Homologs in group_354

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14950 FBDBKF_14950 91.7 Morganella morganii S1 putP Na+/proline symporter
EHELCC_11295 EHELCC_11295 91.7 Morganella morganii S2 putP Na+/proline symporter
NLDBIP_11640 NLDBIP_11640 91.7 Morganella morganii S4 putP Na+/proline symporter
LHKJJB_11500 LHKJJB_11500 91.7 Morganella morganii S3 putP Na+/proline symporter
HKOGLL_10110 HKOGLL_10110 91.7 Morganella morganii S5 putP Na+/proline symporter
F4V73_RS04925 F4V73_RS04925 26.5 Morganella psychrotolerans - sodium:solute symporter family protein
PMI_RS09590 PMI_RS09590 29.6 Proteus mirabilis HI4320 - sodium/sugar symporter

Distribution of the homologs in the orthogroup group_354

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_354

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EZY7 0.0 988 100 0 496 1 siaT Sodium/sialic acid symporter SiaT Proteus mirabilis (strain HI4320)
Q5E733 0.0 703 68 2 495 3 nanT Sodium/sialic acid symporter NanT Aliivibrio fischeri (strain ATCC 700601 / ES114)
P96169 1.93e-36 145 26 9 463 1 sglT Sodium/glucose cotransporter Vibrio parahaemolyticus
Q8N695 8.18e-36 144 30 15 454 1 SLC5A8 Sodium-coupled monocarboxylate transporter 1 Homo sapiens
Q9XT77 2.64e-34 139 26 10 460 2 SLC5A6 Sodium-dependent multivitamin transporter Oryctolagus cuniculus
Q92911 3.85e-33 136 27 15 444 1 SLC5A5 Sodium/iodide cotransporter Homo sapiens
P83740 5.91e-33 135 26 8 458 2 CG32669 Putative sodium-dependent multivitamin transporter Drosophila melanogaster
O70247 6.03e-33 135 26 15 466 1 Slc5a6 Sodium-dependent multivitamin transporter Rattus norvegicus
Q9Y289 1e-32 135 26 9 457 1 SLC5A6 Sodium-dependent multivitamin transporter Homo sapiens
Q7SYH5 2.58e-32 134 27 11 435 2 slc5a8 Sodium-coupled monocarboxylate transporter 1 Xenopus laevis
Q5BL81 3.79e-32 133 27 11 435 2 slc5a8 Sodium-coupled monocarboxylate transporter 1 Xenopus tropicalis
Q8BYF6 1.29e-31 131 28 15 456 1 Slc5a8 Sodium-coupled monocarboxylate transporter 1 Mus musculus
Q3ZMH1 2.39e-30 128 26 14 473 1 slc5a8 Sodium-coupled monocarboxylate transporter 1 Danio rerio
Q63008 5.15e-29 124 25 17 481 1 Slc5a5 Sodium/iodide cotransporter Rattus norvegicus
Q99PN0 7.91e-29 123 25 16 494 1 Slc5a5 Sodium/iodide cotransporter Mus musculus
Q7T384 1.29e-27 120 25 13 438 1 slc5a12 Sodium-coupled monocarboxylate transporter 2 Danio rerio
Q5U4D8 2.19e-26 116 26 12 377 1 Slc5a6 Sodium-dependent multivitamin transporter Mus musculus
Q49B93 2.53e-26 116 25 15 462 1 Slc5a12 Sodium-coupled monocarboxylate transporter 2 Mus musculus
Q1EHB4 9.72e-26 114 23 12 459 1 SLC5A12 Sodium-coupled monocarboxylate transporter 2 Homo sapiens
A7MBD8 1.31e-24 110 23 12 462 2 SLC5A12 Sodium-coupled monocarboxylate transporter 2 Bos taurus
P53791 6.23e-24 108 22 11 468 2 SLC5A1 Sodium/glucose cotransporter 1 Ovis aries
Q8VDT1 3.74e-22 103 23 12 454 1 Slc5a9 Sodium/glucose cotransporter 4 Mus musculus
D3ZIS0 6.21e-22 102 22 13 480 3 Slc5a4 Solute carrier family 5 member 4 Rattus norvegicus
Q5SWY8 2.53e-21 100 25 15 461 1 Slc5a10 Sodium/mannose cotransporter SLC5A10 Mus musculus
Q9NY91 6.88e-21 99 22 14 475 1 SLC5A4 Probable glucose sensor protein SLC5A4 Homo sapiens
Q91ZP4 1.49e-20 98 23 14 486 2 Slc5a4b Solute carrier family 5 member 4B Mus musculus
