Homologs in group_335

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13310 FBDBKF_13310 28.2 Morganella morganii S1 fepD ABC-type Fe3+-siderophore transport system, permease component
EHELCC_08785 EHELCC_08785 28.2 Morganella morganii S2 fepD ABC-type Fe3+-siderophore transport system, permease component
NLDBIP_09110 NLDBIP_09110 28.2 Morganella morganii S4 fepD ABC-type Fe3+-siderophore transport system, permease component
LHKJJB_05155 LHKJJB_05155 28.2 Morganella morganii S3 fepD ABC-type Fe3+-siderophore transport system, permease component
HKOGLL_05760 HKOGLL_05760 28.2 Morganella morganii S5 fepD ABC-type Fe3+-siderophore transport system, permease component
F4V73_RS03445 F4V73_RS03445 28.2 Morganella psychrotolerans - iron ABC transporter permease
PMI_RS06915 PMI_RS06915 30.4 Proteus mirabilis HI4320 - iron ABC transporter permease

Distribution of the homologs in the orthogroup group_335

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_335

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P94418 3.19e-94 285 46 1 308 1 yclN Petrobactin import system permease protein YclN Bacillus subtilis (strain 168)
Q81XB1 3.25e-91 278 46 1 289 1 fatD Petrobactin import system permease protein FatD Bacillus anthracis
P37738 1.5e-63 206 36 1 302 1 fatD Ferric-anguibactin transport system permease protein FatD Vibrio anguillarum (strain ATCC 68554 / 775)
P40410 2.53e-30 120 27 5 302 1 feuB Iron-uptake system permease protein FeuB Bacillus subtilis (strain 168)
P49936 2.46e-28 115 27 6 320 3 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Bacillus subtilis (strain 168)
A6TAH6 4.51e-25 106 30 10 302 3 btuC Vitamin B12 import system permease protein BtuC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A1JPQ9 5.33e-23 100 29 9 301 3 btuC Vitamin B12 import system permease protein BtuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P40411 1.06e-22 99 28 11 339 1 feuC Iron-uptake system permease protein FeuC Bacillus subtilis (strain 168)
Q57552 1.35e-22 99 26 5 296 3 MJ0087 Putative ABC transporter permease protein MJ0087 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q56992 1.63e-22 99 28 6 291 1 hmuU Hemin transport system permease protein HmuU Yersinia pestis
A8AHA4 1.5e-21 96 29 8 307 3 btuC Vitamin B12 import system permease protein BtuC Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3Z259 2.57e-21 95 30 8 302 3 btuC Vitamin B12 import system permease protein BtuC Shigella sonnei (strain Ss046)
B1JJ25 4.59e-21 95 26 8 306 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Z9 4.59e-21 95 26 8 306 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R099 4.59e-21 95 26 8 306 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX4 4.59e-21 95 26 8 306 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis
B2K660 4.59e-21 95 26 8 306 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHG9 4.59e-21 95 26 8 306 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9MFB6 1.9e-20 93 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P49937 3.66e-20 92 27 8 328 3 fhuG Iron(3+)-hydroxamate import system permease protein FhuG Bacillus subtilis (strain 168)
O34832 6.45e-20 92 28 6 311 3 yfmE Fe(3+)-citrate import system permease protein YfmE Bacillus subtilis (strain 168)
Q8Z6I5 8.43e-20 91 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhi
Q57PU6 9.04e-20 91 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella choleraesuis (strain SC-B67)
B4T4N5 1.09e-19 91 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella newport (strain SL254)
B5RAW6 1.09e-19 91 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW1 1.09e-19 91 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella enteritidis PT4 (strain P125109)
Q32FI8 1.13e-19 91 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Shigella dysenteriae serotype 1 (strain Sd197)
B5BA35 1.24e-19 90 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain AKU_12601)
Q5PH87 1.24e-19 90 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9KSL2 1.5e-19 90 27 6 316 3 btuC Vitamin B12 import system permease protein BtuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8ZPS8 1.81e-19 90 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUF7 1.81e-19 90 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella schwarzengrund (strain CVM19633)
A9N235 1.81e-19 90 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TGH8 1.81e-19 90 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella heidelberg (strain SL476)
B5FJA1 1.81e-19 90 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella dublin (strain CT_02021853)
B5F7F5 1.81e-19 90 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Salmonella agona (strain SL483)
A8GDR2 8.22e-19 89 29 8 277 3 btuC Vitamin B12 import system permease protein BtuC Serratia proteamaculans (strain 568)
O34451 9.03e-19 89 28 8 296 3 yvrB Uncharacterized ABC transporter permease protein YvrB Bacillus subtilis (strain 168)
O34933 1.19e-18 88 26 6 310 3 yfmD Fe(3+)-citrate import system permease protein YfmD Bacillus subtilis (strain 168)
P94419 7.43e-18 85 27 8 298 1 yclO Petrobactin import system permease protein YclO Bacillus subtilis (strain 168)
Q81L64 9.16e-18 87 28 5 275 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q81L64 6.57e-08 57 25 10 289 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
B5YPZ9 1.34e-17 85 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4L7 1.34e-17 85 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7
B1IPL6 1.36e-17 85 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q3 1.36e-17 85 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O9:H4 (strain HS)
B6I8R6 2.83e-17 84 30 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SE11)
Q7C1M5 3.54e-17 84 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri
O31569 3.6e-17 84 24 6 306 1 yfhA Probable siderophore transport system permease protein YfhA Bacillus subtilis (strain 168)
Q1RB84 3.83e-17 84 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain UTI89 / UPEC)
