Homologs in group_2288

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17570 FBDBKF_17570 91.7 Morganella morganii S1 rplL 50S ribosomal protein L7/L12
EHELCC_18055 EHELCC_18055 91.7 Morganella morganii S2 rplL 50S ribosomal protein L7/L12
NLDBIP_18095 NLDBIP_18095 91.7 Morganella morganii S4 rplL 50S ribosomal protein L7/L12
LHKJJB_18290 LHKJJB_18290 91.7 Morganella morganii S3 rplL 50S ribosomal protein L7/L12
HKOGLL_17910 HKOGLL_17910 91.7 Morganella morganii S5 rplL 50S ribosomal protein L7/L12
F4V73_RS14955 F4V73_RS14955 91.7 Morganella psychrotolerans rplL 50S ribosomal protein L7/L12

Distribution of the homologs in the orthogroup group_2288

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2288

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EYV0 7.85e-76 223 100 0 121 3 rplL Large ribosomal subunit protein bL12 Proteus mirabilis (strain HI4320)
B7MRB2 2.32e-60 184 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O81 (strain ED1a)
C6DHR4 3.52e-55 171 90 0 121 3 rplL Large ribosomal subunit protein bL12 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P0A7K5 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella flexneri
Q0SY14 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella flexneri serotype 5b (strain 8401)
Q32AF8 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella dysenteriae serotype 1 (strain Sd197)
Q31U11 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella boydii serotype 4 (strain Sb227)
B2TWH2 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUL6 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5V1 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain UTI89 / UPEC)
B1LNT8 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain SMS-3-5 / SECEC)
B6I5J6 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain SE11)
B7NFS6 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7K2 1.27e-54 169 90 0 121 1 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain K12)
B1IUR1 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7K3 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA79 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A785 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O9:H4 (strain HS)
B1XBY8 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain K12 / DH10B)
C5A0S6 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M733 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O8 (strain IAI1)
B7NRR4 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z082 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7K4 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O157:H7
B7LA79 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain 55989 / EAEC)
B7MIX2 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPE1 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUK0 1.27e-54 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O139:H28 (strain E24377A / ETEC)
A4W5A6 2.24e-54 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Enterobacter sp. (strain 638)
Q3YUZ8 3.15e-54 168 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella sonnei (strain Ss046)
A8AKU0 7.1e-54 167 89 0 121 3 rplL Large ribosomal subunit protein bL12 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TGN9 9.86e-54 167 88 0 121 3 rplL Large ribosomal subunit protein bL12 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XYF6 9.86e-54 167 88 0 121 3 rplL Large ribosomal subunit protein bL12 Klebsiella pneumoniae (strain 342)
Q6DAN1 2.42e-53 166 87 0 121 3 rplL Large ribosomal subunit protein bL12 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P0A299 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2A0 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella typhi
B4TQJ4 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella schwarzengrund (strain CVM19633)
B5BJQ2 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi A (strain AKU_12601)
C0Q2R6 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi C (strain RKS4594)
A9N0J3 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK94 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0Y8 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella newport (strain SL254)
B4TCS3 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella heidelberg (strain SL476)
B5RFK2 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYD7 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella enteritidis PT4 (strain P125109)
B5FQJ8 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella dublin (strain CT_02021853)
Q57H70 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella choleraesuis (strain SC-B67)
B5F0W6 3.88e-52 163 90 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella agona (strain SL483)
A8G8E6 1.27e-51 162 82 0 121 3 rplL Large ribosomal subunit protein bL12 Serratia proteamaculans (strain 568)
Q1LSX8 1.96e-51 161 65 0 121 3 rplL Large ribosomal subunit protein bL12 Baumannia cicadellinicola subsp. Homalodisca coagulata
P41188 1.49e-50 159 67 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B2VG95 2.07e-50 159 82 0 121 3 rplL Large ribosomal subunit protein bL12 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C3LR59 2.41e-50 158 73 2 123 3 rplL Large ribosomal subunit protein bL12 Vibrio cholerae serotype O1 (strain M66-2)
Q9KV31 2.41e-50 158 73 2 123 3 rplL Large ribosomal subunit protein bL12 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3P4 2.41e-50 158 73 2 123 3 rplL Large ribosomal subunit protein bL12 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MQP6 2.69e-50 158 85 1 122 3 rplL Large ribosomal subunit protein bL12 Cronobacter sakazakii (strain ATCC BAA-894)
A9MHF3 4.85e-50 157 84 1 123 3 rplL Large ribosomal subunit protein bL12 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A0KQA6 7.14e-50 157 76 0 121 3 rplL Large ribosomal subunit protein bL12 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q3ILQ0 9.82e-50 157 73 2 122 3 rplL Large ribosomal subunit protein bL12 Pseudoalteromonas translucida (strain TAC 125)
B8D6V1 1.79e-49 156 65 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57147 1.79e-49 156 65 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8J7 1.79e-49 156 65 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q7N9A5 1.97e-49 156 82 2 123 3 rplL Large ribosomal subunit protein bL12 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NWR7 3.65e-49 155 84 1 122 3 rplL Large ribosomal subunit protein bL12 Sodalis glossinidius (strain morsitans)
A1REA6 9.44e-48 152 72 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain W3-18-1)
A4YBZ1 9.44e-48 152 72 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK75 9.44e-48 152 72 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q492B8 6.01e-47 150 61 1 122 3 rplL Large ribosomal subunit protein bL12 Blochmanniella pennsylvanica (strain BPEN)
