Homologs in group_2323

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_18055 EHELCC_18055 100.0 Morganella morganii S2 rplL 50S ribosomal protein L7/L12
NLDBIP_18095 NLDBIP_18095 100.0 Morganella morganii S4 rplL 50S ribosomal protein L7/L12
LHKJJB_18290 LHKJJB_18290 100.0 Morganella morganii S3 rplL 50S ribosomal protein L7/L12
HKOGLL_17910 HKOGLL_17910 100.0 Morganella morganii S5 rplL 50S ribosomal protein L7/L12
F4V73_RS14955 F4V73_RS14955 96.7 Morganella psychrotolerans rplL 50S ribosomal protein L7/L12
PMI_RS13760 PMI_RS13760 91.7 Proteus mirabilis HI4320 rplL 50S ribosomal protein L7/L12

Distribution of the homologs in the orthogroup group_2323

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2323

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B7MRB2 7.18e-62 187 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O81 (strain ED1a)
Q3YUZ8 1.27e-56 174 92 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella sonnei (strain Ss046)
A8AKU0 2.62e-56 173 91 0 121 3 rplL Large ribosomal subunit protein bL12 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TGN9 3.72e-56 173 90 0 121 3 rplL Large ribosomal subunit protein bL12 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XYF6 3.72e-56 173 90 0 121 3 rplL Large ribosomal subunit protein bL12 Klebsiella pneumoniae (strain 342)
P0A7K5 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella flexneri
Q0SY14 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella flexneri serotype 5b (strain 8401)
Q32AF8 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella dysenteriae serotype 1 (strain Sd197)
Q31U11 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella boydii serotype 4 (strain Sb227)
B2TWH2 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUL6 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5V1 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain UTI89 / UPEC)
B1LNT8 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain SMS-3-5 / SECEC)
B6I5J6 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain SE11)
B7NFS6 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7K2 5.28e-56 172 91 0 121 1 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain K12)
B1IUR1 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7K3 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA79 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A785 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O9:H4 (strain HS)
B1XBY8 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain K12 / DH10B)
C5A0S6 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M733 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O8 (strain IAI1)
B7NRR4 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z082 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7K4 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O157:H7
B7LA79 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain 55989 / EAEC)
B7MIX2 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPE1 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUK0 5.28e-56 172 91 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O139:H28 (strain E24377A / ETEC)
C3LR59 3.22e-55 171 79 2 123 3 rplL Large ribosomal subunit protein bL12 Vibrio cholerae serotype O1 (strain M66-2)
Q9KV31 3.22e-55 171 79 2 123 3 rplL Large ribosomal subunit protein bL12 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3P4 3.22e-55 171 79 2 123 3 rplL Large ribosomal subunit protein bL12 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0A299 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2A0 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella typhi
B4TQJ4 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella schwarzengrund (strain CVM19633)
B5BJQ2 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi A (strain AKU_12601)
C0Q2R6 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi C (strain RKS4594)
A9N0J3 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK94 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0Y8 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella newport (strain SL254)
B4TCS3 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella heidelberg (strain SL476)
B5RFK2 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYD7 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella enteritidis PT4 (strain P125109)
B5FQJ8 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella dublin (strain CT_02021853)
Q57H70 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella choleraesuis (strain SC-B67)
B5F0W6 8.94e-55 169 92 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella agona (strain SL483)
Q6DAN1 1.51e-54 169 89 0 121 3 rplL Large ribosomal subunit protein bL12 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DHR4 2.12e-54 169 89 0 121 3 rplL Large ribosomal subunit protein bL12 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4EYV0 3.33e-54 168 91 0 121 3 rplL Large ribosomal subunit protein bL12 Proteus mirabilis (strain HI4320)
A4W5A6 1.23e-53 167 91 0 121 3 rplL Large ribosomal subunit protein bL12 Enterobacter sp. (strain 638)
A0KQA6 5.51e-53 165 80 0 121 3 rplL Large ribosomal subunit protein bL12 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q2NWR7 6.07e-53 165 88 1 122 3 rplL Large ribosomal subunit protein bL12 Sodalis glossinidius (strain morsitans)
A7MQP6 6.21e-53 165 87 1 122 3 rplL Large ribosomal subunit protein bL12 Cronobacter sakazakii (strain ATCC BAA-894)
Q1LSX8 9.02e-53 164 67 0 121 3 rplL Large ribosomal subunit protein bL12 Baumannia cicadellinicola subsp. Homalodisca coagulata
A9MHF3 2.07e-52 164 86 1 123 3 rplL Large ribosomal subunit protein bL12 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P41188 3.36e-52 163 68 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8D6V1 2.49e-51 161 66 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57147 2.49e-51 161 66 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8J7 2.49e-51 161 66 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q3ILQ0 5.63e-51 160 74 2 122 3 rplL Large ribosomal subunit protein bL12 Pseudoalteromonas translucida (strain TAC 125)
B2VG95 1.85e-50 159 82 0 121 3 rplL Large ribosomal subunit protein bL12 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7N9A5 4.74e-50 157 82 2 123 3 rplL Large ribosomal subunit protein bL12 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G8E6 7.79e-50 157 80 0 121 3 rplL Large ribosomal subunit protein bL12 Serratia proteamaculans (strain 568)