Q8C3K6 1.74e-20 98 23 12 476 1 Slc5a1 Sodium/glucose cotransporter 1 Mus musculus
A0PJK1 2.45e-20 97 25 13 459 1 SLC5A10 Sodium/mannose cotransporter SLC5A10 Homo sapiens
Q9ET37 3.06e-20 97 22 15 481 1 Slc5a4a Solute carrier family 5 member 4A Mus musculus
P53792 3.71e-20 97 23 15 460 1 Slc5a2 Sodium/glucose cotransporter 2 Rattus norvegicus
P31448 5.02e-20 96 23 9 444 1 yidK Uncharacterized symporter YidK Escherichia coli (strain K12)
P53790 6.59e-20 96 23 12 476 2 Slc5a1 Sodium/glucose cotransporter 1 Rattus norvegicus
P11170 7.11e-20 96 22 11 474 1 SLC5A1 Sodium/glucose cotransporter 1 Oryctolagus cuniculus
P31636 7.21e-20 96 24 16 479 1 SLC5A4 Solute carrier family 5 member 4 Sus scrofa
Q923I7 9.33e-20 96 23 15 466 1 Slc5a2 Sodium/glucose cotransporter 2 Mus musculus
A8WHP3 2.47e-19 94 23 15 458 2 slc5a9 Sodium/glucose cotransporter 4 Danio rerio
P13866 5.42e-19 94 23 13 461 1 SLC5A1 Sodium/glucose cotransporter 1 Homo sapiens
Q2M3M2 8.08e-19 93 24 13 450 1 SLC5A9 Sodium/glucose cotransporter 4 Homo sapiens
Q9JKZ2 1.96e-18 92 23 13 475 1 Slc5a3 Sodium/myo-inositol cotransporter Mus musculus
P31639 2.8e-18 91 23 15 464 1 SLC5A2 Sodium/glucose cotransporter 2 Homo sapiens
Q5FY69 5.07e-18 90 24 15 460 2 SLC5A10 Sodium/mannose cotransporter SLC5A10 Sus scrofa
P26429 5.53e-18 90 22 13 453 2 SLC5A1 Sodium/glucose cotransporter 1 (Fragment) Sus scrofa
P53794 8.8e-18 90 23 12 455 1 SLC5A3 Sodium/myo-inositol cotransporter Homo sapiens
P53793 2.21e-17 89 23 12 464 3 SLC5A3 Sodium/myo-inositol cotransporter Bos taurus
P31637 7.59e-17 87 22 10 448 1 SLC5A3 Sodium/myo-inositol cotransporter Canis lupus familiaris
Q6R4Q5 8.69e-17 86 24 12 472 2 SLC5A10 Sodium/mannose cotransporter SLC5A10 Bos taurus
P94392 7.01e-16 83 24 14 454 1 putP High-affinity proline transporter PutP Bacillus subtilis (strain 168)
P26430 9.78e-16 83 22 15 469 2 SLC5A2 Sodium/glucose cotransporter 2 Oryctolagus cuniculus
Q3ZC26 2.23e-15 82 22 13 463 2 SLC5A11 Sodium/myo-inositol cotransporter 2 Bos taurus
Q8WWX8 2.81e-15 82 22 14 463 1 SLC5A11 Sodium/myo-inositol cotransporter 2 Homo sapiens
A8I1B9 7.02e-15 80 23 14 464 2 SLC5A11 Sodium/myo-inositol cotransporter 2 Sus scrofa
Q8K0E3 8.14e-15 80 22 14 464 1 Slc5a11 Sodium/myo-inositol cotransporter 2 Mus musculus
Q28728 3.74e-14 78 22 12 463 1 SLC5A11 Sodium/myo-inositol cotransporter 2 Oryctolagus cuniculus
Q9Z1F2 2.29e-13 76 22 15 462 1 Slc5a11 Sodium/myo-inositol cotransporter 2 Rattus norvegicus
Q28610 9.18e-13 74 24 14 466 2 SLC5A10 Sodium/mannose cotransporter SLC5A10 Oryctolagus cuniculus
A1JIK1 1.32e-12 73 20 8 382 3 actP Cation/acetate symporter ActP Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P45174 3.95e-12 72 23 18 467 3 putP Sodium/proline symporter Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7NA72 1.88e-11 70 20 5 363 3 actP Cation/acetate symporter ActP Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P16256 2e-11 69 24 14 461 1 panF Sodium/pantothenate symporter Escherichia coli (strain K12)
A7FNG3 3.11e-11 69 19 8 383 3 actP Cation/acetate symporter ActP Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TS08 3.31e-11 69 19 8 383 3 actP Cation/acetate symporter ActP Yersinia pestis (strain Pestoides F)