A8GYW8 8.45e-47 149 70 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q89B19 3.54e-46 148 64 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7VRP6 6.63e-46 147 61 2 126 3 rplL Large ribosomal subunit protein bL12 Blochmanniella floridana
Q089R2 1.7e-45 146 68 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella frigidimarina (strain NCIMB 400)
P44348 1.75e-45 146 73 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHD2 1.75e-45 146 73 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain PittGG)
A5UE95 1.75e-45 146 73 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain PittEE)
Q4QMS6 1.75e-45 146 73 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain 86-028NP)
B0TM20 5.14e-45 145 71 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella halifaxensis (strain HAW-EB4)
A4SHU8 6.69e-45 144 71 1 121 3 rplL Large ribosomal subunit protein bL12 Aeromonas salmonicida (strain A449)
Q7VKL5 1.1e-44 144 73 1 121 3 rplL Large ribosomal subunit protein bL12 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B1JJJ7 1.47e-44 144 74 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FQ3 1.47e-44 144 74 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS30 1.47e-44 144 74 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis (strain Pestoides F)
Q1CN79 1.47e-44 144 74 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAP4 1.47e-44 144 74 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis
B2K111 1.47e-44 144 74 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1U0 1.47e-44 144 74 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNI4 1.47e-44 144 74 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q65W43 1.66e-44 144 71 1 122 3 rplL Large ribosomal subunit protein bL12 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C4LBV3 2.02e-44 143 74 0 121 3 rplL Large ribosomal subunit protein bL12 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q5NID3 2.66e-44 143 72 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JT6 2.66e-44 143 72 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. tularensis (strain FSC 198)
Q4FQH2 3.75e-44 143 71 1 123 3 rplL Large ribosomal subunit protein bL12 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1JIH9 6.09e-44 142 73 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1Q8P8 6.85e-44 142 71 1 123 3 rplL Large ribosomal subunit protein bL12 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B0BSE8 1.32e-43 141 72 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYU7 1.32e-43 141 72 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N319 1.32e-43 141 72 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A1T066 1.88e-43 141 75 0 121 3 rplL Large ribosomal subunit protein bL12 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B0TX09 3.1e-43 140 75 1 124 3 rplL Large ribosomal subunit protein bL12 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A9R0H7 3.72e-43 140 66 1 128 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis bv. Antiqua (strain Angola)
B6ENR4 4.42e-43 140 76 0 121 3 rplL Large ribosomal subunit protein bL12 Aliivibrio salmonicida (strain LFI1238)
Q15YB2 2.59e-42 138 69 1 123 3 rplL Large ribosomal subunit protein bL12 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q2S904 2.95e-42 138 72 1 124 3 rplL Large ribosomal subunit protein bL12 Hahella chejuensis (strain KCTC 2396)
A6VKC6 4.25e-42 137 68 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B7VM70 7.79e-42 137 75 0 121 3 rplL Large ribosomal subunit protein bL12 Vibrio atlanticus (strain LGP32)
A3Q974 9.05e-42 137 72 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A9KW94 1.07e-41 136 69 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella baltica (strain OS195)
A6WHS0 1.07e-41 136 69 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella baltica (strain OS185)
Q9CK90 1.4e-41 136 71 1 122 3 rplL Large ribosomal subunit protein bL12 Pasteurella multocida (strain Pm70)
Q5QWA6 1.46e-41 136 71 1 124 3 rplL Large ribosomal subunit protein bL12 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B8F6N0 1.53e-41 136 72 1 122 3 rplL Large ribosomal subunit protein bL12 Glaesserella parasuis serovar 5 (strain SH0165)
A8G1F6 2.27e-41 135 68 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella sediminis (strain HAW-EB3)
B0UUZ7 2.5e-41 135 68 1 122 3 rplL Large ribosomal subunit protein bL12 Histophilus somni (strain 2336)
Q0I0U9 2.5e-41 135 68 1 122 3 rplL Large ribosomal subunit protein bL12 Histophilus somni (strain 129Pt)
B5FC89 5.05e-41 135 72 1 122 3 rplL Large ribosomal subunit protein bL12 Aliivibrio fischeri (strain MJ11)
Q5E236 5.05e-41 135 72 1 122 3 rplL Large ribosomal subunit protein bL12 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B8CNC4 6.44e-41 134 69 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella piezotolerans (strain WP3 / JCM 13877)
B8EBL3 6.44e-41 134 68 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella baltica (strain OS223)
Q7MGR7 1.05e-40 134 72 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio vulnificus (strain YJ016)
Q8DD21 1.05e-40 134 72 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio vulnificus (strain CMCP6)
A7MXF2 1.51e-40 134 69 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio campbellii (strain ATCC BAA-1116)
B1KMZ1 2.05e-40 133 68 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella woodyi (strain ATCC 51908 / MS32)
Q12SW7 2.14e-40 133 72 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
C4K4F2 2.4e-40 133 68 1 124 3 rplL Large ribosomal subunit protein bL12 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A5WH36 3.11e-40 133 68 1 125 3 rplL Large ribosomal subunit protein bL12 Psychrobacter sp. (strain PRwf-1)
Q31IZ0 5.53e-40 132 68 1 123 3 rplL Large ribosomal subunit protein bL12 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q87KQ3 5.98e-40 132 73 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5WZM0 1.23e-39 131 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila (strain Lens)
Q5ZYQ1 1.23e-39 131 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHS2 1.23e-39 131 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila (strain Corby)
Q5X867 1.23e-39 131 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila (strain Paris)
Q21M94 3.64e-39 130 70 1 126 3 rplL Large ribosomal subunit protein bL12 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3J8Q6 4.83e-39 130 62 1 126 3 rplL Large ribosomal subunit protein bL12 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0HNU5 5.2e-39 130 69 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain MR-4)
Q47UV8 5.87e-39 129 73 2 121 3 rplL Large ribosomal subunit protein bL12 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q6LLW1 1.16e-38 129 70 0 121 3 rplL Large ribosomal subunit protein bL12 Photobacterium profundum (strain SS9)