Q65W43 9.74e-50 157 77 1 122 3 rplL Large ribosomal subunit protein bL12 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1REA6 1.79e-49 156 73 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain W3-18-1)
A4YBZ1 1.79e-49 156 73 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK75 1.79e-49 156 73 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P44348 2.2e-49 156 78 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHD2 2.2e-49 156 78 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain PittGG)
A5UE95 2.2e-49 156 78 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain PittEE)
Q4QMS6 2.2e-49 156 78 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain 86-028NP)
Q492B8 2.43e-49 156 64 1 122 3 rplL Large ribosomal subunit protein bL12 Blochmanniella pennsylvanica (strain BPEN)
A4SHU8 2.97e-49 155 80 1 121 3 rplL Large ribosomal subunit protein bL12 Aeromonas salmonicida (strain A449)
A8GYW8 2.65e-48 153 71 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q7VKL5 3.27e-48 153 77 1 121 3 rplL Large ribosomal subunit protein bL12 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q089R2 4.95e-48 152 71 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella frigidimarina (strain NCIMB 400)
B1JJJ7 1.33e-47 151 77 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FQ3 1.33e-47 151 77 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS30 1.33e-47 151 77 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis (strain Pestoides F)
Q1CN79 1.33e-47 151 77 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAP4 1.33e-47 151 77 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis
B2K111 1.33e-47 151 77 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1U0 1.33e-47 151 77 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNI4 1.33e-47 151 77 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q89B19 1.7e-47 151 66 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B0BSE8 1.94e-47 151 77 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYU7 1.94e-47 151 77 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N319 1.94e-47 151 77 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0TM20 4.73e-47 150 73 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella halifaxensis (strain HAW-EB4)
B7VM70 8.09e-47 149 80 0 121 3 rplL Large ribosomal subunit protein bL12 Vibrio atlanticus (strain LGP32)
A9R0H7 2.74e-46 148 69 1 128 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis bv. Antiqua (strain Angola)
A6VKC6 3.87e-46 148 72 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A1JIH9 3.91e-46 148 75 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B5FC89 1.45e-45 146 77 1 122 3 rplL Large ribosomal subunit protein bL12 Aliivibrio fischeri (strain MJ11)
Q5E236 1.45e-45 146 77 1 122 3 rplL Large ribosomal subunit protein bL12 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5NID3 1.56e-45 146 74 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JT6 1.56e-45 146 74 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. tularensis (strain FSC 198)
B8F6N0 2.28e-45 146 76 1 122 3 rplL Large ribosomal subunit protein bL12 Glaesserella parasuis serovar 5 (strain SH0165)
Q7VRP6 2.72e-45 145 60 2 126 3 rplL Large ribosomal subunit protein bL12 Blochmanniella floridana
C4LBV3 2.75e-45 145 76 0 121 3 rplL Large ribosomal subunit protein bL12 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B6ENR4 3.31e-45 145 79 0 121 3 rplL Large ribosomal subunit protein bL12 Aliivibrio salmonicida (strain LFI1238)
B0UUZ7 3.81e-45 145 72 1 122 3 rplL Large ribosomal subunit protein bL12 Histophilus somni (strain 2336)
Q0I0U9 3.81e-45 145 72 1 122 3 rplL Large ribosomal subunit protein bL12 Histophilus somni (strain 129Pt)
Q7MGR7 5.41e-45 145 77 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio vulnificus (strain YJ016)
Q8DD21 5.41e-45 145 77 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio vulnificus (strain CMCP6)
Q9CK90 2.43e-44 143 74 1 122 3 rplL Large ribosomal subunit protein bL12 Pasteurella multocida (strain Pm70)
B0TX09 7.06e-44 142 75 1 124 3 rplL Large ribosomal subunit protein bL12 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A7MXF2 8.93e-44 142 72 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio campbellii (strain ATCC BAA-1116)
Q87KQ3 4.71e-43 140 77 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A9KW94 5.21e-43 140 71 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella baltica (strain OS195)
A6WHS0 5.21e-43 140 71 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella baltica (strain OS185)
A1T066 8.08e-43 139 75 0 121 3 rplL Large ribosomal subunit protein bL12 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A3Q974 8.7e-43 139 72 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q5QWA6 3.19e-42 138 73 1 124 3 rplL Large ribosomal subunit protein bL12 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q6LLW1 4.52e-42 138 75 0 121 3 rplL Large ribosomal subunit protein bL12 Photobacterium profundum (strain SS9)
B8EBL3 5.08e-42 137 70 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella baltica (strain OS223)
B8CNC4 5.14e-42 137 70 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q4FQH2 5.52e-42 137 69 1 123 3 rplL Large ribosomal subunit protein bL12 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q12SW7 1.07e-41 136 72 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q1Q8P8 1.12e-41 136 69 1 123 3 rplL Large ribosomal subunit protein bL12 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B1KMZ1 2.32e-41 135 69 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella woodyi (strain ATCC 51908 / MS32)
Q15YB2 4.71e-41 135 69 1 123 3 rplL Large ribosomal subunit protein bL12 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
C4K4F2 1.22e-40 134 67 1 124 3 rplL Large ribosomal subunit protein bL12 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q3J8Q6 1.78e-40 134 64 1 126 3 rplL Large ribosomal subunit protein bL12 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A8ZV50 2.2e-40 133 61 1 126 3 rplL Large ribosomal subunit protein bL12 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q0HNU5 2.33e-40 133 70 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain MR-4)
