Homologs in group_1733

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11785 FBDBKF_11785 66.7 Morganella morganii S1 yheV YheV family putative zinc ribbon protein
EHELCC_14520 EHELCC_14520 66.7 Morganella morganii S2 yheV YheV family putative zinc ribbon protein
NLDBIP_15615 NLDBIP_15615 66.7 Morganella morganii S4 yheV YheV family putative zinc ribbon protein
LHKJJB_14995 LHKJJB_14995 66.7 Morganella morganii S3 yheV YheV family putative zinc ribbon protein
HKOGLL_19290 HKOGLL_19290 66.7 Morganella morganii S5 yheV YheV family putative zinc ribbon protein
F4V73_RS14870 F4V73_RS14870 70.1 Morganella psychrotolerans - YheV family putative zinc ribbon protein

Distribution of the homologs in the orthogroup group_1733

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1733

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADW8 1.45e-26 94 65 0 64 4 yheV Uncharacterized protein YheV Escherichia coli (strain K12)
P0ADW9 1.45e-26 94 65 0 64 4 yheV Uncharacterized protein YheV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADX0 1.45e-26 94 65 0 64 4 yheV Uncharacterized protein YheV Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13850
Feature type CDS
Gene -
Product YheV family putative zinc ribbon protein
Location 3075908 - 3076111 (strand: -1)
Length 204 (nucleotides) / 67 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1733
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF09526 Probable metal-binding protein (DUF2387)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3529 General function prediction only (R) R Predicted nucleic-acid-binding protein, contains Zn-ribbon domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07070 uncharacterized protein - -

Protein Sequence

MSATRKRFIAGAVCPHCQAQDTLKMWREDKVDIVECAQCGHQQRQTDGEVSALVRENEQVIGIFTPQ

Flanking regions ( +/- flanking 50bp)

TCAAGTAAATAGAGAAAAAAGACCCATTGATAAACAGGAGAACTGACCCCATGTCTGCAACCCGTAAGCGTTTTATTGCTGGCGCAGTATGTCCCCACTGTCAAGCCCAAGATACACTCAAAATGTGGCGAGAAGATAAAGTGGATATTGTGGAATGCGCTCAATGTGGTCATCAGCAAAGGCAAACAGACGGTGAGGTGAGTGCACTTGTGCGTGAAAATGAACAGGTCATCGGGATCTTTACACCACAATAATTGTAGGTTTTTTTGATATAACCCGATACAGACGATTTATTTTTCGTTAC