A1TYI9 1.2e-38 129 67 1 124 3 rplL Large ribosomal subunit protein bL12 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A5CW26 1.42e-38 129 58 1 121 3 rplL Large ribosomal subunit protein bL12 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A4IW98 1.5e-38 129 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BKC3 1.5e-38 129 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q868 1.5e-38 129 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. novicida (strain U112)
Q2A1M6 1.5e-38 129 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. holarctica (strain LVS)
A7NEC1 1.5e-38 129 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q0VSM3 1.53e-38 129 64 1 125 3 rplL Large ribosomal subunit protein bL12 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A5EX71 1.86e-38 128 63 1 122 3 rplL Large ribosomal subunit protein bL12 Dichelobacter nodosus (strain VCS1703A)
B2SFD5 2.19e-38 128 68 1 126 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. mediasiatica (strain FSC147)
A8ZV50 2.83e-38 128 60 1 125 3 rplL Large ribosomal subunit protein bL12 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q0I0B3 3.38e-38 128 68 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain MR-7)
A0KRL6 3.38e-38 128 68 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain ANA-3)
A1KB35 1.68e-37 126 64 1 125 3 rplL Large ribosomal subunit protein bL12 Azoarcus sp. (strain BH72)
C5BQ38 2.29e-37 125 69 1 126 3 rplL Large ribosomal subunit protein bL12 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q0ABI3 2.77e-37 125 62 1 125 3 rplL Large ribosomal subunit protein bL12 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q0SNB7 7.12e-37 124 58 1 124 3 rplL Large ribosomal subunit protein bL12 Borreliella afzelii (strain PKo)
Q8D234 1.64e-36 123 54 2 123 3 rplL Large ribosomal subunit protein bL12 Wigglesworthia glossinidia brevipalpis
Q058E4 2.07e-36 123 50 1 121 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
C1DKK4 3.53e-36 122 63 1 122 3 rplL Large ribosomal subunit protein bL12 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1AX76 3.82e-36 122 59 1 122 3 rplL Large ribosomal subunit protein bL12 Ruthia magnifica subsp. Calyptogena magnifica
Q7VJ81 7.75e-36 122 55 1 126 3 rplL Large ribosomal subunit protein bL12 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B8GV66 1.15e-35 121 58 1 125 3 rplL Large ribosomal subunit protein bL12 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
C1DAQ9 1.85e-35 120 60 1 123 3 rplL Large ribosomal subunit protein bL12 Laribacter hongkongensis (strain HLHK9)
B3PK29 1.9e-35 120 70 1 122 3 rplL Large ribosomal subunit protein bL12 Cellvibrio japonicus (strain Ueda107)
A1WVD0 2.65e-35 120 60 1 128 3 rplL Large ribosomal subunit protein bL12 Halorhodospira halophila (strain DSM 244 / SL1)
Q3SLQ7 2.74e-35 120 62 1 127 3 rplL Large ribosomal subunit protein bL12 Thiobacillus denitrificans (strain ATCC 25259)
Q60A07 5.93e-35 119 63 1 125 3 rplL Large ribosomal subunit protein bL12 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5P340 6.57e-35 119 62 1 124 3 rplL Large ribosomal subunit protein bL12 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B5YEX7 8.98e-35 119 53 1 125 3 rplL Large ribosomal subunit protein bL12 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
P0A467 9.19e-35 119 58 1 126 3 rplL Large ribosomal subunit protein bL12 Aquifex pyrophilus
P0A466 9.19e-35 119 58 1 126 3 rplL Large ribosomal subunit protein bL12 Aquifex aeolicus (strain VF5)
A1S210 1.01e-34 119 69 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q82T74 1.04e-34 119 60 1 124 3 rplL Large ribosomal subunit protein bL12 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A7ZCN6 1.23e-34 119 54 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter concisus (strain 13826)
A1QZH8 1.33e-34 119 59 2 123 3 rplL Large ribosomal subunit protein bL12 Borrelia turicatae (strain 91E135)
B2UUW1 3.23e-34 117 54 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain Shi470)
P56875 3.23e-34 117 54 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain J99 / ATCC 700824)
Q1CS67 3.23e-34 117 54 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain HPAG1)
B5Z8J6 3.41e-34 117 54 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain G27)
B6JN38 3.41e-34 117 54 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain P12)
Q1LI19 5.23e-34 117 62 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
C3K2Y4 7.67e-34 117 67 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas fluorescens (strain SBW25)
B0K5G7 1.07e-33 116 60 1 125 3 rplL Large ribosomal subunit protein bL12 Thermoanaerobacter sp. (strain X514)
P55834 1.5e-33 116 53 1 125 1 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain ATCC 700392 / 26695)
B2V7M1 2.36e-33 115 57 1 126 3 rplL Large ribosomal subunit protein bL12 Sulfurihydrogenibium sp. (strain YO3AOP1)
Q17VN5 3.03e-33 115 52 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter acinonychis (strain Sheeba)
B0KCJ1 3.2e-33 115 59 1 125 3 rplL Large ribosomal subunit protein bL12 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A7I3U0 4.91e-33 115 55 1 124 3 rplL Large ribosomal subunit protein bL12 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
C0QQL5 5.6e-33 114 59 1 125 3 rplL Large ribosomal subunit protein bL12 Persephonella marina (strain DSM 14350 / EX-H1)
Q1R0I3 5.79e-33 114 62 1 124 3 rplL Large ribosomal subunit protein bL12 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A0RQI6 5.79e-33 114 54 1 124 3 rplL Large ribosomal subunit protein bL12 Campylobacter fetus subsp. fetus (strain 82-40)
Q47JB1 5.94e-33 114 63 1 123 3 rplL Large ribosomal subunit protein bL12 Dechloromonas aromatica (strain RCB)
P0C8S3 7.23e-33 114 62 1 123 1 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAL3 7.23e-33 114 62 1 123 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD40 7.23e-33 114 62 1 123 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain Dugway 5J108-111)
B6J272 7.23e-33 114 62 1 123 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain CbuG_Q212)
B6J5C1 7.23e-33 114 62 1 123 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain CbuK_Q154)
A6LKB9 8.33e-33 114 57 3 125 3 rplL Large ribosomal subunit protein bL12 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B9KFG6 9.63e-33 114 56 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A1ALT3 9.77e-33 114 60 1 124 3 rplL Large ribosomal subunit protein bL12 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B1GZ74 1.07e-32 114 53 1 122 3 rplL Large ribosomal subunit protein bL12 Endomicrobium trichonymphae
B4U736 1.4e-32 114 58 1 125 3 rplL Large ribosomal subunit protein bL12 Hydrogenobaculum sp. (strain Y04AAS1)
P0A0W9 1.46e-32 113 58 1 122 3 rplL Large ribosomal subunit protein bL12 Neisseria sicca
