1.05e-18 81 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5KY95 1.15e-18 82 32 4 170 3 aroK Shikimate kinase Geobacillus kaustophilus (strain HTA426)
C9SE96 1.22e-18 85 32 4 166 3 VDBG_03429 Pentafunctional AROM polypeptide Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136)
B2HNC7 1.39e-18 81 36 4 172 3 aroK Shikimate kinase Mycobacterium marinum (strain ATCC BAA-535 / M)
A0PPH1 1.5e-18 81 36 4 172 3 aroK Shikimate kinase Mycobacterium ulcerans (strain Agy99)
A5I323 2.01e-18 80 32 3 159 3 aroK Shikimate kinase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FUV4 2.01e-18 80 32 3 159 3 aroK Shikimate kinase Clostridium botulinum (strain ATCC 19397 / Type A)
C1FPC6 2.15e-18 80 32 3 159 3 aroK Shikimate kinase Clostridium botulinum (strain Kyoto / Type A2)
Q1CV00 3.05e-18 80 35 5 151 3 aroK Shikimate kinase Helicobacter pylori (strain HPAG1)
B2URY7 3.11e-18 80 35 5 151 3 aroK Shikimate kinase Helicobacter pylori (strain Shi470)
Q6GGG1 3.71e-18 80 35 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain MRSA252)
P63606 3.87e-18 80 35 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain N315)
P63605 3.87e-18 80 35 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IT66 3.87e-18 80 35 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain JH9)
A6U209 3.87e-18 80 35 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain JH1)
A7X2S4 3.87e-18 80 35 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B2TQ47 4.26e-18 79 36 2 121 3 aroK Shikimate kinase Clostridium botulinum (strain Eklund 17B / Type B)
B5Z9T2 5.08e-18 79 35 5 151 3 aroK Shikimate kinase Helicobacter pylori (strain G27)
B7LMJ7 5.12e-18 80 32 3 160 3 aroL Shikimate kinase 2 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q5NTH4 5.72e-18 82 32 6 166 1 SK1 Shikimate kinase 1, chloroplastic Oryza sativa subsp. japonica
Q17YU7 6.69e-18 79 33 5 154 3 aroK Shikimate kinase Helicobacter acinonychis (strain Sheeba)
B6JPQ5 7.85e-18 79 35 5 151 3 aroK Shikimate kinase Helicobacter pylori (strain P12)
A6M250 8.54e-18 79 32 4 170 3 aroK Shikimate kinase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q9ZMS3 1.16e-17 78 34 5 151 3 aroK Shikimate kinase Helicobacter pylori (strain J99 / ATCC 700824)
P56073 1.2e-17 78 35 5 151 1 aroK Shikimate kinase Helicobacter pylori (strain ATCC 700392 / 26695)
Q2S4T0 1.25e-17 79 32 5 172 3 aroK Shikimate kinase Salinibacter ruber (strain DSM 13855 / M31)
B1IMQ2 1.45e-17 78 32 3 159 3 aroK Shikimate kinase Clostridium botulinum (strain Okra / Type B1)
Q2LUD6 1.97e-17 79 32 2 176 3 aroK Shikimate kinase Syntrophus aciditrophicus (strain SB)
A7GEL1 3.58e-17 77 31 3 159 3 aroK Shikimate kinase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B2UYK3 4.6e-17 77 34 2 121 3 aroK Shikimate kinase Clostridium botulinum (strain Alaska E43 / Type E3)
A6GZJ6 8.55e-17 76 29 5 171 3 aroK Shikimate kinase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q5NTH3 1.01e-16 79 33 6 166 1 SK2 Shikimate kinase 2, chloroplastic Oryza sativa subsp. japonica
A8AXY8 1.31e-16 75 31 4 160 3 aroK Shikimate kinase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q9KFH9 1.51e-16 76 34 4 145 3 aroK Shikimate kinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q49XY2 1.56e-16 75 30 3 162 3 aroK Shikimate kinase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A4RD09 2.2e-16 79 32 4 157 3 MGG_01128 Pentafunctional AROM polypeptide Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A5H2P4 2.49e-16 79 30 4 156 3 ARO1-2 Pentafunctional AROM polypeptide 2 Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