Q2S904 3.6e-40 133 69 1 124 3 rplL Large ribosomal subunit protein bL12 Hahella chejuensis (strain KCTC 2396)
Q31IZ0 3.94e-40 132 69 1 123 3 rplL Large ribosomal subunit protein bL12 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q5WZM0 8.4e-40 132 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila (strain Lens)
Q5ZYQ1 8.4e-40 132 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHS2 8.4e-40 132 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila (strain Corby)
Q5X867 8.4e-40 132 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila (strain Paris)
Q0I0B3 2.76e-39 130 69 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain MR-7)
A0KRL6 2.76e-39 130 69 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain ANA-3)
A4IW98 2.81e-39 130 74 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BKC3 2.81e-39 130 74 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q868 2.81e-39 130 74 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. novicida (strain U112)
Q2A1M6 2.81e-39 130 74 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. holarctica (strain LVS)
A7NEC1 2.81e-39 130 74 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A8G1F6 3.72e-39 130 66 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella sediminis (strain HAW-EB3)
B2SFD5 4.1e-39 130 69 1 126 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. mediasiatica (strain FSC147)
A5WH36 4.16e-39 130 67 1 125 3 rplL Large ribosomal subunit protein bL12 Psychrobacter sp. (strain PRwf-1)
A5EX71 5.39e-39 130 64 1 122 3 rplL Large ribosomal subunit protein bL12 Dichelobacter nodosus (strain VCS1703A)
A5CW26 5.48e-39 130 59 1 121 3 rplL Large ribosomal subunit protein bL12 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q21M94 3.54e-38 128 69 1 126 3 rplL Large ribosomal subunit protein bL12 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q0ABI3 4.56e-38 127 63 1 125 3 rplL Large ribosomal subunit protein bL12 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q7VJ81 7.6e-38 127 57 1 126 3 rplL Large ribosomal subunit protein bL12 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q0VSM3 8.23e-38 127 64 1 125 3 rplL Large ribosomal subunit protein bL12 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q058E4 1.09e-37 126 51 1 121 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q8D234 2.67e-37 125 54 2 123 3 rplL Large ribosomal subunit protein bL12 Wigglesworthia glossinidia brevipalpis
B5YEX7 5.22e-37 125 56 1 125 3 rplL Large ribosomal subunit protein bL12 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q47UV8 6.99e-37 124 73 2 121 3 rplL Large ribosomal subunit protein bL12 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B5Z8J6 8.36e-37 124 56 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain G27)
B6JN38 8.36e-37 124 56 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain P12)
B2UUW1 8.54e-37 124 56 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain Shi470)
P56875 8.54e-37 124 56 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain J99 / ATCC 700824)
Q1CS67 8.54e-37 124 56 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain HPAG1)
B2V7M1 9.76e-37 124 61 1 126 3 rplL Large ribosomal subunit protein bL12 Sulfurihydrogenibium sp. (strain YO3AOP1)
P02393 9.79e-37 124 60 1 125 1 rplL Large ribosomal subunit protein bL12 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A1AX76 1.44e-36 124 59 1 122 3 rplL Large ribosomal subunit protein bL12 Ruthia magnifica subsp. Calyptogena magnifica
B8GV66 1.59e-36 124 59 1 125 3 rplL Large ribosomal subunit protein bL12 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1TYI9 2.45e-36 123 65 1 124 3 rplL Large ribosomal subunit protein bL12 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1KB35 3.7e-36 122 61 1 125 3 rplL Large ribosomal subunit protein bL12 Azoarcus sp. (strain BH72)
P55834 3.78e-36 122 56 1 125 1 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain ATCC 700392 / 26695)
A8MLD1 4.27e-36 122 59 2 122 3 rplL Large ribosomal subunit protein bL12 Alkaliphilus oremlandii (strain OhILAs)
Q60A07 5.36e-36 122 64 1 125 3 rplL Large ribosomal subunit protein bL12 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q17VN5 5.36e-36 122 55 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter acinonychis (strain Sheeba)
P0A467 5.92e-36 122 59 1 126 3 rplL Large ribosomal subunit protein bL12 Aquifex pyrophilus
P0A466 5.92e-36 122 59 1 126 3 rplL Large ribosomal subunit protein bL12 Aquifex aeolicus (strain VF5)
A1WVD0 6.05e-36 122 59 1 128 3 rplL Large ribosomal subunit protein bL12 Halorhodospira halophila (strain DSM 244 / SL1)
Q82T74 6.26e-36 122 61 1 124 3 rplL Large ribosomal subunit protein bL12 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B4U736 7.23e-36 122 61 1 125 3 rplL Large ribosomal subunit protein bL12 Hydrogenobaculum sp. (strain Y04AAS1)
A1S210 7.74e-36 122 69 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
C1DKK4 7.93e-36 122 63 1 122 3 rplL Large ribosomal subunit protein bL12 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1ALT3 9.3e-36 122 63 1 124 3 rplL Large ribosomal subunit protein bL12 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q8PC57 1.1e-35 121 68 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU90 1.1e-35 121 68 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas campestris pv. campestris (strain B100)
Q4URD1 1.1e-35 121 68 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas campestris pv. campestris (strain 8004)
A7ZCN6 2.1e-35 120 55 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter concisus (strain 13826)
C5BQ38 2.19e-35 120 66 1 126 3 rplL Large ribosomal subunit protein bL12 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B5EFP2 2.41e-35 120 63 1 126 3 rplL Large ribosomal subunit protein bL12 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q1MPU3 2.76e-35 120 61 2 128 3 rplL Large ribosomal subunit protein bL12 Lawsonia intracellularis (strain PHE/MN1-00)
Q0SNB7 4.68e-35 120 57 1 124 3 rplL Large ribosomal subunit protein bL12 Borreliella afzelii (strain PKo)
Q3BWZ2 4.78e-35 120 66 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q3SLQ7 5.22e-35 120 62 1 127 3 rplL Large ribosomal subunit protein bL12 Thiobacillus denitrificans (strain ATCC 25259)
C1DAQ9 5.35e-35 119 60 1 123 3 rplL Large ribosomal subunit protein bL12 Laribacter hongkongensis (strain HLHK9)
