Homologs in group_2788

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08930 FBDBKF_08930 100.0 Morganella morganii S1 nikC nickel ABC transporter permease subunit NikC
EHELCC_10480 EHELCC_10480 100.0 Morganella morganii S2 nikC nickel ABC transporter permease subunit NikC
NLDBIP_10825 NLDBIP_10825 100.0 Morganella morganii S4 nikC nickel ABC transporter permease subunit NikC
LHKJJB_10530 LHKJJB_10530 100.0 Morganella morganii S3 nikC nickel ABC transporter permease subunit NikC
PMI_RS14560 PMI_RS14560 40.6 Proteus mirabilis HI4320 - ABC transporter permease subunit

Distribution of the homologs in the orthogroup group_2788

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2788

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFA9 5.83e-114 332 66 0 248 1 nikC Nickel transport system permease protein NikC Escherichia coli (strain K12)
P0AFB0 5.83e-114 332 66 0 248 3 nikC Nickel transport system permease protein NikC Escherichia coli O157:H7
P94312 1.81e-68 217 40 2 276 3 dppC Dipeptide transport system permease protein DppC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q83S25 1.47e-66 213 40 1 272 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri
P0C2L2 1.47e-66 213 40 1 272 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri serotype 5b (strain 8401)
Q8FJK8 2.06e-66 212 40 1 272 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJL6 2.06e-66 212 40 1 272 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3Z3V1 2.61e-66 212 40 1 272 3 gsiD Glutathione transport system permease protein GsiD Shigella sonnei (strain Ss046)
Q323W2 2.61e-66 212 40 1 272 3 gsiD Glutathione transport system permease protein GsiD Shigella boydii serotype 4 (strain Sb227)
Q8X6V6 2.61e-66 212 40 1 272 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O157:H7
P75799 3.28e-66 211 40 1 272 1 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain K12)
Q1RE93 1.59e-65 210 40 1 272 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain UTI89 / UPEC)
A1A971 1.59e-65 210 40 1 272 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O1:K1 / APEC
Q32IB8 2.4e-65 209 40 1 272 3 gsiD Glutathione transport system permease protein GsiD Shigella dysenteriae serotype 1 (strain Sd197)
Q6D3B2 3.23e-63 204 38 3 286 3 gsiD Glutathione transport system permease protein GsiD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7CQV4 1.52e-61 199 40 2 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF88 1.52e-61 199 40 2 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhi
Q5PGP6 1.52e-61 199 40 2 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RA9 1.52e-61 199 40 2 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella choleraesuis (strain SC-B67)
Q2FVE9 5.44e-60 195 38 0 260 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3JU73 6.33e-60 195 38 0 260 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A0A0H2ZFV0 1.94e-58 192 38 2 291 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
P26904 4.4e-58 191 38 1 274 2 dppC Dipeptide transport system permease protein DppC Bacillus subtilis (strain 168)
P42063 4.59e-58 191 35 3 290 3 appC Oligopeptide transport system permease protein AppC Bacillus subtilis (strain 168)
P77463 1.15e-57 189 37 0 254 1 ddpC Probable D,D-dipeptide transport system permease protein DdpC Escherichia coli (strain K12)
P24139 4.48e-56 186 39 0 247 1 oppC Oligopeptide transport system permease protein OppC Bacillus subtilis (strain 168)
Q53192 1.41e-55 184 42 2 236 3 NGR_a01420 Probable peptide ABC transporter permease protein y4tQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P51000 2.82e-52 176 35 1 277 3 dppC Dipeptide transport system permease protein DppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8FWN9 3.06e-52 176 37 1 259 3 BRA0407 Putative peptide permease protein BRA0407/BS1330_II0404 Brucella suis biovar 1 (strain 1330)
A5VU89 1.65e-51 174 37 1 259 3 BOV_A0350 Putative peptide permease protein BOV_A0350 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YBN8 2.18e-51 173 37 1 259 3 BMEII0861 Putative peptide permease protein BMEII0861 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YK65 2.18e-51 173 37 1 259 3 BAB2_0815 Putative peptide permease protein BAB2_0815 Brucella abortus (strain 2308)
Q577J7 2.18e-51 173 37 1 259 3 BruAb2_0794 Putative peptide permease protein BruAb2_0794 Brucella abortus biovar 1 (strain 9-941)
Q2YXY8 5.08e-51 172 33 1 265 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GH26 2.42e-50 170 33 1 265 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MRSA252)
Q7A0Y0 1.17e-49 168 35 0 238 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MW2)
Q6G9H9 1.17e-49 168 35 0 238 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MSSA476)
Q5HG39 1.17e-49 168 35 0 238 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain COL)
Q2FYQ6 1.17e-49 168 35 0 238 1 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH56 1.17e-49 168 35 0 238 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain USA300)
Q7A5Q7 3.02e-49 167 35 0 238 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain N315)
Q99UA1 3.02e-49 167 35 0 238 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain Mu50 / ATCC 700699)
P45053 5.26e-47 162 33 2 288 3 oppC Oligopeptide transport system permease protein OppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AEG1 9.62e-47 161 37 2 277 1 dppC Dipeptide transport system permease protein DppC Escherichia coli (strain K12)
P0AEG2 9.62e-47 161 37 2 277 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG3 9.62e-47 161 37 2 277 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O157:H7
Q8FUW9 2.13e-46 160 36 1 244 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)
Q8YDG8 2.45e-46 160 36 1 244 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 2.45e-46 160 36 1 244 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 2.45e-46 160 36 1 244 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)
P0AFH6 6.9e-43 151 33 3 284 1 oppC Oligopeptide transport system permease protein OppC Escherichia coli (strain K12)
P0AFH7 6.9e-43 151 33 3 284 3 oppC Oligopeptide transport system permease protein OppC Escherichia coli O157:H7
P08006 1.03e-42 151 34 5 287 1 oppC Oligopeptide transport system permease protein OppC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66965 1.2e-37 137 31 1 247 3 BQ2027_MB1313C Putative peptide transport permease protein Mb1313c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ9 1.2e-37 137 31 1 247 1 Rv1282c Putative peptide transport permease protein Rv1282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ8 1.2e-37 137 31 1 247 3 MT1319 Putative peptide transport permease protein MT1319 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A2J5 3.06e-36 134 31 1 271 2 sapC Peptide transport system permease protein SapC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J6 3.06e-36 134 31 1 271 3 sapC Peptide transport system permease protein SapC Salmonella typhi
P0AGH7 5.39e-35 130 29 1 271 3 sapC Peptide transport system permease protein SapC Shigella flexneri
P0AGH5 5.39e-35 130 29 1 271 1 sapC Putrescine export system permease protein SapC Escherichia coli (strain K12)
P0AGH6 5.39e-35 130 29 1 271 3 sapC Peptide transport system permease protein SapC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A2RI76 1.51e-29 117 31 1 243 1 dppC Dipeptide transport system permease protein DppC Lactococcus lactis subsp. cremoris (strain MG1363)
P0A4N0 1.75e-26 108 28 4 281 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M9 1.75e-26 108 28 4 281 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P45287 1.01e-24 103 24 3 280 3 sapC Peptide transport system permease protein SapC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7D203 3.4e-24 103 32 5 224 3 yejE Peptidoglycan transport system permease protein YejE Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A4N9 1.58e-21 95 27 3 255 1 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. lactis (strain IL1403)
P0A4P0 1.62e-21 95 27 3 255 3 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. cremoris (strain SK11)
P33915 1.01e-17 85 26 2 227 1 yejE Inner membrane ABC transporter permease protein YejE Escherichia coli (strain K12)
P75553 2.74e-11 66 28 8 250 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47324 4.74e-11 66 27 7 243 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P45054 2.22e-05 48 26 9 204 3 oppB Oligopeptide transport system permease protein OppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_13590
Feature type CDS
Gene nikC
Product nickel ABC transporter permease subunit NikC
Location 3746 - 4609 (strand: -1)
Length 864 (nucleotides) / 287 (amino acids)