A5H2Q8 2.61e-16 79 30 4 156 3 ARO1-1 Pentafunctional AROM polypeptide 1 Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
Q7X7H9 4.84e-16 76 34 3 123 1 SK3 Shikimate kinase 3, chloroplastic Oryza sativa subsp. japonica
B6JVD0 6.71e-16 77 32 2 136 3 aro1 Pentafunctional AROM polypeptide Schizosaccharomyces japonicus (strain yFS275 / FY16936)
Q6CJC4 8.95e-16 77 32 6 168 3 ARO1 Pentafunctional AROM polypeptide Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
B0STS6 4.49e-15 72 30 3 176 3 aroK Shikimate kinase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SI62 4.49e-15 72 30 3 176 3 aroK Shikimate kinase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q9P7R0 7.06e-15 74 33 3 138 1 aro1 Pentafunctional AROM polypeptide Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8CSF2 1.09e-14 71 30 2 142 3 aroK Shikimate kinase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP11 1.09e-14 71 30 2 142 3 aroK Shikimate kinase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q03LG8 3.78e-14 69 32 5 162 3 aroK Shikimate kinase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q9SJ05 3.86e-14 71 33 4 124 1 SK1 Shikimate kinase 1, chloroplastic Arabidopsis thaliana
Q8X071 6.3e-14 72 29 5 157 3 aro-1 Pentafunctional AROM polypeptide Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
C7YZ74 6.37e-14 72 34 3 124 3 NECHADRAFT_47780 Pentafunctional AROM polypeptide Fusarium vanettenii (strain ATCC MYA-4622 / CBS 123669 / FGSC 9596 / NRRL 45880 / 77-13-4)
C5M1X2 1.34e-13 71 34 2 126 3 ARO1 Pentafunctional AROM polypeptide Candida tropicalis (strain ATCC MYA-3404 / T1)
B2B223 1.4e-13 71 31 5 161 3 Pa_6_5280 Pentafunctional AROM polypeptide Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383)
D1ZA70 2.53e-13 70 30 6 165 3 SMAC_02366 Pentafunctional AROM polypeptide Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell)
P07547 3.38e-13 70 31 5 164 1 aromA Pentafunctional AROM polypeptide Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8GY88 4.83e-13 68 33 4 124 1 SK2 Shikimate kinase 2, chloroplastic Arabidopsis thaliana
C5FQ73 7.08e-13 68 29 4 155 3 MCYG_04845 Pentafunctional AROM polypeptide Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
C5JKE6 8.1e-13 68 31 5 151 3 BDBG_02999 Pentafunctional AROM polypeptide Blastomyces gilchristii (strain SLH14081)
B6HAA7 1.11e-12 68 29 5 170 3 aroM Pentafunctional AROM polypeptide Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
C7GIN5 1.13e-12 68 31 5 165 3 ARO1 Pentafunctional AROM polypeptide Saccharomyces cerevisiae (strain JAY291)
C5DVG6 1.25e-12 68 34 6 156 3 ARO1 Pentafunctional AROM polypeptide Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229)
C8Z543 1.36e-12 68 31 5 165 3 ARO1 Pentafunctional AROM polypeptide Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse)
P08566 1.39e-12 68 31 5 165 1 ARO1 Pentafunctional AROM polypeptide Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A6ZY89 1.39e-12 68 31 5 165 3 ARO1 Pentafunctional AROM polypeptide Saccharomyces cerevisiae (strain YJM789)
B3LGE9 1.39e-12 68 31 5 165 3 ARO1 Pentafunctional AROM polypeptide Saccharomyces cerevisiae (strain RM11-1a)
C6HCG7 1.51e-12 68 30 5 155 3 HCDG_03716 Pentafunctional AROM polypeptide Ajellomyces capsulatus (strain H143)
Q4WS76 1.53e-12 68 30 4 162 3 aroM Pentafunctional AROM polypeptide Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0XRM8 1.57e-12 68 30 4 162 1 aroM Pentafunctional AROM polypeptide Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