P0A0W9 5.43e-35 119 60 1 122 3 rplL Large ribosomal subunit protein bL12 Neisseria sicca
P0A0W8 5.43e-35 119 60 1 122 3 rplL Large ribosomal subunit protein bL12 Neisseria lactamica
Q5P340 6.71e-35 119 62 1 124 3 rplL Large ribosomal subunit protein bL12 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B9L7J5 9.01e-35 119 56 1 124 3 rplL Large ribosomal subunit protein bL12 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q6AP79 1.08e-34 119 65 1 123 3 rplL Large ribosomal subunit protein bL12 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B0K5G7 1.35e-34 119 60 1 125 3 rplL Large ribosomal subunit protein bL12 Thermoanaerobacter sp. (strain X514)
Q8PNT1 1.56e-34 118 65 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas axonopodis pv. citri (strain 306)
A6LKB9 1.69e-34 119 59 2 125 3 rplL Large ribosomal subunit protein bL12 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B0KCJ1 2.04e-34 118 60 1 125 3 rplL Large ribosomal subunit protein bL12 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
P02395 2.46e-34 118 61 1 119 1 rplL Large ribosomal subunit protein bL12 Micrococcus luteus
B3PK29 2.71e-34 118 68 1 122 3 rplL Large ribosomal subunit protein bL12 Cellvibrio japonicus (strain Ueda107)
A0RQI6 3.34e-34 117 56 1 124 3 rplL Large ribosomal subunit protein bL12 Campylobacter fetus subsp. fetus (strain 82-40)
Q11QA4 3.7e-34 117 56 2 119 3 rplL Large ribosomal subunit protein bL12 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
B8E0K0 4.24e-34 117 56 1 125 3 rplL Large ribosomal subunit protein bL12 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B9KFG6 4.48e-34 117 57 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q18CE7 4.49e-34 117 57 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridioides difficile (strain 630)
Q9F5M1 5.08e-34 117 61 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria perflava
C0QQL5 5.29e-34 117 60 1 125 3 rplL Large ribosomal subunit protein bL12 Persephonella marina (strain DSM 14350 / EX-H1)
Q1LI19 5.59e-34 117 61 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B5ELX1 6.28e-34 117 59 1 128 3 rplL Large ribosomal subunit protein bL12 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J458 6.28e-34 117 59 1 128 3 rplL Large ribosomal subunit protein bL12 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B1HMZ8 9e-34 116 64 0 119 3 rplL Large ribosomal subunit protein bL12 Lysinibacillus sphaericus (strain C3-41)
E6MUA0 1.42e-33 116 60 1 123 1 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)
A1KRG5 1.42e-33 116 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0X1 1.42e-33 116 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0X0 1.42e-33 116 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3X5 1.42e-33 116 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup C (strain 053442)
Q5GWS5 1.75e-33 115 65 2 123 3 rplL Large ribosomal subunit protein bL12 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQQ0 1.75e-33 115 65 2 123 3 rplL Large ribosomal subunit protein bL12 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZX7 1.75e-33 115 65 2 123 3 rplL Large ribosomal subunit protein bL12 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q30X07 1.94e-33 116 59 1 124 3 rplL Large ribosomal subunit protein bL12 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q39Y14 2.05e-33 115 61 1 124 3 rplL Large ribosomal subunit protein bL12 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q7MA57 2.07e-33 115 57 1 124 3 rplL Large ribosomal subunit protein bL12 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A7I3U0 2.21e-33 115 56 1 124 3 rplL Large ribosomal subunit protein bL12 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q3A6Q5 2.75e-33 115 61 1 125 3 rplL Large ribosomal subunit protein bL12 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A7GZK0 2.87e-33 115 54 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter curvus (strain 525.92)
B1GZ74 3.34e-33 115 53 1 122 3 rplL Large ribosomal subunit protein bL12 Endomicrobium trichonymphae
B8J1A7 3.41e-33 115 57 1 128 3 rplL Large ribosomal subunit protein bL12 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B3EER1 3.73e-33 115 53 2 127 3 rplL Large ribosomal subunit protein bL12 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q748Y5 4.08e-33 115 61 1 124 3 rplL Large ribosomal subunit protein bL12 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B9M6V3 4.23e-33 115 63 1 123 3 rplL Large ribosomal subunit protein bL12 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q3K5Y0 8.3e-33 114 59 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas fluorescens (strain Pf0-1)
A1QZH8 1.04e-32 114 57 2 123 3 rplL Large ribosomal subunit protein bL12 Borrelia turicatae (strain 91E135)
B1JDX2 1.19e-32 114 59 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain W619)
P0A158 1.19e-32 114 59 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida
P0A157 1.19e-32 114 59 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK59 1.19e-32 114 59 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain GB-1)
A5VXN9 1.19e-32 114 59 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B4RQW1 1.33e-32 114 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5R4 1.33e-32 114 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q7NQE5 1.45e-32 113 61 1 123 3 rplL Large ribosomal subunit protein bL12 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8R7U5 1.46e-32 114 58 1 125 3 rplL Large ribosomal subunit protein bL12 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
C5CGE0 1.56e-32 114 57 2 128 3 rplL Large ribosomal subunit protein bL12 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
B6YPZ8 1.88e-32 113 48 1 116 3 rplL Large ribosomal subunit protein bL12 Azobacteroides pseudotrichonymphae genomovar. CFP2
Q1IFX4 2.23e-32 113 60 1 122 3 rplL Large ribosomal subunit protein bL12 Pseudomonas entomophila (strain L48)
Q8XUZ7 4.66e-32 112 61 1 124 3 rplL Large ribosomal subunit protein bL12 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2YB06 8.9e-32 111 58 1 126 3 rplL Large ribosomal subunit protein bL12 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B2TIG7 9.1e-32 111 64 1 120 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYA2 9.1e-32 111 64 1 120 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Alaska E43 / Type E3)
