Homologs in group_354

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14950 FBDBKF_14950 27.9 Morganella morganii S1 putP Na+/proline symporter
EHELCC_11295 EHELCC_11295 27.9 Morganella morganii S2 putP Na+/proline symporter
NLDBIP_11640 NLDBIP_11640 27.9 Morganella morganii S4 putP Na+/proline symporter
LHKJJB_11500 LHKJJB_11500 27.9 Morganella morganii S3 putP Na+/proline symporter
HKOGLL_10110 HKOGLL_10110 27.9 Morganella morganii S5 putP Na+/proline symporter
F4V73_RS04925 F4V73_RS04925 23.9 Morganella psychrotolerans - sodium:solute symporter family protein
PMI_RS14715 PMI_RS14715 29.6 Proteus mirabilis HI4320 - sodium:solute symporter

Distribution of the homologs in the orthogroup group_354

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_354

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P96169 0.0 825 75 1 538 1 sglT Sodium/glucose cotransporter Vibrio parahaemolyticus
Q8K0E3 4.71e-77 259 33 10 464 1 Slc5a11 Sodium/myo-inositol cotransporter 2 Mus musculus
Q8WWX8 3.56e-75 254 33 10 469 1 SLC5A11 Sodium/myo-inositol cotransporter 2 Homo sapiens
Q28728 7.13e-74 250 32 9 462 1 SLC5A11 Sodium/myo-inositol cotransporter 2 Oryctolagus cuniculus
Q9Z1F2 5.54e-72 245 32 10 464 1 Slc5a11 Sodium/myo-inositol cotransporter 2 Rattus norvegicus
P53794 4.01e-70 241 33 12 486 1 SLC5A3 Sodium/myo-inositol cotransporter Homo sapiens
P26430 2.16e-69 238 30 9 469 2 SLC5A2 Sodium/glucose cotransporter 2 Oryctolagus cuniculus
P53793 3.98e-69 239 31 15 540 3 SLC5A3 Sodium/myo-inositol cotransporter Bos taurus
Q923I7 5.07e-69 238 31 9 469 1 Slc5a2 Sodium/glucose cotransporter 2 Mus musculus
P31637 6.79e-69 238 32 16 540 1 SLC5A3 Sodium/myo-inositol cotransporter Canis lupus familiaris
A8I1B9 1.13e-68 236 32 9 467 2 SLC5A11 Sodium/myo-inositol cotransporter 2 Sus scrofa
P53792 1.45e-68 236 31 9 469 1 Slc5a2 Sodium/glucose cotransporter 2 Rattus norvegicus
Q9JKZ2 1.16e-67 235 31 14 549 1 Slc5a3 Sodium/myo-inositol cotransporter Mus musculus
Q3ZC26 2.27e-67 233 33 9 463 2 SLC5A11 Sodium/myo-inositol cotransporter 2 Bos taurus
P31639 2.81e-66 230 30 9 469 1 SLC5A2 Sodium/glucose cotransporter 2 Homo sapiens
P13866 4.91e-66 229 30 9 466 1 SLC5A1 Sodium/glucose cotransporter 1 Homo sapiens
P11170 3.24e-65 227 30 7 470 1 SLC5A1 Sodium/glucose cotransporter 1 Oryctolagus cuniculus
Q6R4Q5 1.46e-64 224 32 7 473 2 SLC5A10 Sodium/mannose cotransporter SLC5A10 Bos taurus
Q5SWY8 1.74e-64 224 31 7 473 1 Slc5a10 Sodium/mannose cotransporter SLC5A10 Mus musculus
P53791 1.8e-64 225 30 8 469 2 SLC5A1 Sodium/glucose cotransporter 1 Ovis aries
Q91ZP4 2.37e-64 224 30 10 476 2 Slc5a4b Solute carrier family 5 member 4B Mus musculus
A0PJK1 2.31e-63 221 31 7 473 1 SLC5A10 Sodium/mannose cotransporter SLC5A10 Homo sapiens
Q5FY69 3.3e-61 215 31 7 476 2 SLC5A10 Sodium/mannose cotransporter SLC5A10 Sus scrofa
Q9NY91 6.29e-61 215 27 8 479 1 SLC5A4 Probable glucose sensor protein SLC5A4 Homo sapiens
D3ZIS0 7.21e-61 215 26 8 479 3 Slc5a4 Solute carrier family 5 member 4 Rattus norvegicus