Contig

Accession ZDB_692
Length 124746 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2788
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF12911 N-terminal TM domain of oligopeptide transport permease C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1173 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15586 nickel transport system permease protein ABC transporters -

Protein Sequence

MSDMILKAPSAWRTLSRNLLLWFALAVVALLVLAMIAGPWISPHDPDLVELSNRLQEPDSQYWLGTDHLGRDIFSRLIAGARISLGTVAITLVIIMTLGLVIGGIAGFTGGRTDQIIMRFTDVFLTFPTLVLALFLIGILGTGLTNVIIAIALSHWAWYARIVRGIILSLRHREFLLAARLSGAGNVRIFLRHLFPATISQLIVLATLDIGHMMLHVSGLSFLGLGVAAPTAEWGVMISDARQFVRTSPMLIFWPGLILFFSVMAFNILGDALRDRLDPTLRAGTCH

Flanking regions ( +/- flanking 50bp)

ATTTATGCGATTGCGGATCCCCGCATCCGCCTCTCTGCGGAGGGTATCGAATGAGCGATATGATACTGAAAGCCCCTTCCGCCTGGCGGACACTCAGCCGCAATCTTCTGTTGTGGTTTGCGCTGGCCGTGGTGGCGCTGCTGGTACTGGCCATGATTGCCGGGCCGTGGATCTCCCCGCATGATCCGGATCTGGTGGAATTATCAAACCGGCTTCAGGAACCGGATAGTCAGTACTGGCTTGGTACTGATCATCTCGGGCGTGATATTTTTTCCCGCCTGATTGCCGGGGCGCGGATTTCTCTCGGCACCGTAGCAATCACGCTGGTGATTATTATGACGCTCGGACTGGTGATCGGCGGCATTGCCGGGTTTACCGGCGGACGGACGGATCAAATCATCATGCGGTTTACCGATGTGTTCCTGACATTCCCGACACTGGTGCTGGCTCTGTTTTTAATCGGCATCCTCGGTACCGGGCTGACAAACGTGATTATTGCGATCGCGCTGTCACACTGGGCGTGGTATGCGCGGATTGTCCGCGGGATCATCCTCTCGCTGCGCCACCGGGAATTTCTGCTGGCGGCACGTCTGAGCGGCGCCGGAAATGTGCGGATCTTTCTCCGGCATCTGTTTCCGGCCACTATTTCCCAGCTGATCGTGCTGGCGACCCTGGATATCGGCCATATGATGCTGCATGTCTCCGGGCTGTCATTCCTCGGGCTGGGCGTGGCGGCACCCACCGCAGAGTGGGGCGTGATGATCAGCGATGCCCGTCAGTTTGTCCGGACATCACCGATGCTGATTTTCTGGCCGGGTTTAATTTTATTTTTCAGTGTGATGGCGTTTAACATCCTCGGGGATGCTCTGCGTGATCGTCTGGATCCGACACTGAGGGCCGGGACATGTCATTAAATCATTCTGTATTGGAGGTCAGCCATCTGTCGGCGGGGTATCTGCATAAT