Homologs in group_2788

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08930 FBDBKF_08930 40.6 Morganella morganii S1 nikC nickel ABC transporter permease subunit NikC
EHELCC_10480 EHELCC_10480 40.6 Morganella morganii S2 nikC nickel ABC transporter permease subunit NikC
NLDBIP_10825 NLDBIP_10825 40.6 Morganella morganii S4 nikC nickel ABC transporter permease subunit NikC
LHKJJB_10530 LHKJJB_10530 40.6 Morganella morganii S3 nikC nickel ABC transporter permease subunit NikC
HKOGLL_13590 HKOGLL_13590 40.6 Morganella morganii S5 nikC nickel ABC transporter permease subunit NikC

Distribution of the homologs in the orthogroup group_2788

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2788

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A0A0H3JU73 3.95e-77 239 44 1 276 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FVE9 1.1e-76 238 44 1 276 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q83S25 1.7e-62 202 39 2 275 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri
P0C2L2 1.7e-62 202 39 2 275 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri serotype 5b (strain 8401)
P42063 1.89e-62 202 38 1 277 3 appC Oligopeptide transport system permease protein AppC Bacillus subtilis (strain 168)
Q3Z3V1 3.11e-62 201 39 2 275 3 gsiD Glutathione transport system permease protein GsiD Shigella sonnei (strain Ss046)
Q323W2 3.11e-62 201 39 2 275 3 gsiD Glutathione transport system permease protein GsiD Shigella boydii serotype 4 (strain Sb227)
Q8X6V6 3.11e-62 201 39 2 275 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O157:H7
Q8FJK8 3.24e-62 201 39 2 275 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJL6 3.24e-62 201 39 2 275 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P75799 5.81e-62 201 39 2 275 1 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain K12)
Q6D3B2 1.5e-61 199 40 4 276 3 gsiD Glutathione transport system permease protein GsiD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q1RE93 2.63e-61 199 39 2 275 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain UTI89 / UPEC)
A1A971 2.63e-61 199 39 2 275 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O1:K1 / APEC
Q32IB8 3.13e-61 199 39 2 275 3 gsiD Glutathione transport system permease protein GsiD Shigella dysenteriae serotype 1 (strain Sd197)
Q7CQV4 2.39e-56 186 40 3 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF88 2.39e-56 186 40 3 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhi
Q5PGP6 2.39e-56 186 40 3 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RA9 2.39e-56 186 40 3 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella choleraesuis (strain SC-B67)
Q7A0Y0 1.42e-53 178 38 0 234 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MW2)
Q6G9H9 1.42e-53 178 38 0 234 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MSSA476)
Q5HG39 1.42e-53 178 38 0 234 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain COL)
Q2FYQ6 1.42e-53 178 38 0 234 1 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH56 1.42e-53 178 38 0 234 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain USA300)
Q2YXY8 3.23e-53 177 38 0 234 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A5Q7 4.13e-53 177 38 0 234 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain N315)
Q99UA1 4.13e-53 177 38 0 234 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GH26 1.01e-52 176 38 0 234 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MRSA252)
P77463 1.05e-51 174 35 3 264 1 ddpC Probable D,D-dipeptide transport system permease protein DdpC Escherichia coli (strain K12)
P51000 3.38e-50 170 34 1 279 3 dppC Dipeptide transport system permease protein DppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P94312 5.93e-50 170 34 0 276 3 dppC Dipeptide transport system permease protein DppC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P0AFA9 1.64e-49 168 36 0 242 1 nikC Nickel transport system permease protein NikC Escherichia coli (strain K12)
P0AFB0 1.64e-49 168 36 0 242 3 nikC Nickel transport system permease protein NikC Escherichia coli O157:H7
A0A0H2ZFV0 5.02e-49 167 36 1 282 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
P26904 6.8e-46 160 33 1 273 2 dppC Dipeptide transport system permease protein DppC Bacillus subtilis (strain 168)
Q8FWN9 8.32e-44 154 33 1 269 3 BRA0407 Putative peptide permease protein BRA0407/BS1330_II0404 Brucella suis biovar 1 (strain 1330)
A5VU89 4.16e-43 152 33 1 269 3 BOV_A0350 Putative peptide permease protein BOV_A0350 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P24139 4.25e-43 152 32 2 278 1 oppC Oligopeptide transport system permease protein OppC Bacillus subtilis (strain 168)
Q8YBN8 8.13e-43 151 33 1 269 3 BMEII0861 Putative peptide permease protein BMEII0861 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YK65 8.13e-43 151 33 1 269 3 BAB2_0815 Putative peptide permease protein BAB2_0815 Brucella abortus (strain 2308)
Q577J7 8.13e-43 151 33 1 269 3 BruAb2_0794 Putative peptide permease protein BruAb2_0794 Brucella abortus biovar 1 (strain 9-941)
P0AEG1 1.91e-42 150 36 1 279 1 dppC Dipeptide transport system permease protein DppC Escherichia coli (strain K12)
P0AEG2 1.91e-42 150 36 1 279 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG3 1.91e-42 150 36 1 279 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O157:H7
Q8YDG8 9.97e-41 145 31 1 267 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 9.97e-41 145 31 1 267 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 9.97e-41 145 31 1 267 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)
Q53192 1.06e-40 145 33 1 239 3 NGR_a01420 Probable peptide ABC transporter permease protein y4tQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8FUW9 3.24e-40 144 32 1 241 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)
P08006 4.4e-40 144 35 4 280 1 oppC Oligopeptide transport system permease protein OppC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45053 2.3e-39 142 32 1 278 3 oppC Oligopeptide transport system permease protein OppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AFH6 9.72e-39 140 36 4 280 1 oppC Oligopeptide transport system permease protein OppC Escherichia coli (strain K12)
P0AFH7 9.72e-39 140 36 4 280 3 oppC Oligopeptide transport system permease protein OppC Escherichia coli O157:H7
P0AGH7 9.51e-30 117 31 3 274 3 sapC Peptide transport system permease protein SapC Shigella flexneri
P0AGH5 9.51e-30 117 31 3 274 1 sapC Putrescine export system permease protein SapC Escherichia coli (strain K12)
P0AGH6 9.51e-30 117 31 3 274 3 sapC Peptide transport system permease protein SapC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A2RI76 2.72e-29 117 33 0 223 1 dppC Dipeptide transport system permease protein DppC Lactococcus lactis subsp. cremoris (strain MG1363)
P0A2J5 3.43e-29 115 31 3 274 2 sapC Peptide transport system permease protein SapC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J6 3.43e-29 115 31 3 274 3 sapC Peptide transport system permease protein SapC Salmonella typhi
P0A4P0 6.72e-26 106 29 7 281 3 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N9 1.07e-25 106 29 7 281 1 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. lactis (strain IL1403)
Q7D203 1.28e-25 107 29 1 216 3 yejE Peptidoglycan transport system permease protein YejE Agrobacterium fabrum (strain C58 / ATCC 33970)
P66965 1.73e-25 105 30 4 233 3 BQ2027_MB1313C Putative peptide transport permease protein Mb1313c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ9 1.73e-25 105 30 4 233 1 Rv1282c Putative peptide transport permease protein Rv1282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ8 1.73e-25 105 30 4 233 3 MT1319 Putative peptide transport permease protein MT1319 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P45287 4.94e-24 101 26 2 260 3 sapC Peptide transport system permease protein SapC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P33915 1.85e-22 98 28 1 226 1 yejE Inner membrane ABC transporter permease protein YejE Escherichia coli (strain K12)
P0A4N0 1.22e-18 87 25 5 278 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M9 1.22e-18 87 25 5 278 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P75553 2.54e-11 67 23 7 256 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47324 9.41e-11 65 24 7 256 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14560
Feature type CDS
Gene -
Product ABC transporter permease subunit
Location 3228090 - 3228959 (strand: -1)
Length 870 (nucleotides) / 289 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2788
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF12911 N-terminal TM domain of oligopeptide transport permease C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1173 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)		 EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15586 nickel transport system permease protein ABC transporters -