Q8C3K6 4.27e-59 211 31 9 471 1 Slc5a1 Sodium/glucose cotransporter 1 Mus musculus
Q9ET37 6.14e-59 210 27 9 477 1 Slc5a4a Solute carrier family 5 member 4A Mus musculus
P53790 1.23e-58 209 31 9 471 2 Slc5a1 Sodium/glucose cotransporter 1 Rattus norvegicus
A8WHP3 1.23e-58 209 30 8 454 2 slc5a9 Sodium/glucose cotransporter 4 Danio rerio
P31636 2.03e-58 209 29 10 474 1 SLC5A4 Solute carrier family 5 member 4 Sus scrofa
P31448 5.36e-58 206 31 10 442 1 yidK Uncharacterized symporter YidK Escherichia coli (strain K12)
Q8VDT1 1.71e-57 206 30 9 475 1 Slc5a9 Sodium/glucose cotransporter 4 Mus musculus
P26429 2.36e-57 204 30 7 437 2 SLC5A1 Sodium/glucose cotransporter 1 (Fragment) Sus scrofa
Q2M3M2 9e-56 202 29 10 531 1 SLC5A9 Sodium/glucose cotransporter 4 Homo sapiens
Q28610 1.58e-50 186 30 7 472 2 SLC5A10 Sodium/mannose cotransporter SLC5A10 Oryctolagus cuniculus
Q5E733 4.73e-35 141 27 10 473 3 nanT Sodium/sialic acid symporter NanT Aliivibrio fischeri (strain ATCC 700601 / ES114)
B4EZY7 3.81e-27 118 28 10 459 1 siaT Sodium/sialic acid symporter SiaT Proteus mirabilis (strain HI4320)
Q5BL81 5.72e-26 115 26 12 458 2 slc5a8 Sodium-coupled monocarboxylate transporter 1 Xenopus tropicalis
Q92911 6.19e-26 115 25 17 458 1 SLC5A5 Sodium/iodide cotransporter Homo sapiens
Q63008 2.14e-25 114 24 14 483 1 Slc5a5 Sodium/iodide cotransporter Rattus norvegicus
Q7SYH5 1.45e-24 111 26 15 469 2 slc5a8 Sodium-coupled monocarboxylate transporter 1 Xenopus laevis
Q99PN0 3.78e-23 107 24 14 483 1 Slc5a5 Sodium/iodide cotransporter Mus musculus
Q9XT77 3.32e-22 104 26 17 475 2 SLC5A6 Sodium-dependent multivitamin transporter Oryctolagus cuniculus
O70247 4.85e-22 103 24 16 477 1 Slc5a6 Sodium-dependent multivitamin transporter Rattus norvegicus
Q9Y289 4.96e-21 100 25 17 477 1 SLC5A6 Sodium-dependent multivitamin transporter Homo sapiens
A7MBD8 9.78e-21 99 23 12 461 2 SLC5A12 Sodium-coupled monocarboxylate transporter 2 Bos taurus
Q8N695 1.64e-20 99 24 17 476 1 SLC5A8 Sodium-coupled monocarboxylate transporter 1 Homo sapiens
Q7T384 3.3e-19 94 24 15 470 1 slc5a12 Sodium-coupled monocarboxylate transporter 2 Danio rerio
Q8BYF6 1.1e-18 93 25 14 460 1 Slc5a8 Sodium-coupled monocarboxylate transporter 1 Mus musculus
Q1EHB4 5.42e-18 90 22 12 469 1 SLC5A12 Sodium-coupled monocarboxylate transporter 2 Homo sapiens
P45174 6.91e-18 90 24 19 494 3 putP Sodium/proline symporter Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P94392 8.96e-18 89 26 17 449 1 putP High-affinity proline transporter PutP Bacillus subtilis (strain 168)
Q49B93 1.01e-17 90 23 13 470 1 Slc5a12 Sodium-coupled monocarboxylate transporter 2 Mus musculus
P10502 1.2e-17 89 27 15 408 1 putP Sodium/proline symporter Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5U4D8 2.18e-17 89 25 14 404 1 Slc5a6 Sodium-dependent multivitamin transporter Mus musculus
P07117 2.55e-17 88 27 14 407 1 putP Sodium/proline symporter Escherichia coli (strain K12)
O06493 1e-16 86 25 15 456 1 opuE Osmoregulated proline transporter OpuE Bacillus subtilis (strain 168)