Q1CE35 3.31e-11 69 19 8 383 3 actP Cation/acetate symporter ActP Yersinia pestis bv. Antiqua (strain Nepal516)
A9R563 3.31e-11 69 19 8 383 3 actP Cation/acetate symporter ActP Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ73 3.31e-11 69 19 8 383 3 actP Cation/acetate symporter ActP Yersinia pestis
Q1C0M8 3.31e-11 69 19 8 383 3 actP Cation/acetate symporter ActP Yersinia pestis bv. Antiqua (strain Antiqua)
B1JNK6 3.49e-11 68 19 8 383 3 actP Cation/acetate symporter ActP Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FN0 3.49e-11 68 19 8 383 3 actP Cation/acetate symporter ActP Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K137 3.49e-11 68 19 8 383 3 actP Cation/acetate symporter ActP Yersinia pseudotuberculosis serotype IB (strain PB1/+)
C6D930 2.87e-10 66 19 9 384 3 actP Cation/acetate symporter ActP Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D913 3.03e-10 66 20 9 384 3 actP Cation/acetate symporter ActP Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VKE4 4.69e-10 65 21 10 380 3 actP Cation/acetate symporter ActP Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C0Q552 7.5e-10 65 19 6 369 3 actP Cation/acetate symporter ActP Salmonella paratyphi C (strain RKS4594)
B5R937 7.83e-10 64 19 6 370 3 actP Cation/acetate symporter ActP Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ97 8.04e-10 64 19 6 370 3 actP Cation/acetate symporter ActP Salmonella enteritidis PT4 (strain P125109)
B5FRF0 8.04e-10 64 19 6 370 3 actP Cation/acetate symporter ActP Salmonella dublin (strain CT_02021853)
A9MGK8 8.04e-10 64 19 6 370 3 actP Cation/acetate symporter ActP Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q83P94 8.11e-10 64 20 7 370 3 actP Cation/acetate symporter ActP Shigella flexneri
B4T1W9 8.18e-10 64 19 6 371 3 actP Cation/acetate symporter ActP Salmonella newport (strain SL254)
Q8ZKF8 8.47e-10 64 19 6 371 3 actP Cation/acetate symporter ActP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TRK2 8.47e-10 64 19 6 371 3 actP Cation/acetate symporter ActP Salmonella schwarzengrund (strain CVM19633)
B5BJZ5 8.47e-10 64 19 6 371 3 actP Cation/acetate symporter ActP Salmonella paratyphi A (strain AKU_12601)
A9N1R2 8.47e-10 64 19 6 371 3 actP Cation/acetate symporter ActP Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJ05 8.47e-10 64 19 6 371 3 actP Cation/acetate symporter ActP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TEB2 8.47e-10 64 19 6 371 3 actP Cation/acetate symporter ActP Salmonella heidelberg (strain SL476)
B5F2E9 8.47e-10 64 19 6 371 3 actP Cation/acetate symporter ActP Salmonella agona (strain SL483)
Q57GV4 8.78e-10 64 19 6 370 3 actP Cation/acetate symporter ActP Salmonella choleraesuis (strain SC-B67)
A8AN31 1.07e-09 64 19 6 370 3 actP Cation/acetate symporter ActP Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q1R3J9 1.75e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli (strain UTI89 / UPEC)
B1LPN2 1.75e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli (strain SMS-3-5 / SECEC)
Q0T9Y2 1.75e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIQ8 1.75e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O1:K1 / APEC
B7MSH6 1.75e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O81 (strain ED1a)