B1XSP2 1.1e-31 111 60 1 125 3 rplL Large ribosomal subunit protein bL12 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A5GAY0 1.12e-31 111 62 1 123 3 rplL Large ribosomal subunit protein bL12 Geotalea uraniireducens (strain Rf4)
C3K2Y4 1.13e-31 111 65 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas fluorescens (strain SBW25)
Q1AU21 1.68e-31 111 53 1 128 3 rplL Large ribosomal subunit protein bL12 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
A7HCH8 1.78e-31 110 56 1 119 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter sp. (strain Fw109-5)
B2FQ37 1.8e-31 110 66 2 123 3 rplL Large ribosomal subunit protein bL12 Stenotrophomonas maltophilia (strain K279a)
B0TC46 2e-31 110 62 1 120 3 rplL Large ribosomal subunit protein bL12 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q6FF91 2.32e-31 110 66 0 121 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q46WD3 2.4e-31 110 62 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2W2I0 2.5e-31 110 61 1 119 3 rplL Large ribosomal subunit protein bL12 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B7GJ57 2.5e-31 110 61 1 121 3 rplL Large ribosomal subunit protein bL12 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B3E7S7 2.59e-31 110 60 1 123 3 rplL Large ribosomal subunit protein bL12 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B4SKV5 2.61e-31 110 66 2 123 3 rplL Large ribosomal subunit protein bL12 Stenotrophomonas maltophilia (strain R551-3)
C6C178 2.65e-31 110 59 1 127 3 rplL Large ribosomal subunit protein bL12 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B4S496 2.68e-31 110 57 1 122 3 rplL Large ribosomal subunit protein bL12 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A7GK11 3e-31 110 60 0 119 3 rplL Large ribosomal subunit protein bL12 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2II87 3.18e-31 110 57 1 118 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter dehalogenans (strain 2CP-C)
A6Q6I1 3.32e-31 110 55 1 124 3 rplL Large ribosomal subunit protein bL12 Sulfurovum sp. (strain NBC37-1)
A6Q1M2 3.58e-31 110 50 1 127 3 rplL Large ribosomal subunit protein bL12 Nitratiruptor sp. (strain SB155-2)
A9VNB3 3.62e-31 110 62 0 119 3 rplL Large ribosomal subunit protein bL12 Bacillus mycoides (strain KBAB4)
O78414 3.71e-31 110 52 2 125 3 rpl12 Large ribosomal subunit protein bL12c Guillardia theta
A6LPQ3 3.87e-31 110 60 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q8ETZ0 4.06e-31 110 58 1 120 3 rplL Large ribosomal subunit protein bL12 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A6X0A8 4.09e-31 110 60 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q6MJ06 4.8e-31 109 58 1 122 3 rplL Large ribosomal subunit protein bL12 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A5VR16 5.03e-31 109 60 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q30TP8 5.07e-31 109 55 1 122 3 rplL Large ribosomal subunit protein bL12 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
P0C8S3 5.27e-31 109 61 1 122 1 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAL3 5.27e-31 109 61 1 122 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD40 5.27e-31 109 61 1 122 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain Dugway 5J108-111)
B6J272 5.27e-31 109 61 1 122 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain CbuG_Q212)
B6J5C1 5.27e-31 109 61 1 122 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain CbuK_Q154)
Q0SQD5 5.32e-31 109 61 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium perfringens (strain SM101 / Type A)
Q0TMN7 5.32e-31 109 61 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
C4XIP0 5.56e-31 109 55 1 126 3 rplL Large ribosomal subunit protein bL12 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q4L3K1 5.59e-31 109 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus haemolyticus (strain JCSC1435)
Q1XDE8 7.71e-31 109 51 3 129 3 rpl12 Large ribosomal subunit protein bL12c Neopyropia yezoensis
P05392 7.85e-31 109 60 1 122 1 rplL Large ribosomal subunit protein bL12 Geobacillus stearothermophilus
Q47JB1 7.9e-31 109 60 1 123 3 rplL Large ribosomal subunit protein bL12 Dechloromonas aromatica (strain RCB)
Q9PA85 8.2e-31 109 64 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain 9a5c)
Q5L407 9.11e-31 109 60 1 122 3 rplL Large ribosomal subunit protein bL12 Geobacillus kaustophilus (strain HTA426)
A4SUV3 9.68e-31 108 60 1 124 3 rplL Large ribosomal subunit protein bL12 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B3R7T7 9.68e-31 108 61 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K605 9.68e-31 108 61 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B7I359 1.02e-30 108 65 1 122 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain AB0057)
A4IJH9 1.05e-30 108 61 1 122 3 rplL Large ribosomal subunit protein bL12 Geobacillus thermodenitrificans (strain NG80-2)
C6E4R5 1.19e-30 108 61 1 126 3 rplL Large ribosomal subunit protein bL12 Geobacter sp. (strain M21)
Q1R0I3 1.23e-30 108 60 1 124 3 rplL Large ribosomal subunit protein bL12 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B8FEU2 1.35e-30 108 58 1 124 3 rplL Large ribosomal subunit protein bL12 Desulfatibacillum aliphaticivorans
A6U850 1.37e-30 108 61 1 120 3 rplL Large ribosomal subunit protein bL12 Sinorhizobium medicae (strain WSM419)
Q87A31 1.45e-30 108 63 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5X8 1.45e-30 108 63 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain M12)
B2IA69 1.45e-30 108 63 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain M23)
B0VDG3 1.49e-30 108 65 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain AYE)
A3M1G2 1.49e-30 108 65 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VLZ7 1.49e-30 108 65 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain SDF)
B2I1Z0 1.49e-30 108 65 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain ACICU)
B7H1J9 1.49e-30 108 65 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain AB307-0294)
B2UEN7 1.53e-30 108 60 1 124 3 rplL Large ribosomal subunit protein bL12 Ralstonia pickettii (strain 12J)
Q1IHH3 1.54e-30 108 56 1 121 3 rplL Large ribosomal subunit protein bL12 Koribacter versatilis (strain Ellin345)
C0ZIG8 1.68e-30 108 61 1 120 3 rplL Large ribosomal subunit protein bL12 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q92QH8 1.97e-30 108 60 1 121 3 rplL Large ribosomal subunit protein bL12 Rhizobium meliloti (strain 1021)