P0A0W8 1.46e-32 113 58 1 122 3 rplL Large ribosomal subunit protein bL12 Neisseria lactamica
A7GZK0 2.18e-32 113 53 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter curvus (strain 525.92)
Q2YB06 2.86e-32 113 58 1 126 3 rplL Large ribosomal subunit protein bL12 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8R7U5 4.44e-32 112 57 1 125 3 rplL Large ribosomal subunit protein bL12 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q1MPU3 5.23e-32 112 57 1 128 3 rplL Large ribosomal subunit protein bL12 Lawsonia intracellularis (strain PHE/MN1-00)
Q11QA4 5.33e-32 112 55 2 120 3 rplL Large ribosomal subunit protein bL12 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q8XUZ7 5.49e-32 112 62 1 124 3 rplL Large ribosomal subunit protein bL12 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7MA57 5.73e-32 112 56 1 124 3 rplL Large ribosomal subunit protein bL12 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q6AP79 6.01e-32 112 61 1 123 3 rplL Large ribosomal subunit protein bL12 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8MLD1 6.9e-32 112 56 2 119 3 rplL Large ribosomal subunit protein bL12 Alkaliphilus oremlandii (strain OhILAs)
B8E0K0 6.95e-32 112 53 1 125 3 rplL Large ribosomal subunit protein bL12 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q18CE7 1e-31 111 55 1 118 3 rplL Large ribosomal subunit protein bL12 Clostridioides difficile (strain 630)
P02393 1.11e-31 111 55 1 125 1 rplL Large ribosomal subunit protein bL12 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q9F5M1 1.12e-31 111 59 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria perflava
B6YPZ8 1.23e-31 111 47 2 121 3 rplL Large ribosomal subunit protein bL12 Azobacteroides pseudotrichonymphae genomovar. CFP2
O78414 1.39e-31 111 52 2 124 3 rpl12 Large ribosomal subunit protein bL12c Guillardia theta
B5EFP2 1.44e-31 111 58 1 126 3 rplL Large ribosomal subunit protein bL12 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C5CGE0 1.66e-31 111 54 2 128 3 rplL Large ribosomal subunit protein bL12 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q46WD3 2.56e-31 110 62 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q39Y14 2.82e-31 110 58 1 124 3 rplL Large ribosomal subunit protein bL12 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
E6MUA0 2.89e-31 110 58 1 123 1 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)
A1KRG5 2.89e-31 110 58 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0X1 2.89e-31 110 58 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0X0 2.89e-31 110 58 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3X5 2.89e-31 110 58 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup C (strain 053442)
Q3ZXY0 3.12e-31 110 57 1 120 3 rplL Large ribosomal subunit protein bL12 Dehalococcoides mccartyi (strain CBDB1)
Q8PC57 3.59e-31 110 63 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU90 3.59e-31 110 63 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas campestris pv. campestris (strain B100)
Q4URD1 3.59e-31 110 63 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas campestris pv. campestris (strain 8004)
B2S093 3.62e-31 110 57 1 122 3 rplL Large ribosomal subunit protein bL12 Borrelia hermsii (strain HS1 / DAH)
Q4ZMN6 4.09e-31 110 63 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas syringae pv. syringae (strain B728a)
Q48D28 4.09e-31 110 63 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4G9U6 4.51e-31 110 64 1 124 3 rplL Large ribosomal subunit protein bL12 Herminiimonas arsenicoxydans
B9M6V3 4.57e-31 110 60 1 123 3 rplL Large ribosomal subunit protein bL12 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q748Y5 4.97e-31 110 58 1 124 3 rplL Large ribosomal subunit protein bL12 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q3BWZ2 5.32e-31 109 61 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNT1 6.62e-31 109 61 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas axonopodis pv. citri (strain 306)
Q6FF91 6.99e-31 109 63 0 121 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q30X07 8.03e-31 109 57 1 124 3 rplL Large ribosomal subunit protein bL12 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B9L7J5 8.4e-31 109 51 1 124 3 rplL Large ribosomal subunit protein bL12 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A6T3L4 8.97e-31 109 63 1 124 3 rplL Large ribosomal subunit protein bL12 Janthinobacterium sp. (strain Marseille)
B3R7T7 1.33e-30 108 61 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K605 1.33e-30 108 61 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B5ELX1 1.81e-30 108 56 1 128 3 rplL Large ribosomal subunit protein bL12 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J458 1.81e-30 108 56 1 128 3 rplL Large ribosomal subunit protein bL12 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
P02395 2.08e-30 108 57 1 119 1 rplL Large ribosomal subunit protein bL12 Micrococcus luteus
P07472 2.65e-30 108 60 1 123 1 rplL Large ribosomal subunit protein bL12 Halophilic eubacterium NRCC 41227
Q889X9 2.68e-30 107 62 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B3EER1 2.9e-30 107 51 2 127 3 rplL Large ribosomal subunit protein bL12 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B4RQW1 3.13e-30 107 57 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5R4 3.13e-30 107 57 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B5RRJ8 3.76e-30 107 57 1 123 3 rplL Large ribosomal subunit protein bL12 Borrelia recurrentis (strain A1)
B5RLV0 3.76e-30 107 57 1 123 3 rplL Large ribosomal subunit protein bL12 Borrelia duttonii (strain Ly)
Q1XDE8 3.88e-30 107 50 3 129 3 rpl12 Large ribosomal subunit protein bL12c Neopyropia yezoensis
Q5N3N6 4.25e-30 107 54 2 128 3 rplL Large ribosomal subunit protein bL12 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31QK6 4.25e-30 107 54 2 128 3 rplL Large ribosomal subunit protein bL12 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q1AU21 4.34e-30 107 52 1 128 3 rplL Large ribosomal subunit protein bL12 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B7I359 4.6e-30 107 63 1 122 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain AB0057)
A1TVT1 4.67e-30 107 59 1 126 3 rplL Large ribosomal subunit protein bL12 Paracidovorax citrulli (strain AAC00-1)
A8EVZ5 5.45e-30 107 54 1 123 3 rplL Large ribosomal subunit protein bL12 Aliarcobacter butzleri (strain RM4018)
B1HMZ8 6.39e-30 107 60 0 119 3 rplL Large ribosomal subunit protein bL12 Lysinibacillus sphaericus (strain C3-41)
B0VDG3 6.71e-30 107 62 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain AYE)
A3M1G2 6.71e-30 107 62 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VLZ7 6.71e-30 107 62 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain SDF)
B2I1Z0 6.71e-30 107 62 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain ACICU)