B7NSM7 1.75e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MJT5 1.75e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPN5 1.75e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7NG10 1.82e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7LMN9 1.83e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5Z1C8 1.83e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X5T7 1.83e-09 63 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O157:H7
A8A7G7 3.62e-09 62 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O9:H4 (strain HS)
B7M7Y0 3.62e-09 62 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O8 (strain IAI1)
P39599 3.71e-09 62 21 12 401 3 ywcA Uncharacterized symporter YwcA Bacillus subtilis (strain 168)
B6I5T5 3.95e-09 62 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli (strain SE11)
P32705 3.95e-09 62 19 6 370 1 actP Cation/acetate symporter ActP Escherichia coli (strain K12)
B1IUI4 3.95e-09 62 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XCV3 3.95e-09 62 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli (strain K12 / DH10B)
C5A160 3.95e-09 62 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli (strain K12 / MC4100 / BW2952)
B7LB16 3.95e-09 62 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli (strain 55989 / EAEC)
A7ZUU1 3.95e-09 62 19 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31TS7 4.24e-09 62 19 6 370 3 actP Cation/acetate symporter ActP Shigella boydii serotype 4 (strain Sb227)
Q8Z1R2 4.71e-09 62 19 5 364 3 actP Cation/acetate symporter ActP Salmonella typhi
Q8FAZ0 9.4e-09 61 18 6 370 3 actP Cation/acetate symporter ActP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B2TXA0 1.32e-08 60 18 6 370 3 actP Cation/acetate symporter ActP Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
O06493 2.99e-08 59 22 11 456 1 opuE Osmoregulated proline transporter OpuE Bacillus subtilis (strain 168)
P10502 3.35e-08 59 22 11 389 1 putP Sodium/proline symporter Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3YUR7 4.19e-08 59 18 6 370 3 actP Cation/acetate symporter ActP Shigella sonnei (strain Ss046)
A4W5I3 1.1e-07 58 21 8 378 3 actP Cation/acetate symporter ActP Enterobacter sp. (strain 638)
Q4A070 9.51e-07 55 22 18 503 3 putP1 Sodium/proline symporter 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A6TGZ7 1.55e-06 54 20 6 388 3 actP Cation/acetate symporter ActP Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XXT7 1.55e-06 54 20 6 388 3 actP Cation/acetate symporter ActP Klebsiella pneumoniae (strain 342)
P07117 4.5e-06 52 22 12 389 1 putP Sodium/proline symporter Escherichia coli (strain K12)
P44963 0.000145 48 23 10 335 3 panF Sodium/pantothenate symporter Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q49YU6 0.001 45 21 16 467 3 putP2 Sodium/proline symporter 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14715
Feature type CDS
Gene -
Product sodium:solute symporter
Location 3262292 - 3263782 (strand: -1)
Length 1491 (nucleotides) / 496 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_354
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00474 Sodium:solute symporter family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0591 Amino acid transport and metabolism (E) E Na+/proline symporter