Protein Sequence

MWRLFWQRLAQDKSAQLCLLVMVIITIAGIGAPWFAPHDPTLTSIRLKFQPISFHYPLGTDNLGRCVFSRLLFGIRTTVFYAIYAMGITLLIGWLMGMLAGYFHGKTDTVIMRLCDVVLSFPAEIMILALVGIMGPGIGNILIAVILVKWAWYARMIRGIVRQYSHRHYIAYAQVIGAPPTHILRRHLLPVTLAETIVLASSDIGSVILMISALSFLGLGVQPPTPEWGNMLSEAKNVMVLHPEQMLPAGIAITVVVTAFNFWGDFLRDVFDPDNRQSVGDKYEQFTDA

Flanking regions ( +/- flanking 50bp)

CTGATAGATATCATTCAGATGAAAGTCGATCCTCGTCTAAGGCGGTAACAATGTGGCGGTTATTCTGGCAACGACTTGCGCAAGATAAAAGTGCACAACTCTGTTTATTGGTGATGGTTATTATTACCATCGCCGGAATAGGCGCACCTTGGTTTGCACCTCATGATCCCACTTTAACATCGATACGCTTAAAATTTCAGCCAATCAGCTTTCACTATCCACTGGGTACAGATAATTTAGGGCGTTGTGTGTTTTCACGTTTACTCTTTGGTATTCGAACCACCGTTTTTTATGCCATATATGCGATGGGTATAACACTGCTGATCGGTTGGCTAATGGGGATGTTGGCGGGCTATTTTCACGGTAAAACGGATACAGTGATTATGCGTTTATGTGATGTGGTATTGTCATTTCCTGCGGAAATTATGATCTTAGCCTTAGTGGGCATAATGGGGCCTGGAATAGGTAACATCTTGATTGCGGTGATCTTGGTTAAATGGGCTTGGTACGCCAGAATGATACGAGGCATTGTTCGACAATATTCACATCGTCACTATATTGCTTATGCTCAAGTGATTGGCGCACCACCAACACATATTTTACGACGCCATTTATTACCCGTGACATTAGCTGAAACTATCGTTTTAGCCTCAAGTGATATTGGTAGTGTTATTTTAATGATCTCTGCTCTTTCATTTCTGGGGTTAGGGGTACAGCCACCCACCCCAGAATGGGGTAATATGCTGAGTGAAGCAAAAAATGTCATGGTATTACATCCCGAACAAATGCTACCTGCGGGGATAGCGATTACGGTTGTTGTTACTGCATTTAACTTTTGGGGCGATTTTTTACGCGATGTGTTCGACCCCGATAATCGTCAATCAGTCGGGGATAAATATGAACAATTTACTGACGCTTAATCAAGTCTCAATCTATGATCCTCACAGCGAAAAAAAGCGGGTAGATAATC