A3LSZ2 1.63e-12 68 32 2 124 3 ARO1 Pentafunctional AROM polypeptide Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
C0NL63 1.66e-12 68 30 5 155 3 HCBG_03893 Pentafunctional AROM polypeptide Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432)
A1D244 1.83e-12 67 30 4 162 3 aroM Pentafunctional AROM polypeptide Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q6C1X5 2.17e-12 67 28 5 173 3 ARO1 Pentafunctional AROM polypeptide Yarrowia lipolytica (strain CLIB 122 / E 150)
P43906 2.71e-12 64 34 4 163 3 aroK Shikimate kinase Lactococcus lactis subsp. cremoris (strain MG1363)
Q04WV5 2.74e-12 65 27 5 181 3 aroK Shikimate kinase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04NM2 2.74e-12 65 27 5 181 3 aroK Shikimate kinase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B8N4Q9 4.41e-12 66 29 4 162 3 aroM Pentafunctional AROM polypeptide Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
Q2UCP6 4.77e-12 66 29 4 162 3 aroM Pentafunctional AROM polypeptide Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q6FIV4 4.86e-12 66 34 5 139 3 ARO1 Pentafunctional AROM polypeptide Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
C5PA86 5.3e-12 66 31 5 161 3 CPC735_008210 Pentafunctional AROM polypeptide Coccidioides posadasii (strain C735)
C1FYJ9 5.61e-12 66 30 5 155 3 PADG_00875 Pentafunctional AROM polypeptide Paracoccidioides brasiliensis (strain Pb18)
C0S433 5.89e-12 66 30 5 155 3 PABG_02447 Pentafunctional AROM polypeptide Paracoccidioides brasiliensis (strain Pb03)
C1H8L1 6.18e-12 66 30 5 155 3 PAAG_07102 Pentafunctional AROM polypeptide Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01)
B4U247 8.26e-12 63 30 5 163 3 aroK Shikimate kinase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C5G8R4 9.42e-12 65 31 5 151 3 BDCG_01028 Pentafunctional AROM polypeptide Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586)
A5FNY2 9.46e-12 63 32 3 124 3 aroK Shikimate kinase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q0V3H0 9.81e-12 65 26 4 173 3 SNOG_01444 Pentafunctional AROM polypeptide Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
B6QWH9 1.15e-11 65 31 5 164 3 aroM-1 Pentafunctional AROM polypeptide 1 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
Q5AME2 1.73e-11 65 30 2 126 1 ARO1 Pentafunctional AROM polypeptide Candida albicans (strain SC5314 / ATCC MYA-2876)
B9WFG1 1.78e-11 65 29 2 126 3 ARO1 Pentafunctional AROM polypeptide Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
A1CP85 2.29e-11 64 28 4 162 3 aroM Pentafunctional AROM polypeptide Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
C4JYG6 2.5e-11 64 30 5 155 3 UREG_07217 Pentafunctional AROM polypeptide Uncinocarpus reesii (strain UAMH 1704)
Q02XD2 2.61e-11 62 33 4 163 3 aroK Shikimate kinase Lactococcus lactis subsp. cremoris (strain SK11)
Q9WYI3 2.96e-11 64 40 4 145 3 aroKB Bifunctional shikimate kinase/3-dehydroquinate synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
C5DN02 3.63e-11 64 30 5 173 3 ARO1 Pentafunctional AROM polypeptide Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)
B8M0U4 6.5e-11 63 28 4 164 3 aroM Pentafunctional AROM polypeptide Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q8J294 7.1e-11 63 33 4 148 3 None Pentafunctional AROM polypeptide Thanatephorus cucumeris
B6QCA7 2.78e-10 61 29 5 164 3 aroM-2 Pentafunctional AROM polypeptide 2 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