Q3ZMH1 1.23e-15 83 24 25 512 1 slc5a8 Sodium-coupled monocarboxylate transporter 1 Danio rerio
P16256 8.39e-15 80 26 20 461 1 panF Sodium/pantothenate symporter Escherichia coli (strain K12)
P83740 3.84e-13 75 22 14 471 2 CG32669 Putative sodium-dependent multivitamin transporter Drosophila melanogaster
Q49YU6 1.71e-12 73 25 20 486 3 putP2 Sodium/proline symporter 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P44963 8.4e-11 68 23 16 478 3 panF Sodium/pantothenate symporter Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O02228 9.55e-11 68 26 18 434 2 cho-1 High-affinity choline transporter 1 Caenorhabditis elegans
Q6GFF5 2.32e-10 66 24 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain MRSA252)
Q9VE46 2.57e-10 66 22 13 504 2 ChT High-affinity choline transporter 1 Drosophila melanogaster
Q8CNP2 4.14e-10 65 24 20 490 3 putP Sodium/proline symporter Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q7A0H2 4.37e-10 65 24 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain MW2)
Q6G831 4.37e-10 65 24 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain MSSA476)
Q7A4Q7 4.37e-10 65 24 16 410 1 putP Sodium/proline symporter Staphylococcus aureus (strain N315)
Q99SY5 4.37e-10 65 24 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HEM0 4.37e-10 65 24 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain COL)
A5IU69 4.37e-10 65 24 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain JH9)
Q2FWY7 4.37e-10 65 24 16 410 1 putP Sodium/proline symporter Staphylococcus aureus (strain NCTC 8325 / PS 47)
A6U307 4.37e-10 65 24 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain JH1)
A7X430 4.37e-10 65 24 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q5HN32 5.72e-10 65 24 20 490 3 putP Sodium/proline symporter Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A8Z2R6 5.88e-10 65 24 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain USA300 / TCH1516)
Q2FFJ3 5.88e-10 65 24 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain USA300)
Q9URY6 6.91e-10 65 25 14 368 3 dur3-3 Probable urea active transporter 3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q2YU74 2.56e-09 63 23 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain bovine RF122 / ET3-1)
A6QID0 3.44e-09 63 23 16 410 3 putP Sodium/proline symporter Staphylococcus aureus (strain Newman)
Q9JMD7 3.97e-09 62 25 18 497 1 Slc5a7 High affinity choline transporter 1 Rattus norvegicus
Q4A070 4.81e-09 62 25 20 457 3 putP1 Sodium/proline symporter 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8BGY9 5.2e-09 62 25 18 497 1 Slc5a7 High affinity choline transporter 1 Mus musculus
Q53584 9.89e-09 61 23 16 410 3 putP Sodium/proline symporter Staphylococcus aureus
Q4L7L6 1.04e-08 61 25 22 479 3 putP Sodium/proline symporter Staphylococcus haemolyticus (strain JCSC1435)
Q9GZV3 1.43e-08 61 26 20 504 1 SLC5A7 High affinity choline transporter 1 Homo sapiens
A0A1D8PDB5 3.18e-08 60 25 11 374 3 DUR3 Spermidine transporter DUR3 Candida albicans (strain SC5314 / ATCC MYA-2876)
