Homologs in group_1733

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11785 FBDBKF_11785 100.0 Morganella morganii S1 yheV YheV family putative zinc ribbon protein
EHELCC_14520 EHELCC_14520 100.0 Morganella morganii S2 yheV YheV family putative zinc ribbon protein
NLDBIP_15615 NLDBIP_15615 100.0 Morganella morganii S4 yheV YheV family putative zinc ribbon protein
HKOGLL_19290 HKOGLL_19290 100.0 Morganella morganii S5 yheV YheV family putative zinc ribbon protein
F4V73_RS14870 F4V73_RS14870 80.6 Morganella psychrotolerans - YheV family putative zinc ribbon protein
PMI_RS13850 PMI_RS13850 66.7 Proteus mirabilis HI4320 - YheV family putative zinc ribbon protein

Distribution of the homologs in the orthogroup group_1733

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1733

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADW8 1.45e-29 102 70 0 65 4 yheV Uncharacterized protein YheV Escherichia coli (strain K12)
P0ADW9 1.45e-29 102 70 0 65 4 yheV Uncharacterized protein YheV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADX0 1.45e-29 102 70 0 65 4 yheV Uncharacterized protein YheV Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_14995
Feature type CDS
Gene yheV
Product YheV family putative zinc ribbon protein
Location 7678 - 7881 (strand: -1)
Length 204 (nucleotides) / 67 (amino acids)
In genomic island -

Contig

Accession ZDB_373
Length 137108 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1733
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF09526 Probable metal-binding protein (DUF2387)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3529 General function prediction only (R) R Predicted nucleic-acid-binding protein, contains Zn-ribbon domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07070 uncharacterized protein - -

Protein Sequence

MSNRKRFIAGAVCPECQAQDTLAMWREDNVDVVQCVQCGHLERRADAHAEQHVRKDEQVIGIFTPGE

Flanking regions ( +/- flanking 50bp)

CTGACGGAAGACTCACCGGGCAGCGGACGGACAGAGACAGGAGCAGAAAAATGAGCAACCGGAAACGGTTTATTGCGGGTGCGGTATGCCCTGAGTGTCAGGCACAGGATACCCTCGCCATGTGGCGTGAGGATAATGTGGACGTGGTGCAGTGTGTGCAGTGCGGCCATCTTGAGCGCCGGGCGGATGCGCATGCGGAGCAGCATGTGCGCAAAGATGAACAGGTGATTGGTATCTTTACACCGGGGGAATAACAGGCCGCTGCTTTTCACAGAGAATTTGGGGGAATTTGTCCCAAAACAGA