A6GYU1 2.55e-30 108 56 1 117 3 rplL Large ribosomal subunit protein bL12 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
P0A469 2.59e-30 108 59 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella suis biovar 1 (strain 1330)
B0CH42 2.59e-30 108 59 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella suis (strain ATCC 23445 / NCTC 10510)
P0A468 2.59e-30 108 59 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJL2 2.59e-30 108 59 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5R1 2.59e-30 108 59 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
P0A470 2.59e-30 108 59 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella abortus biovar 1 (strain 9-941)
Q2YM14 2.59e-30 108 59 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella abortus (strain 2308)
B2S688 2.59e-30 108 59 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella abortus (strain S19)
Q5HVZ0 3e-30 107 58 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni (strain RM1221)
Q134R7 3.09e-30 107 61 1 119 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain BisB5)
B6JER8 3.17e-30 107 61 1 121 3 rplL Large ribosomal subunit protein bL12 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q9PI32 3.27e-30 107 55 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1VYJ3 3.35e-30 107 55 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FKR2 3.35e-30 107 55 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q7W0S0 3.47e-30 107 61 1 127 3 rplL Large ribosomal subunit protein bL12 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2H0 3.47e-30 107 61 1 127 3 rplL Large ribosomal subunit protein bL12 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRE0 3.47e-30 107 61 1 127 3 rplL Large ribosomal subunit protein bL12 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A4XZ98 4.11e-30 107 59 1 123 3 rplL Large ribosomal subunit protein bL12 Pseudomonas mendocina (strain ymp)
Q2K9M5 4.45e-30 107 59 1 122 3 rplL Large ribosomal subunit protein bL12 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PW58 4.45e-30 107 59 1 122 3 rplL Large ribosomal subunit protein bL12 Rhizobium etli (strain CIAT 652)
A6LE82 4.74e-30 107 58 1 112 3 rplL Large ribosomal subunit protein bL12 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
P07472 5.33e-30 107 60 1 123 1 rplL Large ribosomal subunit protein bL12 Halophilic eubacterium NRCC 41227
C0Q9Y0 5.42e-30 107 55 1 125 3 rplL Large ribosomal subunit protein bL12 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q8KG16 5.88e-30 107 57 1 121 3 rplL Large ribosomal subunit protein bL12 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q3ZXY0 5.88e-30 107 56 1 123 3 rplL Large ribosomal subunit protein bL12 Dehalococcoides mccartyi (strain CBDB1)
A0L5W5 6.71e-30 107 60 1 123 3 rplL Large ribosomal subunit protein bL12 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q2L2M6 9.09e-30 106 61 1 126 3 rplL Large ribosomal subunit protein bL12 Bordetella avium (strain 197N)
A4G9U6 9.89e-30 106 61 1 124 3 rplL Large ribosomal subunit protein bL12 Herminiimonas arsenicoxydans
A1VAJ7 1.09e-29 106 60 1 127 3 rplL Large ribosomal subunit protein bL12 Nitratidesulfovibrio vulgaris (strain DP4)
Q727C8 1.09e-29 106 60 1 127 3 rplL Large ribosomal subunit protein bL12 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A7H4Q6 1.1e-29 106 54 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q11HB2 1.15e-29 106 60 1 120 3 rplL Large ribosomal subunit protein bL12 Chelativorans sp. (strain BNC1)
A6KYK4 1.17e-29 106 55 2 120 3 rplL Large ribosomal subunit protein bL12 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q8XHR7 1.36e-29 106 61 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium perfringens (strain 13 / Type A)
A8F4F9 1.37e-29 106 58 2 126 3 rplL Large ribosomal subunit protein bL12 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q8A468 1.51e-29 106 55 2 120 3 rplL Large ribosomal subunit protein bL12 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A6W3A0 1.62e-29 105 65 1 123 3 rplL Large ribosomal subunit protein bL12 Marinomonas sp. (strain MWYL1)
Q03ZH3 1.64e-29 105 53 0 121 3 rplL Large ribosomal subunit protein bL12 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q211D7 1.7e-29 105 59 1 119 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain BisB18)
Q1QN45 1.74e-29 105 60 1 120 3 rplL Large ribosomal subunit protein bL12 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q4ZMN6 1.75e-29 105 61 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas syringae pv. syringae (strain B728a)
Q48D28 1.75e-29 105 61 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1TVT1 2.02e-29 105 57 1 126 3 rplL Large ribosomal subunit protein bL12 Paracidovorax citrulli (strain AAC00-1)
B1L936 2.02e-29 105 56 2 128 3 rplL Large ribosomal subunit protein bL12 Thermotoga sp. (strain RQ2)
A5IJW4 2.02e-29 105 56 2 128 3 rplL Large ribosomal subunit protein bL12 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q07KK6 2.11e-29 105 59 1 119 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain BisA53)
B4SG12 2.17e-29 105 52 2 126 3 rplL Large ribosomal subunit protein bL12 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A6T3L4 2.17e-29 105 60 1 124 3 rplL Large ribosomal subunit protein bL12 Janthinobacterium sp. (strain Marseille)
Q63Q02 2.32e-29 105 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain K96243)
A3NEI8 2.32e-29 105 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain 668)
Q3JMQ2 2.32e-29 105 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain 1710b)
A3P0C6 2.32e-29 105 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain 1106a)
A1V8B3 2.32e-29 105 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain SAVP1)
Q62GJ6 2.32e-29 105 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain ATCC 23344)
A2S7G5 2.32e-29 105 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain NCTC 10229)
A3MRU4 2.32e-29 105 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain NCTC 10247)
A9H3S4 2.9e-29 105 58 1 120 3 rplL Large ribosomal subunit protein bL12 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q89J73 3.53e-29 105 57 1 121 3 rplL Large ribosomal subunit protein bL12 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5FTX6 5.06e-29 104 59 1 120 3 rplL Large ribosomal subunit protein bL12 Gluconobacter oxydans (strain 621H)