P39599 3.94e-08 59 23 14 473 3 ywcA Uncharacterized symporter YwcA Bacillus subtilis (strain 168)
Q7NA72 4.52e-08 59 21 19 470 3 actP Cation/acetate symporter ActP Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VKE4 1.86e-07 57 20 15 458 3 actP Cation/acetate symporter ActP Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B7LMN9 2.44e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5Z1C8 2.44e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X5T7 2.44e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O157:H7
B7NG10 2.73e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q1R3J9 2.78e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli (strain UTI89 / UPEC)
A1AIQ8 2.78e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O1:K1 / APEC
B7MSH6 2.78e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O81 (strain ED1a)
B7MJT5 2.78e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPN5 2.78e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1LPN2 3.11e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli (strain SMS-3-5 / SECEC)
Q0T9Y2 3.11e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NSM7 3.11e-07 57 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A8A7G7 3.17e-07 56 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O9:H4 (strain HS)
B7M7Y0 3.17e-07 56 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O8 (strain IAI1)
B6I5T5 3.22e-07 56 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli (strain SE11)
P32705 3.22e-07 56 20 15 461 1 actP Cation/acetate symporter ActP Escherichia coli (strain K12)
B1IUI4 3.22e-07 56 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XCV3 3.22e-07 56 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli (strain K12 / DH10B)
C5A160 3.22e-07 56 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli (strain K12 / MC4100 / BW2952)
B7LB16 3.22e-07 56 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli (strain 55989 / EAEC)
A7ZUU1 3.22e-07 56 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83P94 5.11e-07 56 20 15 461 3 actP Cation/acetate symporter ActP Shigella flexneri
C6D930 9.09e-07 55 20 17 467 3 actP Cation/acetate symporter ActP Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q3YUR7 9.47e-07 55 20 15 461 3 actP Cation/acetate symporter ActP Shigella sonnei (strain Ss046)
B5R937 1.11e-06 55 20 15 461 3 actP Cation/acetate symporter ActP Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q31TS7 1.25e-06 55 20 15 461 3 actP Cation/acetate symporter ActP Shigella boydii serotype 4 (strain Sb227)
Q8FAZ0 1.61e-06 54 20 15 461 3 actP Cation/acetate symporter ActP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8AN31 2.93e-06 53 20 14 463 3 actP Cation/acetate symporter ActP Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1JIK1 3.46e-06 53 21 19 481 3 actP Cation/acetate symporter ActP Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2TXA0 3.6e-06 53 20 15 461 3 actP Cation/acetate symporter ActP Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A4W5I3 3.86e-06 53 20 17 461 3 actP Cation/acetate symporter ActP Enterobacter sp. (strain 638)