B7H1J9 6.71e-30 107 62 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain AB307-0294)
Q30TP8 7.43e-30 106 51 1 122 3 rplL Large ribosomal subunit protein bL12 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B8FEU2 8.15e-30 107 58 1 124 3 rplL Large ribosomal subunit protein bL12 Desulfatibacillum aliphaticivorans
Q3A6Q5 8.29e-30 107 58 1 124 3 rplL Large ribosomal subunit protein bL12 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q6MJ06 8.38e-30 106 57 1 122 3 rplL Large ribosomal subunit protein bL12 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
C6C178 8.97e-30 107 57 1 126 3 rplL Large ribosomal subunit protein bL12 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A5GAY0 9.29e-30 106 59 1 123 3 rplL Large ribosomal subunit protein bL12 Geotalea uraniireducens (strain Rf4)
P14134 9.87e-30 106 60 1 122 1 rplL Large ribosomal subunit protein bL12 Halanaerobium praevalens
Q9PI32 1.02e-29 106 54 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B2TIG7 1.07e-29 106 60 1 120 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYA2 1.07e-29 106 60 1 120 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Alaska E43 / Type E3)
A6Q1M2 1.1e-29 106 48 1 127 3 rplL Large ribosomal subunit protein bL12 Nitratiruptor sp. (strain SB155-2)
A1VYJ3 1.11e-29 106 54 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FKR2 1.11e-29 106 54 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B8J1A7 1.17e-29 106 53 1 128 3 rplL Large ribosomal subunit protein bL12 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q7NQE5 1.18e-29 106 58 1 123 3 rplL Large ribosomal subunit protein bL12 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5HVZ0 1.25e-29 106 57 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni (strain RM1221)
Q03ZH3 1.27e-29 106 54 0 121 3 rplL Large ribosomal subunit protein bL12 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B3E7S7 1.36e-29 106 57 1 123 3 rplL Large ribosomal subunit protein bL12 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q2II87 1.45e-29 106 56 2 121 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter dehalogenans (strain 2CP-C)
B2UEN7 1.6e-29 105 59 1 124 3 rplL Large ribosomal subunit protein bL12 Ralstonia pickettii (strain 12J)
B7J1W2 1.78e-29 105 55 1 124 3 rplL Large ribosomal subunit protein bL12 Borreliella burgdorferi (strain ZS7)
O51351 1.78e-29 105 55 1 124 3 rplL Large ribosomal subunit protein bL12 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
A6Q6I1 1.86e-29 105 52 1 124 3 rplL Large ribosomal subunit protein bL12 Sulfurovum sp. (strain NBC37-1)
Q5GWS5 1.9e-29 105 61 2 123 3 rplL Large ribosomal subunit protein bL12 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQQ0 1.9e-29 105 61 2 123 3 rplL Large ribosomal subunit protein bL12 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZX7 1.9e-29 105 61 2 123 3 rplL Large ribosomal subunit protein bL12 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
P51339 2.1e-29 105 51 2 129 3 rpl12 Large ribosomal subunit protein bL12c Porphyra purpurea
B1X073 2.4e-29 105 51 2 133 3 rplL Large ribosomal subunit protein bL12 Crocosphaera subtropica (strain ATCC 51142 / BH68)
B9MH48 2.48e-29 105 57 1 126 3 rplL Large ribosomal subunit protein bL12 Acidovorax ebreus (strain TPSY)
A6LE82 2.78e-29 105 55 2 122 3 rplL Large ribosomal subunit protein bL12 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B0TC46 2.87e-29 105 59 1 121 3 rplL Large ribosomal subunit protein bL12 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B1JDX2 3.36e-29 105 56 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain W619)
P0A158 3.36e-29 105 56 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida
P0A157 3.36e-29 105 56 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK59 3.36e-29 105 56 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain GB-1)
A5VXN9 3.36e-29 105 56 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B7KIR5 3.71e-29 105 53 2 131 3 rplL Large ribosomal subunit protein bL12 Gloeothece citriformis (strain PCC 7424)
A1WCN0 3.71e-29 105 57 1 126 3 rplL Large ribosomal subunit protein bL12 Acidovorax sp. (strain JS42)
Q3K5Y0 4e-29 105 56 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas fluorescens (strain Pf0-1)
Q2W2I0 4.51e-29 104 59 1 118 3 rplL Large ribosomal subunit protein bL12 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A7H4Q6 4.54e-29 105 53 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q1IFX4 4.91e-29 104 57 1 122 3 rplL Large ribosomal subunit protein bL12 Pseudomonas entomophila (strain L48)
C0Q9Y0 5.01e-29 104 54 1 124 3 rplL Large ribosomal subunit protein bL12 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B1L936 5.1e-29 104 56 2 125 3 rplL Large ribosomal subunit protein bL12 Thermotoga sp. (strain RQ2)
A5IJW4 5.1e-29 104 56 2 125 3 rplL Large ribosomal subunit protein bL12 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
C0ZIG8 7.33e-29 104 61 1 120 3 rplL Large ribosomal subunit protein bL12 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A6W3A0 7.72e-29 104 66 1 123 3 rplL Large ribosomal subunit protein bL12 Marinomonas sp. (strain MWYL1)
A9BR97 8.82e-29 104 57 1 125 3 rplL Large ribosomal subunit protein bL12 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q2LQ88 1.02e-28 104 54 1 126 3 rplL Large ribosomal subunit protein bL12 Syntrophus aciditrophicus (strain SB)
Q63Q02 1.07e-28 103 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain K96243)
A3NEI8 1.07e-28 103 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain 668)
Q3JMQ2 1.07e-28 103 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain 1710b)
A3P0C6 1.07e-28 103 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain 1106a)
A1V8B3 1.07e-28 103 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain SAVP1)
Q62GJ6 1.07e-28 103 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain ATCC 23344)
A2S7G5 1.07e-28 103 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain NCTC 10229)
A3MRU4 1.07e-28 103 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain NCTC 10247)
A5FQQ9 1.5e-28 103 58 1 120 3 rplL Large ribosomal subunit protein bL12 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A7HCH8 1.55e-28 103 52 1 121 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter sp. (strain Fw109-5)
B1Y7H4 1.65e-28 103 56 1 124 3 rplL Large ribosomal subunit protein bL12 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A5N4N8 1.75e-28 103 59 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYA0 1.75e-28 103 59 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium kluyveri (strain NBRC 12016)
A5VR16 1.96e-28 103 59 1 118 3 rplL Large ribosomal subunit protein bL12 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A0LII3 2.09e-28 103 53 1 125 3 rplL Large ribosomal subunit protein bL12 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B2FQ37 2.28e-28 103 63 2 123 3 rplL Large ribosomal subunit protein bL12 Stenotrophomonas maltophilia (strain K279a)