A5ELN8 5.4e-29 104 58 1 121 3 rplL Large ribosomal subunit protein bL12 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q64NJ6 5.48e-29 104 55 2 120 3 rplL Large ribosomal subunit protein bL12 Bacteroides fragilis (strain YCH46)
Q5L896 5.48e-29 104 55 2 120 3 rplL Large ribosomal subunit protein bL12 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B9MH48 6.13e-29 104 56 1 126 3 rplL Large ribosomal subunit protein bL12 Acidovorax ebreus (strain TPSY)
A1BD22 6.86e-29 104 51 2 127 3 rplL Large ribosomal subunit protein bL12 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B2S093 7.03e-29 104 55 1 122 3 rplL Large ribosomal subunit protein bL12 Borrelia hermsii (strain HS1 / DAH)
Q9KGE3 7.06e-29 104 57 1 121 3 rplL Large ribosomal subunit protein bL12 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B3QC01 7.33e-29 104 57 1 121 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain TIE-1)
Q6N4R8 7.33e-29 104 57 1 121 1 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2IXS1 7.47e-29 104 60 1 119 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain HaA2)
P51339 7.52e-29 104 51 2 129 3 rpl12 Large ribosomal subunit protein bL12c Porphyra purpurea
Q3B1H6 9.4e-29 103 53 2 125 3 rplL Large ribosomal subunit protein bL12 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A7IKP9 9.56e-29 103 61 1 119 3 rplL Large ribosomal subunit protein bL12 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q889X9 9.9e-29 103 60 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A1WCN0 1.03e-28 103 56 1 126 3 rplL Large ribosomal subunit protein bL12 Acidovorax sp. (strain JS42)
A5VC06 1.42e-28 103 58 1 122 3 rplL Large ribosomal subunit protein bL12 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A5FZX2 1.46e-28 103 54 1 119 3 rplL Large ribosomal subunit protein bL12 Acidiphilium cryptum (strain JF-5)
Q98N67 1.57e-28 103 57 1 120 3 rplL Large ribosomal subunit protein bL12 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A9BR97 1.57e-28 103 56 1 125 3 rplL Large ribosomal subunit protein bL12 Delftia acidovorans (strain DSM 14801 / SPH-1)
A9IJ27 1.65e-28 103 61 1 126 3 rplL Large ribosomal subunit protein bL12 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B9E8Q7 1.69e-28 103 57 1 121 3 rplL Large ribosomal subunit protein bL12 Macrococcus caseolyticus (strain JCSC5402)
Q3SSY1 1.7e-28 103 57 1 121 3 rplL Large ribosomal subunit protein bL12 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q9TL30 1.85e-28 103 49 2 128 3 rpl12 Large ribosomal subunit protein bL12c Nephroselmis olivacea
Q8CTT1 1.9e-28 103 52 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRL2 1.9e-28 103 52 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A4YSI0 1.98e-28 103 57 1 121 3 rplL Large ribosomal subunit protein bL12 Bradyrhizobium sp. (strain ORS 278)
A8EVZ5 2.48e-28 103 52 1 123 3 rplL Large ribosomal subunit protein bL12 Aliarcobacter butzleri (strain RM4018)
B0UHX7 2.58e-28 103 59 1 121 3 rplL Large ribosomal subunit protein bL12 Methylobacterium sp. (strain 4-46)
Q5N3N6 2.7e-28 103 53 2 128 3 rplL Large ribosomal subunit protein bL12 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31QK6 2.7e-28 103 53 2 128 3 rplL Large ribosomal subunit protein bL12 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A7HWQ3 2.77e-28 102 59 1 118 3 rplL Large ribosomal subunit protein bL12 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q49V50 2.81e-28 102 53 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B3QQS3 2.82e-28 102 55 1 121 3 rplL Large ribosomal subunit protein bL12 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A5N4N8 2.89e-28 102 58 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYA0 2.89e-28 102 58 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium kluyveri (strain NBRC 12016)
Q3A9Q5 3.31e-28 102 58 1 123 3 rplL Large ribosomal subunit protein bL12 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9ZE21 3.52e-28 102 52 2 120 3 rplL Large ribosomal subunit protein bL12 Rickettsia prowazekii (strain Madrid E)
B2IK54 3.74e-28 102 58 1 121 3 rplL Large ribosomal subunit protein bL12 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q1H4P5 3.83e-28 102 59 1 128 3 rplL Large ribosomal subunit protein bL12 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q0BUQ8 3.84e-28 102 57 1 120 3 rplL Large ribosomal subunit protein bL12 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B5RRJ8 4.32e-28 102 56 1 123 3 rplL Large ribosomal subunit protein bL12 Borrelia recurrentis (strain A1)
B5RLV0 4.32e-28 102 56 1 123 3 rplL Large ribosomal subunit protein bL12 Borrelia duttonii (strain Ly)
Q2LQ88 4.59e-28 102 55 1 126 3 rplL Large ribosomal subunit protein bL12 Syntrophus aciditrophicus (strain SB)
B9JVM7 5.18e-28 102 62 1 119 3 rplL Large ribosomal subunit protein bL12 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q01VB0 5.31e-28 102 56 1 120 3 rplL Large ribosomal subunit protein bL12 Solibacter usitatus (strain Ellin6076)
Q160X6 5.5e-28 102 56 3 110 3 rplL Large ribosomal subunit protein bL12 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8YLJ5 5.68e-28 102 50 2 130 3 rplL Large ribosomal subunit protein bL12 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q5WLS2 5.82e-28 102 57 1 120 3 rplL Large ribosomal subunit protein bL12 Shouchella clausii (strain KSM-K16)
Q1MIF0 6.21e-28 102 60 1 120 3 rplL Large ribosomal subunit protein bL12 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B1Y7H4 6.37e-28 102 55 1 124 3 rplL Large ribosomal subunit protein bL12 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B2JA77 6.55e-28 102 49 2 130 3 rplL Large ribosomal subunit protein bL12 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A9GRA8 7.37e-28 102 52 1 125 3 rplL Large ribosomal subunit protein bL12 Sorangium cellulosum (strain So ce56)
B9JDS0 8.42e-28 101 60 1 120 3 rplL Large ribosomal subunit protein bL12 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B7KIR5 9.44e-28 101 58 2 110 3 rplL Large ribosomal subunit protein bL12 Gloeothece citriformis (strain PCC 7424)
B7J1W2 9.65e-28 101 54 1 124 3 rplL Large ribosomal subunit protein bL12 Borreliella burgdorferi (strain ZS7)
O51351 9.65e-28 101 54 1 124 3 rplL Large ribosomal subunit protein bL12 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