A4TS08 4.37e-06 53 21 19 495 3 actP Cation/acetate symporter ActP Yersinia pestis (strain Pestoides F)
Q1CE35 4.37e-06 53 21 19 495 3 actP Cation/acetate symporter ActP Yersinia pestis bv. Antiqua (strain Nepal516)
A9R563 4.37e-06 53 21 19 495 3 actP Cation/acetate symporter ActP Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ73 4.37e-06 53 21 19 495 3 actP Cation/acetate symporter ActP Yersinia pestis
Q1C0M8 4.37e-06 53 21 19 495 3 actP Cation/acetate symporter ActP Yersinia pestis bv. Antiqua (strain Antiqua)
B5QZ97 4.97e-06 53 19 15 461 3 actP Cation/acetate symporter ActP Salmonella enteritidis PT4 (strain P125109)
B5FRF0 4.97e-06 53 19 15 461 3 actP Cation/acetate symporter ActP Salmonella dublin (strain CT_02021853)
A9MGK8 4.97e-06 53 19 15 461 3 actP Cation/acetate symporter ActP Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8ZKF8 5.01e-06 53 19 15 461 3 actP Cation/acetate symporter ActP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TRK2 5.01e-06 53 19 15 461 3 actP Cation/acetate symporter ActP Salmonella schwarzengrund (strain CVM19633)
B5BJZ5 5.01e-06 53 19 15 461 3 actP Cation/acetate symporter ActP Salmonella paratyphi A (strain AKU_12601)
A9N1R2 5.01e-06 53 19 15 461 3 actP Cation/acetate symporter ActP Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJ05 5.01e-06 53 19 15 461 3 actP Cation/acetate symporter ActP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TEB2 5.01e-06 53 19 15 461 3 actP Cation/acetate symporter ActP Salmonella heidelberg (strain SL476)
B5F2E9 5.01e-06 53 19 15 461 3 actP Cation/acetate symporter ActP Salmonella agona (strain SL483)
Q8Z1R2 5.28e-06 52 19 15 461 3 actP Cation/acetate symporter ActP Salmonella typhi
Q57GV4 5.61e-06 52 19 15 461 3 actP Cation/acetate symporter ActP Salmonella choleraesuis (strain SC-B67)
B4T1W9 6.5e-06 52 19 15 461 3 actP Cation/acetate symporter ActP Salmonella newport (strain SL254)
A7FNG3 6.63e-06 52 21 19 495 3 actP Cation/acetate symporter ActP Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JNK6 6.86e-06 52 21 19 495 3 actP Cation/acetate symporter ActP Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FN0 6.86e-06 52 21 19 495 3 actP Cation/acetate symporter ActP Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K137 6.86e-06 52 21 19 495 3 actP Cation/acetate symporter ActP Yersinia pseudotuberculosis serotype IB (strain PB1/+)
C0Q552 7.4e-06 52 19 15 461 3 actP Cation/acetate symporter ActP Salmonella paratyphi C (strain RKS4594)
Q6D913 1.98e-05 51 19 17 465 3 actP Cation/acetate symporter ActP Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
O34745 2.23e-05 50 21 19 468 2 yodF Uncharacterized symporter YodF Bacillus subtilis (strain 168)
P33413 4.23e-05 50 22 18 452 1 DUR3 Urea active transporter Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P31640 8.5e-05 49 29 8 199 3 H16_A2524 Uncharacterized symporter H16_A2524 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8UWF0 0.000395 47 24 17 493 2 CHT1 High-affinity choline transporter 1 Torpedo marmorata