A6LPQ3 2.45e-28 102 57 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A5GPD2 2.51e-28 103 53 2 130 3 rplL Large ribosomal subunit protein bL12 Synechococcus sp. (strain WH7803)
Q3Z7T6 2.78e-28 102 56 1 121 3 rplL Large ribosomal subunit protein bL12 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A5VC06 2.79e-28 102 59 1 120 3 rplL Large ribosomal subunit protein bL12 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
P23349 3.05e-28 102 57 2 128 1 rplL Large ribosomal subunit protein bL12 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B1XSP2 3.41e-28 102 57 1 125 3 rplL Large ribosomal subunit protein bL12 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B7JWT5 3.49e-28 102 46 2 132 3 rplL Large ribosomal subunit protein bL12 Rippkaea orientalis (strain PCC 8801 / RF-1)
A6X0A8 4.03e-28 102 58 1 118 3 rplL Large ribosomal subunit protein bL12 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q7W0S0 4.11e-28 102 61 1 127 3 rplL Large ribosomal subunit protein bL12 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2H0 4.11e-28 102 61 1 127 3 rplL Large ribosomal subunit protein bL12 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRE0 4.11e-28 102 61 1 127 3 rplL Large ribosomal subunit protein bL12 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9KGE3 4.18e-28 102 57 1 121 3 rplL Large ribosomal subunit protein bL12 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8F4F9 4.59e-28 102 57 2 126 3 rplL Large ribosomal subunit protein bL12 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B4S496 5.13e-28 102 53 1 124 3 rplL Large ribosomal subunit protein bL12 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q3A9Q5 5.17e-28 102 58 1 123 3 rplL Large ribosomal subunit protein bL12 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9PA85 8.27e-28 101 60 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain 9a5c)
C4XIP0 8.27e-28 102 51 1 126 3 rplL Large ribosomal subunit protein bL12 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B2IK54 8.76e-28 101 58 1 120 3 rplL Large ribosomal subunit protein bL12 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q5FTX6 9.09e-28 101 58 1 119 3 rplL Large ribosomal subunit protein bL12 Gluconobacter oxydans (strain 621H)
P0A469 9.86e-28 101 58 1 118 3 rplL Large ribosomal subunit protein bL12 Brucella suis biovar 1 (strain 1330)
B0CH42 9.86e-28 101 58 1 118 3 rplL Large ribosomal subunit protein bL12 Brucella suis (strain ATCC 23445 / NCTC 10510)
P0A468 9.86e-28 101 58 1 118 3 rplL Large ribosomal subunit protein bL12 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJL2 9.86e-28 101 58 1 118 3 rplL Large ribosomal subunit protein bL12 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5R1 9.86e-28 101 58 1 118 3 rplL Large ribosomal subunit protein bL12 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
P0A470 9.86e-28 101 58 1 118 3 rplL Large ribosomal subunit protein bL12 Brucella abortus biovar 1 (strain 9-941)
Q2YM14 9.86e-28 101 58 1 118 3 rplL Large ribosomal subunit protein bL12 Brucella abortus (strain 2308)
B2S688 9.86e-28 101 58 1 118 3 rplL Large ribosomal subunit protein bL12 Brucella abortus (strain S19)
A1WK54 1.1e-27 101 55 1 124 3 rplL Large ribosomal subunit protein bL12 Verminephrobacter eiseniae (strain EF01-2)
Q8ETZ0 1.11e-27 101 54 1 120 3 rplL Large ribosomal subunit protein bL12 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B6JER8 1.12e-27 101 59 1 119 3 rplL Large ribosomal subunit protein bL12 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q92QH8 1.4e-27 101 58 1 120 3 rplL Large ribosomal subunit protein bL12 Rhizobium meliloti (strain 1021)
Q87A31 1.47e-27 100 59 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5X8 1.47e-27 100 59 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain M12)
B2IA69 1.47e-27 100 59 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain M23)
A0L5W5 1.5e-27 100 56 1 123 3 rplL Large ribosomal subunit protein bL12 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A6U850 1.53e-27 100 59 1 119 3 rplL Large ribosomal subunit protein bL12 Sinorhizobium medicae (strain WSM419)
Q4L3K1 1.61e-27 100 51 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus haemolyticus (strain JCSC1435)
A7GK11 1.82e-27 100 55 0 119 3 rplL Large ribosomal subunit protein bL12 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q134R7 1.95e-27 100 59 1 117 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain BisB5)
A5FZX2 2.11e-27 100 53 1 119 3 rplL Large ribosomal subunit protein bL12 Acidiphilium cryptum (strain JF-5)
Q8DM25 2.29e-27 100 52 2 132 3 rplL Large ribosomal subunit protein bL12 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B2JA77 2.7e-27 100 48 2 130 3 rplL Large ribosomal subunit protein bL12 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q2L2M6 2.87e-27 100 60 1 126 3 rplL Large ribosomal subunit protein bL12 Bordetella avium (strain 197N)
A6KYK4 2.93e-27 100 52 2 121 3 rplL Large ribosomal subunit protein bL12 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
P05392 2.99e-27 100 56 1 122 1 rplL Large ribosomal subunit protein bL12 Geobacillus stearothermophilus
C6E4R5 3.1e-27 100 57 1 126 3 rplL Large ribosomal subunit protein bL12 Geobacter sp. (strain M21)
B7GJ57 3.17e-27 100 57 1 121 3 rplL Large ribosomal subunit protein bL12 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q250P5 3.23e-27 100 60 1 119 3 rplL Large ribosomal subunit protein bL12 Desulfitobacterium hafniense (strain Y51)
B8G1V3 3.23e-27 100 60 1 119 3 rplL Large ribosomal subunit protein bL12 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q2K9M5 3.37e-27 100 57 1 121 3 rplL Large ribosomal subunit protein bL12 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PW58 3.37e-27 100 57 1 121 3 rplL Large ribosomal subunit protein bL12 Rhizobium etli (strain CIAT 652)
A6GYU1 3.41e-27 100 55 1 109 3 rplL Large ribosomal subunit protein bL12 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q21SF6 3.95e-27 100 59 1 123 3 rplL Large ribosomal subunit protein bL12 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q11HB2 4.41e-27 99 57 1 119 3 rplL Large ribosomal subunit protein bL12 Chelativorans sp. (strain BNC1)
Q8A468 4.79e-27 99 52 2 121 3 rplL Large ribosomal subunit protein bL12 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q0SQD5 4.85e-27 99 57 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium perfringens (strain SM101 / Type A)
Q0TMN7 4.85e-27 99 57 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q9ZE21 5.25e-27 99 52 2 115 3 rplL Large ribosomal subunit protein bL12 Rickettsia prowazekii (strain Madrid E)