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03307 solute:Na+ symporter, SSS family - -

Protein Sequence

MQLHDFGFINYAVLFGYLAAMLLVGVYFSKRQKTADDYFRGGGRVPGWAAGVSVFATTLSSITFMSIPAKAYTSDWTFIIGQYLAIAILPLVFYFYIPFFRKLKITSAYEYLEARFDVRSRLFASLSFMLFHIGRVAIITYLTVLALRPFMGIDPVVLIVLISLLCIIYTWMGGIEGVIWTDVIQGLLLSGGAVLIFIMICFKVDGGISEIFTTTAQADKFFPTTQWRWSWTDSTIPVLMIGFLFANIQQFTASQDVVQRYIVTDSIKETKRTLITNAKLVAIIPIFFFAIGSALFVYYQQNPSLLPAGFNTGGILPLFIVTEMPIGIAGLIIAAIFAAAQSSISSSLNSISSCFNSDIYTRLSKSSPSPEQKMKVAKLVIIVAGIFSSLAAIWLVLSDEAEIWDAFNSLIGLMGGPMTGLFMLGIFVKRANAGSAVVGIIVSIIAVLAARYGSDLNFFFYGVIGSMSVVIAGTITAPLFAPAKQLSLDDSETSEN

Flanking regions ( +/- flanking 50bp)

AAAACTGTCGTAAAACTTACCTTTTACCCTACATATGGCAGGACTAAAAAATGCAATTACATGATTTTGGTTTTATTAACTATGCAGTGCTGTTTGGCTATTTGGCAGCTATGTTACTCGTGGGTGTTTATTTTTCTAAACGTCAAAAAACTGCGGATGACTATTTCCGTGGTGGAGGGCGAGTTCCTGGGTGGGCCGCTGGTGTGTCTGTATTTGCGACCACATTAAGCTCGATTACATTTATGTCCATTCCTGCTAAAGCTTATACTTCTGATTGGACCTTTATTATTGGACAGTATTTAGCTATTGCAATTTTACCTTTAGTTTTTTATTTCTATATTCCTTTTTTTAGAAAATTAAAAATCACCTCCGCTTATGAATATCTAGAAGCTCGTTTTGATGTTCGTAGTCGTTTATTTGCTAGCCTTTCATTTATGTTATTCCATATTGGGCGTGTTGCTATTATTACTTATTTAACCGTACTAGCTTTACGTCCTTTTATGGGGATTGATCCGGTCGTGTTAATCGTATTAATAAGCTTATTATGCATTATTTATACTTGGATGGGGGGCATTGAAGGCGTTATTTGGACGGATGTTATTCAAGGTTTATTACTTTCTGGTGGTGCTGTACTGATCTTTATTATGATCTGTTTTAAAGTTGATGGTGGTATTAGCGAAATTTTTACTACTACAGCACAAGCAGATAAATTCTTTCCTACCACACAATGGCGCTGGAGTTGGACAGATAGCACTATTCCTGTATTAATGATTGGGTTTTTATTTGCCAATATTCAGCAATTTACTGCTAGTCAGGATGTTGTGCAGCGCTATATCGTTACCGATTCTATTAAAGAAACTAAACGTACATTGATAACTAACGCTAAATTAGTGGCTATTATTCCTATTTTCTTTTTTGCCATCGGCTCTGCATTGTTTGTTTACTACCAACAAAACCCAAGTTTATTACCCGCAGGATTTAATACGGGGGGAATTTTACCACTATTTATCGTGACGGAAATGCCTATCGGTATTGCAGGGTTAATTATTGCAGCTATTTTTGCTGCTGCACAATCAAGTATTTCTAGTAGTTTAAATAGTATTTCAAGTTGCTTTAATTCTGATATTTATACTCGTCTTAGTAAATCATCCCCTAGTCCTGAACAAAAAATGAAAGTCGCAAAGTTAGTTATTATTGTGGCAGGGATATTCAGTAGTTTAGCGGCAATTTGGTTAGTTTTATCCGATGAAGCTGAAATTTGGGATGCATTTAATAGCCTTATAGGTCTTATGGGCGGACCAATGACAGGCCTATTTATGCTGGGAATTTTTGTAAAACGTGCTAATGCCGGTAGCGCCGTTGTTGGGATCATCGTGAGTATTATTGCAGTATTGGCTGCACGTTATGGCAGTGATCTTAACTTCTTCTTCTATGGAGTCATTGGTTCAATGTCAGTGGTGATTGCAGGAACCATTACGGCACCACTTTTCGCACCAGCAAAACAGCTTTCCTTAGATGACAGTGAAACATCAGAGAACTAAGAAGGAATAATCTATGTTATTTGGACATTTATCTGATTTGGCGACTATGC