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09590
Feature type CDS
Gene -
Product sodium/sugar symporter
Location 2093852 - 2095486 (strand: -1)
Length 1635 (nucleotides) / 544 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_354
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00474 Sodium:solute symporter family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4146 General function prediction only (R) R Uncharacterized membrane permease YidK, sodium:solute symporter family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03307 solute:Na+ symporter, SSS family - -

Protein Sequence

MHTEGVGLSTIDYAIFALYVIIIISLGLWVSRSKDGAKKGTKDYFLAGKTLPWWAIGSSLIAANISAEQFIGMSGSGFSIGLAIASYEWMAALTLIIVAKYFLPIFIEKGIYTIPEFVENRFKSRNLKTILAVFWLALFIFVNLTSVLYLGSLALETILGVPMMYAIIGLALFAVIYSLYGGLSAVAWTDVVQVFFLILGGLFTTVLAVSYIGGDGGIMEGLSKMTAAAPDHFKMILAKENPQFMNLPGIAVLIGGLWVANLYYWGFNQYIIQRALAAKSINEAQKGLVFAAFLKLIVPILVVVPGIAAFVITTDPTLMAGLGTMAQEHIPTLAQADKAYPWLTQFLPIGAKGVVFAALAAAIVSSLASMLNSIATIFTMDIYKEYIGPKSSETRLVNVGRISAVIALIIACFIAPLLGGIDQAFQYIQEYTGLVSPGILAVFLLGLFWKKTNAKGAIIGVVLSIPFALFLKLMPLGMPFLDQMMYTFIFTAVVIGLVSLTSTKSDDSVGAIVLTDATFKTQSGFNIASYIIMIILCVLYAVFW

Flanking regions ( +/- flanking 50bp)

ACGTTTACATTAATATTCTCTTCTCTCTATGGGTCTGAAAGGAAAATATTATGCATACAGAAGGTGTTGGATTAAGCACAATAGATTATGCAATCTTTGCCCTCTATGTCATCATTATTATTAGCCTTGGATTATGGGTTTCTCGTTCAAAAGATGGAGCTAAAAAAGGAACAAAGGATTACTTCCTCGCGGGTAAAACACTGCCTTGGTGGGCGATTGGTTCTTCTCTTATTGCTGCTAATATCTCAGCTGAGCAATTCATTGGTATGTCTGGCTCAGGATTTTCGATAGGTCTTGCTATTGCATCTTATGAATGGATGGCAGCATTGACGTTAATCATTGTTGCTAAATACTTTTTACCTATTTTTATTGAAAAAGGCATTTATACCATTCCTGAATTTGTTGAGAATCGTTTTAAAAGTCGTAATTTAAAGACGATCCTCGCCGTATTCTGGTTAGCACTCTTTATTTTCGTTAACTTAACATCTGTATTGTATTTAGGATCATTGGCGTTAGAAACCATTCTTGGTGTGCCGATGATGTATGCCATTATTGGTCTGGCACTATTTGCGGTTATCTACTCGCTTTACGGTGGACTTTCAGCGGTTGCATGGACGGATGTTGTACAAGTTTTCTTCCTGATCCTCGGTGGACTTTTCACGACCGTACTTGCTGTTAGCTATATCGGTGGTGATGGAGGAATAATGGAAGGCTTAAGTAAGATGACAGCCGCCGCGCCAGATCACTTTAAAATGATCTTAGCAAAAGAAAACCCACAATTTATGAATTTGCCAGGAATTGCTGTGCTAATCGGTGGGCTATGGGTTGCTAACCTCTATTACTGGGGCTTTAACCAATACATTATTCAGCGTGCTTTAGCTGCTAAATCTATTAATGAAGCGCAAAAAGGTTTAGTGTTTGCCGCTTTCTTAAAACTGATTGTGCCTATTTTAGTTGTTGTGCCGGGGATCGCAGCTTTTGTTATCACAACCGATCCTACGCTGATGGCAGGATTAGGAACAATGGCACAGGAGCATATCCCAACCTTAGCGCAAGCGGATAAAGCCTATCCTTGGTTAACACAATTCTTACCTATTGGGGCTAAAGGGGTTGTGTTTGCAGCACTGGCAGCAGCTATCGTTTCTTCTTTAGCTTCCATGCTTAACTCTATCGCGACTATTTTCACGATGGATATTTATAAAGAATATATTGGGCCAAAATCCTCAGAAACCCGCTTAGTTAATGTGGGACGTATTAGTGCGGTGATTGCATTGATTATTGCTTGCTTTATTGCGCCACTGTTAGGGGGCATTGATCAGGCATTCCAATATATCCAAGAGTACACAGGTTTAGTGAGTCCTGGTATCTTAGCTGTATTCTTGTTAGGACTATTTTGGAAGAAAACTAATGCCAAAGGGGCAATTATAGGGGTTGTACTCTCAATTCCTTTTGCTTTATTCCTAAAATTAATGCCACTAGGAATGCCATTCCTTGACCAAATGATGTATACCTTTATTTTCACCGCGGTTGTTATTGGTTTGGTCAGCTTAACCTCAACGAAAAGTGATGATAGCGTAGGGGCGATTGTATTAACTGATGCAACATTTAAAACCCAAAGTGGGTTCAATATTGCTTCTTATATCATTATGATCATCCTCTGTGTGCTTTATGCTGTATTTTGGTAATTAGTAATTAATTTTATTTATCAATGTATTACAAAAAAAAGCAGAGCCAA