Q9CEU1 4.44e-10 58 32 4 164 3 aroK Shikimate kinase Lactococcus lactis subsp. lactis (strain IL1403)
Q0D0F3 4.7e-10 60 27 4 161 3 aroM Pentafunctional AROM polypeptide Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q12659 5.27e-10 60 29 3 144 3 arom Pentafunctional AROM polypeptide Pneumocystis carinii
Q74ZZ1 5.69e-10 60 31 4 137 3 ARO1 Pentafunctional AROM polypeptide Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q5XNP0 1.63e-09 59 27 5 165 3 None Pentafunctional AROM polypeptide Sclerotinia sclerotiorum
A7F7H0 2.34e-09 58 27 5 165 3 SS1G_13550 Pentafunctional AROM polypeptide Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
Q9PK27 5.36e-09 56 30 3 119 3 aroK Shikimate kinase Chlamydia muridarum (strain MoPn / Nigg)
P0CM22 8.24e-09 57 33 2 110 3 CNB01990 Pentafunctional AROM polypeptide Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CM23 8.24e-09 57 33 2 110 3 CNBB3730 Pentafunctional AROM polypeptide Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
C4Y9D5 9.95e-09 57 28 5 156 3 ARO1 Pentafunctional AROM polypeptide Clavispora lusitaniae (strain ATCC 42720)
Q1J634 1.93e-08 54 29 7 171 3 aroK Shikimate kinase Streptococcus pyogenes serotype M4 (strain MGAS10750)
B5XM06 5.32e-08 53 31 6 164 3 aroK Shikimate kinase Streptococcus pyogenes serotype M49 (strain NZ131)
A2RE14 5.32e-08 53 31 6 164 3 aroK Shikimate kinase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JGC2 5.32e-08 53 31 6 164 3 aroK Shikimate kinase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JL88 5.32e-08 53 31 6 164 3 aroK Shikimate kinase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JB44 5.32e-08 53 31 6 164 3 aroK Shikimate kinase Streptococcus pyogenes serotype M12 (strain MGAS2096)
C4R4R8 5.34e-07 52 27 5 154 3 ARO1 Pentafunctional AROM polypeptide Komagataella phaffii (strain GS115 / ATCC 20864)
Q4P8F6 5.97e-07 52 31 9 169 3 UMAG_03607 Pentafunctional AROM polypeptide Ustilago maydis (strain 521 / FGSC 9021)
Q9Z6M1 6.49e-07 50 24 4 161 3 aroK Shikimate kinase Chlamydia pneumoniae
A8QCB2 8.69e-07 51 30 8 172 3 MGL_3989 Pentafunctional AROM polypeptide Malassezia globosa (strain ATCC MYA-4612 / CBS 7966)
O84372 1.3e-06 49 29 3 115 3 aroK Shikimate kinase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14970
Feature type CDS
Gene aroK
Product shikimate kinase AroK
Location 3323307 - 3323828 (strand: 1)
Length 522 (nucleotides) / 173 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1596
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01202 Shikimate kinase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0703 Amino acid transport and metabolism (E) E Shikimate kinase

Kegg Ortholog Annotation(s)

Protein Sequence

MAEKRNIFLVGPMGAGKSTIGRQLAQQLSMEFYDSDQEIERRTGADVGWVFDVEGEEGFRQREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETNIEKQLARTQRDKKRPLLQGVEPVRDVLETLAEERNPLYEEIADITIHTDDQSAKIVANQIIELLEKN

Flanking regions ( +/- flanking 50bp)

ATTTGGCGGGGCGGGTTATCATTAACGAATATCTTAGTAATACCAAAAACATGGCAGAGAAACGTAATATCTTTCTGGTTGGGCCTATGGGTGCCGGCAAAAGCACTATTGGTCGTCAGTTAGCTCAACAACTTAGTATGGAATTTTATGATTCCGATCAGGAAATTGAGCGACGTACAGGTGCAGATGTAGGTTGGGTATTTGATGTAGAAGGCGAAGAAGGCTTCCGTCAACGTGAAGAAAAAATAATCAACGAACTTACTGAAAAGCAAGGCATTGTACTGGCAACAGGTGGTGGTTCGGTGAAATCAAGAGAAACCCGTAACCGACTATCAGCACGCGGTGTTGTTGTTTATTTAGAAACCAACATTGAAAAACAACTTGCTCGTACTCAGCGAGATAAAAAACGTCCTTTATTGCAAGGTGTTGAACCCGTACGTGATGTACTGGAAACCCTCGCAGAAGAACGTAATCCTCTTTACGAAGAGATTGCTGATATCACCATTCATACTGATGATCAGAGTGCAAAAATCGTTGCAAATCAAATTATTGAATTATTAGAGAAAAACTAATAAATTCTTTAGATGAGATGAAAGTAAAGACTACTTGAAGAAGGCCGTTG