B1LE19 3.83e-17 84 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SMS-3-5 / SECEC)
P06609 3.83e-17 84 29 8 302 1 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12)
A1ABP7 3.83e-17 84 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O1:K1 / APEC
B1XG18 3.83e-17 84 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / DH10B)
C4ZYH3 3.83e-17 84 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / MC4100 / BW2952)
B7NT65 3.83e-17 84 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MAS2 3.83e-17 84 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O45:K1 (strain S88 / ExPEC)
B7L6I4 3.98e-17 84 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain 55989 / EAEC)
B7LQ78 4.79e-17 83 29 8 301 3 btuC Vitamin B12 import system permease protein BtuC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q7MLE7 5.05e-17 83 25 6 276 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain YJ016)
Q6D656 6.82e-17 83 27 10 310 3 btuC Vitamin B12 import system permease protein BtuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7M1C0 7.72e-17 83 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O8 (strain IAI1)
A7ZMH9 7.72e-17 83 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8D927 9.58e-17 82 26 6 276 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain CMCP6)
Q7N3Q3 1.48e-16 82 27 7 303 3 btuC Vitamin B12 import system permease protein BtuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B7N549 2.22e-16 81 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7US50 2.62e-16 81 29 9 303 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0T4S1 3.12e-16 81 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri serotype 5b (strain 8401)
Q8FH26 3.61e-16 81 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MVJ0 3.64e-16 81 29 8 302 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O81 (strain ED1a)
Q0THB7 4.73e-16 80 29 9 303 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B2U360 4.91e-16 80 30 7 279 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P15030 8.68e-16 80 27 5 276 1 fecC Fe(3+) dicitrate transport system permease protein FecC Escherichia coli (strain K12)
P15029 3.52e-15 78 26 10 311 1 fecD Fe(3+) dicitrate transport system permease protein FecD Escherichia coli (strain K12)
Q321G8 1.36e-14 76 29 7 279 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 4 (strain Sb227)
Q6LQ76 3.75e-14 75 27 8 308 3 btuC Vitamin B12 import system permease protein BtuC Photobacterium profundum (strain SS9)
O87656 9.54e-14 75 26 6 279 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O87656 1.23e-06 53 25 5 267 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P06972 1.1e-13 75 25 7 282 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P06972 5e-06 51 26 8 280 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P23876 2.04e-13 73 28 6 281 1 fepD Ferric enterobactin transport system permease protein FepD Escherichia coli (strain K12)
Q47086 4.07e-13 72 27 7 279 3 cbrC Achromobactin transport system permease protein CbrC Dickeya dadantii (strain 3937)
Q87Q39 5.12e-13 72 27 6 260 3 btuC Vitamin B12 import system permease protein BtuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q57130 7.29e-13 71 23 6 287 1 molB Molybdate import system permease protein MolB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q47085 8.09e-13 71 26 7 320 3 cbrB Achromobactin transport system permease protein CbrB Dickeya dadantii (strain 3937)
Q2YX91 9.56e-13 71 27 8 282 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GHV2 9.96e-12 68 40 0 85 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MRSA252)
Q7A651 9.96e-12 68 40 0 85 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain N315)
Q99UX0 9.96e-12 68 40 0 85 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG35 9.96e-12 68 40 0 85 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Newman)
Q5HGV0 9.96e-12 68 40 0 85 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain COL)
Q2FHU7 9.96e-12 68 40 0 85 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain USA300)
A7X154 9.96e-12 68 40 0 85 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8NX64 1.05e-11 68 40 0 85 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MW2)
Q6GA81 1.05e-11 68 40 0 85 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MSSA476)
O05731 3.14e-11 66 23 7 332 3 HP_0889 Probable iron chelatin transport system permease protein HP_0889 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZKW2 4.27e-11 66 25 4 272 3 jhp_0822 Probable iron chelatin transport system permease protein jhp_0822 Helicobacter pylori (strain J99 / ATCC 700824)
Q2FZE5 4e-09 60 38 1 85 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q58286 3.21e-08 57 22 8 315 3 MJ0876 Putative ABC transporter permease protein MJ0876 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P37737 4.69e-08 57 25 11 245 1 fatC Ferric-anguibactin transport system permease protein FatC Vibrio anguillarum (strain ATCC 68554 / 775)
O31568 2.12e-07 55 26 11 284 1 yfiZ Probable siderophore transport system permease protein YfiZ Bacillus subtilis (strain 168)
Q9HQ19 2.39e-07 55 26 7 286 1 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G3 2.39e-07 55 26 7 286 3 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P23877 8.89e-05 47 23 6 278 1 fepG Ferric enterobactin transport system permease protein FepG Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14625
Feature type CDS
Gene -
Product iron chelate uptake ABC transporter family permease subunit
Location 3241111 - 3242073 (strand: 1)
Length 963 (nucleotides) / 320 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_335
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01032 FecCD transport family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4606 Inorganic ion transport and metabolism (P) P ABC-type enterochelin transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K25284 iron-siderophore transport system permease protein - -