A9VNB3 6.03e-27 99 57 0 119 3 rplL Large ribosomal subunit protein bL12 Bacillus mycoides (strain KBAB4)
Q0BUQ8 6.05e-27 99 55 1 120 3 rplL Large ribosomal subunit protein bL12 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
C5CKF2 6.12e-27 99 58 1 125 3 rplL Large ribosomal subunit protein bL12 Variovorax paradoxus (strain S110)
Q8YLJ5 6.31e-27 99 49 2 130 3 rplL Large ribosomal subunit protein bL12 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A4XZ98 6.82e-27 99 56 1 123 3 rplL Large ribosomal subunit protein bL12 Pseudomonas mendocina (strain ymp)
B4SKV5 7.89e-27 99 61 2 123 3 rplL Large ribosomal subunit protein bL12 Stenotrophomonas maltophilia (strain R551-3)
A8F973 8.1e-27 99 54 0 121 3 rplL Large ribosomal subunit protein bL12 Bacillus pumilus (strain SAFR-032)
A4SUV3 8.53e-27 99 56 1 124 3 rplL Large ribosomal subunit protein bL12 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A9H3S4 9.36e-27 99 56 1 119 3 rplL Large ribosomal subunit protein bL12 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q9TL30 9.96e-27 99 46 2 128 3 rpl12 Large ribosomal subunit protein bL12c Nephroselmis olivacea
B9LI32 1.01e-26 99 53 2 128 3 rplL Large ribosomal subunit protein bL12 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WFP9 1.01e-26 99 53 2 128 3 rplL Large ribosomal subunit protein bL12 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q98N67 1.1e-26 99 56 1 119 3 rplL Large ribosomal subunit protein bL12 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8KG16 1.15e-26 99 53 1 123 3 rplL Large ribosomal subunit protein bL12 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q0I6L0 1.19e-26 99 54 2 128 3 rplL Large ribosomal subunit protein bL12 Synechococcus sp. (strain CC9311)
Q1IHH3 1.22e-26 99 54 1 113 3 rplL Large ribosomal subunit protein bL12 Koribacter versatilis (strain Ellin345)
A7GJ83 1.25e-26 98 58 1 122 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q07KK6 1.3e-26 98 58 1 117 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain BisA53)
B0UHX7 1.38e-26 98 58 1 120 3 rplL Large ribosomal subunit protein bL12 Methylobacterium sp. (strain 4-46)
Q1H4P5 1.4e-26 98 60 1 128 3 rplL Large ribosomal subunit protein bL12 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A4IJH9 1.43e-26 98 56 1 122 3 rplL Large ribosomal subunit protein bL12 Geobacillus thermodenitrificans (strain NG80-2)
Q5L407 1.59e-26 98 55 1 122 3 rplL Large ribosomal subunit protein bL12 Geobacillus kaustophilus (strain HTA426)
A9IJ27 1.7e-26 98 61 1 126 3 rplL Large ribosomal subunit protein bL12 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B1KSN4 1.91e-26 98 58 1 122 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Loch Maree / Type A3)
C3KVR0 1.91e-26 98 58 1 122 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain 657 / Type Ba4)
B2S2I7 1.97e-26 98 50 4 126 3 rplL Large ribosomal subunit protein bL12 Treponema pallidum subsp. pallidum (strain SS14)
O83268 1.97e-26 98 50 4 126 3 rplL Large ribosomal subunit protein bL12 Treponema pallidum (strain Nichols)
Q64NJ6 2.04e-26 98 52 2 121 3 rplL Large ribosomal subunit protein bL12 Bacteroides fragilis (strain YCH46)
Q5L896 2.04e-26 98 52 2 121 3 rplL Large ribosomal subunit protein bL12 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B8EMS0 2.23e-26 98 56 1 122 3 rplL Large ribosomal subunit protein bL12 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q1GSF9 2.49e-26 97 59 1 119 3 rplL Large ribosomal subunit protein bL12 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q0BJ55 2.65e-26 97 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRC1 2.65e-26 97 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia ambifaria (strain MC40-6)
Q8CTT1 2.67e-26 97 50 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRL2 2.67e-26 97 50 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B1IGG3 2.78e-26 97 56 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Okra / Type B1)
C1FMW0 2.78e-26 97 56 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Kyoto / Type A2)
A5I7L5 2.78e-26 97 56 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZ78 2.78e-26 97 56 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain ATCC 19397 / Type A)
A5D5H9 2.79e-26 97 57 1 125 3 rplL Large ribosomal subunit protein bL12 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q1QN45 2.8e-26 97 57 1 118 3 rplL Large ribosomal subunit protein bL12 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B4SG12 3.08e-26 97 49 2 126 3 rplL Large ribosomal subunit protein bL12 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B8IS76 3.19e-26 97 57 1 120 3 rplL Large ribosomal subunit protein bL12 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q01VB0 3.56e-26 97 54 2 123 3 rplL Large ribosomal subunit protein bL12 Solibacter usitatus (strain Ellin6076)
B1XJG9 3.6e-26 97 52 2 128 3 rplL Large ribosomal subunit protein bL12 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B3QC01 4.03e-26 97 56 1 119 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain TIE-1)
Q6N4R8 4.03e-26 97 56 1 119 1 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q89J73 4.03e-26 97 55 1 119 3 rplL Large ribosomal subunit protein bL12 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B1I1M6 4.05e-26 97 51 1 122 3 rplL Large ribosomal subunit protein bL12 Desulforudis audaxviator (strain MP104C)
Q5WLS2 4.55e-26 97 56 1 120 3 rplL Large ribosomal subunit protein bL12 Shouchella clausii (strain KSM-K16)
A0PXT7 5.28e-26 97 52 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium novyi (strain NT)
A5ELN8 5.41e-26 97 57 1 119 3 rplL Large ribosomal subunit protein bL12 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q2SU18 5.49e-26 97 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q211D7 5.64e-26 97 57 1 117 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain BisB18)
B0S065 5.7e-26 97 57 2 125 3 rplL Large ribosomal subunit protein bL12 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B9E8Q7 6.64e-26 96 55 1 121 3 rplL Large ribosomal subunit protein bL12 Macrococcus caseolyticus (strain JCSC5402)
Q8XHR7 7.08e-26 96 56 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium perfringens (strain 13 / Type A)
A7HWQ3 7.41e-26 96 57 1 117 3 rplL Large ribosomal subunit protein bL12 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B1MVU1 8.43e-26 96 52 0 121 3 rplL Large ribosomal subunit protein bL12 Leuconostoc citreum (strain KM20)
A7IKP9 9.16e-26 96 58 1 118 3 rplL Large ribosomal subunit protein bL12 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q3AGT2 9.74e-26 96 56 2 129 3 rplL Large ribosomal subunit protein bL12 Synechococcus sp. (strain CC9605)
P31915 1.12e-25 96 43 3 131 3 rpl12 Large ribosomal subunit protein bL12c Euglena gracilis
B3EL60 1.17e-25 96 50 1 120 3 rplL Large ribosomal subunit protein bL12 Chlorobium phaeobacteroides (strain BS1)