Protein Sequence

MKTFHLSLGIGLIAILSMISLFIGAGDITPASLFTDPDMRDIFFISRVPRTLSLLLAGGAISVAGLIMQLLTQNRFVEPSLAGTTQSASLGLLVVMLLFPAAGIFTKMMVATVFALLGTVLFMLLLQRIALKTALIVPLVGIMLSAVIGALTIFLAVYFDLLQSLDAWTSGDFSSVLQGRYELLWLVGALALMACWVADSFTVAGMGREFSINVGLNYRKVMIIGLSIIALISGVVVSVVGALPFLGLIVPNLVSLVMGDNIRKTIPWVCLSGGAIVLLCDVIGRLIRYPFEIPASVILGAVGAVIFLFLLLKQQRYAKS

Flanking regions ( +/- flanking 50bp)

TAATGGATACAATTAATCAGGCGTTGGATCAAAAAAAATAAAGTAACTGAATGAAAACGTTCCATTTATCATTGGGGATAGGACTTATCGCTATCCTCTCAATGATCAGTCTATTTATCGGCGCAGGAGATATCACTCCTGCTTCGCTTTTTACTGATCCCGATATGCGCGATATCTTCTTTATTAGTCGCGTACCAAGAACCCTGTCATTATTACTTGCTGGGGGCGCAATTAGTGTTGCTGGTTTAATCATGCAACTGCTCACGCAAAACCGCTTTGTTGAGCCTTCTCTTGCAGGTACAACACAATCAGCCAGTCTCGGTTTATTAGTCGTGATGTTGCTTTTCCCCGCGGCAGGCATTTTCACCAAAATGATGGTAGCCACTGTTTTTGCACTTTTAGGCACTGTGTTATTTATGTTGTTGCTACAGAGAATTGCCTTAAAGACCGCATTAATCGTGCCACTTGTCGGTATTATGCTAAGTGCAGTGATAGGTGCTCTAACCATCTTTCTTGCCGTCTATTTTGATTTACTACAATCACTAGATGCGTGGACTAGCGGAGACTTCTCCAGTGTCTTACAAGGTCGTTATGAGCTGCTATGGCTTGTCGGTGCCCTTGCATTAATGGCGTGTTGGGTCGCGGATAGCTTTACCGTGGCAGGTATGGGACGTGAATTTTCCATCAACGTTGGACTTAACTATCGTAAAGTGATGATTATCGGTTTATCTATTATCGCTTTAATTAGTGGTGTGGTGGTGTCTGTTGTTGGTGCTCTACCTTTCCTTGGTTTGATCGTGCCAAATTTAGTTAGCCTAGTGATGGGAGATAATATTCGCAAAACCATCCCGTGGGTATGCTTAAGCGGTGGAGCCATTGTTTTACTCTGTGATGTGATTGGTCGCCTGATCCGTTATCCATTTGAGATCCCCGCAAGTGTCATTTTAGGGGCGGTAGGTGCTGTGATCTTCCTTTTCTTACTACTGAAGCAGCAACGTTATGCAAAAAGTTAATTCATCCATGATTAGCAAATATACTGGCGCTGTTCAACCTAAGAAAGTGC