A6TWJ1 1.25e-25 95 57 1 117 3 rplL Large ribosomal subunit protein bL12 Alkaliphilus metalliredigens (strain QYMF)
A1BD22 1.31e-25 96 48 2 127 3 rplL Large ribosomal subunit protein bL12 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q2IXS1 1.39e-25 95 58 1 117 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain HaA2)
A4YSI0 1.44e-25 95 55 1 119 3 rplL Large ribosomal subunit protein bL12 Bradyrhizobium sp. (strain ORS 278)
Q3B1H6 1.45e-25 95 50 2 125 3 rplL Large ribosomal subunit protein bL12 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
C0QWX5 1.5e-25 96 49 2 128 3 rplL Large ribosomal subunit protein bL12 Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q160X6 1.62e-25 95 54 3 110 3 rplL Large ribosomal subunit protein bL12 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q65PB7 1.79e-25 95 53 1 123 3 rplL Large ribosomal subunit protein bL12 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q49V50 1.98e-25 95 50 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B9JVM7 2.29e-25 95 60 1 118 3 rplL Large ribosomal subunit protein bL12 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q830Q8 2.34e-25 95 59 2 119 3 rplL Large ribosomal subunit protein bL12 Enterococcus faecalis (strain ATCC 700802 / V583)
Q3SSY1 2.86e-25 95 55 1 119 3 rplL Large ribosomal subunit protein bL12 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A1VAJ7 2.86e-25 95 55 1 127 3 rplL Large ribosomal subunit protein bL12 Nitratidesulfovibrio vulgaris (strain DP4)
Q727C8 2.86e-25 95 55 1 127 3 rplL Large ribosomal subunit protein bL12 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B3QYL3 3.02e-25 95 48 1 125 3 rplL Large ribosomal subunit protein bL12 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q2RQV2 3.59e-25 95 58 1 117 3 rplL Large ribosomal subunit protein bL12 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A4SGK7 3.59e-25 95 50 2 125 3 rplL Large ribosomal subunit protein bL12 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q6NJG5 3.82e-25 95 55 2 123 3 rplL Large ribosomal subunit protein bL12 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B8G988 3.82e-25 95 53 1 128 3 rplL Large ribosomal subunit protein bL12 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q7MX28 3.84e-25 95 52 2 122 3 rplL Large ribosomal subunit protein bL12 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RL46 3.84e-25 95 52 2 122 3 rplL Large ribosomal subunit protein bL12 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
A9ADI4 4.74e-25 94 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia multivorans (strain ATCC 17616 / 249)
A7Z0M7 4.82e-25 94 52 1 123 3 rplL Large ribosomal subunit protein bL12 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P02394 4.82e-25 94 52 1 123 1 rplL Large ribosomal subunit protein bL12 Bacillus subtilis (strain 168)
Q8KTP9 4.92e-25 94 40 1 121 3 rplL Large ribosomal subunit protein bL12 Tremblaya princeps
B1ZGR9 4.96e-25 94 56 1 120 3 rplL Large ribosomal subunit protein bL12 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B8D0B5 5.43e-25 94 55 1 123 3 rplL Large ribosomal subunit protein bL12 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B4UDT3 5.74e-25 94 55 2 122 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter sp. (strain K)
B8JB71 5.74e-25 94 55 2 122 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
P56345 5.8e-25 94 43 2 130 3 rpl12 Large ribosomal subunit protein bL12c Chlorella vulgaris
B3ETZ1 6.47e-25 94 50 1 114 3 rplL Large ribosomal subunit protein bL12 Amoebophilus asiaticus (strain 5a2)
B3QQS3 6.58e-25 94 51 1 123 3 rplL Large ribosomal subunit protein bL12 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
C3MAX1 7.06e-25 94 57 1 121 3 rplL Large ribosomal subunit protein bL12 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A9GRA8 7.66e-25 94 49 1 125 3 rplL Large ribosomal subunit protein bL12 Sorangium cellulosum (strain So ce56)
Q6FZL8 8.21e-25 94 57 1 117 3 rplL Large ribosomal subunit protein bL12 Bartonella quintana (strain Toulouse)
Q3MA16 8.45e-25 94 50 2 128 3 rplL Large ribosomal subunit protein bL12 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B9JDS0 9.16e-25 94 57 1 119 3 rplL Large ribosomal subunit protein bL12 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B0CAD2 9.27e-25 94 48 2 125 3 rplL Large ribosomal subunit protein bL12 Acaryochloris marina (strain MBIC 11017)
Q5NPK7 1.4e-24 93 58 1 117 3 rplL Large ribosomal subunit protein bL12 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q3AUJ8 1.41e-24 93 56 2 128 3 rplL Large ribosomal subunit protein bL12 Synechococcus sp. (strain CC9902)
A1USC7 1.54e-24 93 58 1 117 3 rplL Large ribosomal subunit protein bL12 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q98QS2 1.55e-24 93 43 0 116 3 rplL Large ribosomal subunit protein bL12 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q67JT2 1.7e-24 93 58 1 122 3 rplL Large ribosomal subunit protein bL12 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q39KH6 1.93e-24 93 57 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1MIF0 2.19e-24 93 57 1 119 3 rplL Large ribosomal subunit protein bL12 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8UE07 2.39e-24 92 57 1 119 1 rplL Large ribosomal subunit protein bL12 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6G3X6 2.41e-24 92 58 1 117 3 rplL Large ribosomal subunit protein bL12 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
P36247 2.56e-24 92 49 2 117 3 rplL Large ribosomal subunit protein bL12 Liberibacter asiaticus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13760
Feature type CDS
Gene rplL
Product 50S ribosomal protein L7/L12
Location 3062195 - 3062560 (strand: -1)
Length 366 (nucleotides) / 121 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2288
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00542 Ribosomal protein L7/L12 C-terminal domain
PF16320 Ribosomal protein L7/L12 dimerisation domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0222 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L7/L12

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02935 large subunit ribosomal protein L7/L12 Ribosome -

Protein Sequence

MSISKDDILNAVAEMSVMDVVELITMMEEKFGVSAAAAVAVAAGPAEAAEEKTEFDVILKGIGGNKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK

Flanking regions ( +/- flanking 50bp)

TCGTTGCTTTACTACGTATAAACTTTTTCTGAATTTTAGGAACAATTGTTATGTCTATCTCTAAAGACGATATCTTAAATGCAGTTGCTGAAATGTCTGTAATGGACGTTGTTGAACTGATCACTATGATGGAAGAAAAATTCGGTGTATCTGCTGCTGCAGCTGTTGCTGTTGCTGCGGGTCCAGCAGAAGCTGCTGAAGAAAAAACTGAATTCGACGTTATCCTGAAAGGTATCGGCGGTAACAAAGTAGCAGTAATCAAAGCAGTACGTGGCGCTACCGGTCTTGGTCTGAAAGAAGCTAAAGACTTAGTAGAATCTGCTCCAGCAGCTCTGAAAGAAGGCGTAAGCAAAGATGATGCTGAAGCTCTGAAGAAAGCTCTGGAAGAAGCAGGTGCTGAGGTTGAAGTTAAGTAATTTAACTTCCCAGAGAGCAGCCTAACGGCTGATGGCTGGTGATTTTTTGG