B3EL60 1.01e-27 101 53 1 122 3 rplL Large ribosomal subunit protein bL12 Chlorobium phaeobacteroides (strain BS1)
Q250P5 1.03e-27 101 60 2 125 3 rplL Large ribosomal subunit protein bL12 Desulfitobacterium hafniense (strain Y51)
B8G1V3 1.03e-27 101 60 2 125 3 rplL Large ribosomal subunit protein bL12 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B5ZYS6 1.08e-27 101 60 1 120 3 rplL Large ribosomal subunit protein bL12 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B1X073 1.09e-27 101 50 2 133 3 rplL Large ribosomal subunit protein bL12 Crocosphaera subtropica (strain ATCC 51142 / BH68)
A0PXT7 1.15e-27 101 55 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium novyi (strain NT)
B8IS76 1.25e-27 101 58 1 121 3 rplL Large ribosomal subunit protein bL12 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A8F973 1.27e-27 101 56 0 121 3 rplL Large ribosomal subunit protein bL12 Bacillus pumilus (strain SAFR-032)
C5CKF2 1.29e-27 101 57 1 125 3 rplL Large ribosomal subunit protein bL12 Variovorax paradoxus (strain S110)
Q2RQV2 1.43e-27 100 60 1 118 3 rplL Large ribosomal subunit protein bL12 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B7JWT5 1.53e-27 101 46 2 132 3 rplL Large ribosomal subunit protein bL12 Rippkaea orientalis (strain PCC 8801 / RF-1)
Q9RST0 1.54e-27 100 50 2 123 1 rplL Large ribosomal subunit protein bL12 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
C3MAX1 1.6e-27 100 59 1 122 3 rplL Large ribosomal subunit protein bL12 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P14134 1.62e-27 100 59 1 122 1 rplL Large ribosomal subunit protein bL12 Halanaerobium praevalens
B9LI32 1.67e-27 101 53 2 128 3 rplL Large ribosomal subunit protein bL12 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WFP9 1.67e-27 101 53 2 128 3 rplL Large ribosomal subunit protein bL12 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A5GPD2 1.71e-27 101 53 2 130 3 rplL Large ribosomal subunit protein bL12 Synechococcus sp. (strain WH7803)
A1WK54 1.72e-27 100 54 1 124 3 rplL Large ribosomal subunit protein bL12 Verminephrobacter eiseniae (strain EF01-2)
B3ETZ1 2.18e-27 100 52 1 114 3 rplL Large ribosomal subunit protein bL12 Amoebophilus asiaticus (strain 5a2)
B0S065 2.85e-27 100 58 2 125 3 rplL Large ribosomal subunit protein bL12 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A5FQQ9 2.85e-27 100 56 1 123 3 rplL Large ribosomal subunit protein bL12 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A6TWJ1 3.88e-27 99 57 1 120 3 rplL Large ribosomal subunit protein bL12 Alkaliphilus metalliredigens (strain QYMF)
B8EMS0 3.9e-27 100 58 1 122 3 rplL Large ribosomal subunit protein bL12 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
P23349 4.26e-27 100 55 2 128 1 rplL Large ribosomal subunit protein bL12 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8UE07 5.03e-27 99 60 1 120 1 rplL Large ribosomal subunit protein bL12 Agrobacterium fabrum (strain C58 / ATCC 33970)
A4SGK7 5.25e-27 99 52 2 125 3 rplL Large ribosomal subunit protein bL12 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q3ATP6 5.4e-27 99 50 2 126 3 rplL Large ribosomal subunit protein bL12 Chlorobium chlorochromatii (strain CaD3)
Q6G3X6 5.92e-27 99 60 1 118 3 rplL Large ribosomal subunit protein bL12 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q97EG8 6.53e-27 99 56 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B1I1M6 6.65e-27 99 53 1 121 3 rplL Large ribosomal subunit protein bL12 Desulforudis audaxviator (strain MP104C)
A1USC7 6.82e-27 99 59 1 118 3 rplL Large ribosomal subunit protein bL12 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q21SF6 6.97e-27 99 58 1 123 3 rplL Large ribosomal subunit protein bL12 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q3Z7T6 7.09e-27 99 54 1 124 3 rplL Large ribosomal subunit protein bL12 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q0BJ55 7.32e-27 99 60 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRC1 7.32e-27 99 60 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia ambifaria (strain MC40-6)
B1ZGR9 8e-27 99 57 1 121 3 rplL Large ribosomal subunit protein bL12 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A6QEJ2 1.08e-26 99 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain Newman)
A5D5H9 1.17e-26 99 58 1 125 3 rplL Large ribosomal subunit protein bL12 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
C1D0S3 1.38e-26 98 50 2 122 3 rplL Large ribosomal subunit protein bL12 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B4UDT3 1.39e-26 98 57 1 119 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter sp. (strain K)
B8JB71 1.39e-26 98 57 1 119 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B2S2I7 1.43e-26 98 51 4 126 3 rplL Large ribosomal subunit protein bL12 Treponema pallidum subsp. pallidum (strain SS14)
O83268 1.43e-26 98 51 4 126 3 rplL Large ribosomal subunit protein bL12 Treponema pallidum (strain Nichols)
Q4K525 1.49e-26 98 57 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6FZL8 1.65e-26 98 58 1 118 3 rplL Large ribosomal subunit protein bL12 Bartonella quintana (strain Toulouse)
Q2SU18 1.69e-26 98 60 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P66062 2.01e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain MW2)
A8YZN8 2.01e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBU7 2.01e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain MSSA476)
P99154 2.01e-26 98 55 1 120 1 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain N315)
P66061 2.01e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HID5 2.01e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain COL)
A5IQ94 2.01e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain JH9)
P48860 2.01e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJA0 2.01e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain USA300)
A6TZ17 2.01e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain JH1)
A7WYW4 2.01e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q03E51 2.11e-26 98 52 0 121 3 rplL Large ribosomal subunit protein bL12 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B1MVU1 2.23e-26 97 52 0 121 3 rplL Large ribosomal subunit protein bL12 Leuconostoc citreum (strain KM20)
B6IRP5 3.09e-26 97 56 1 122 3 rplL Large ribosomal subunit protein bL12 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q1J0P3 3.25e-26 97 51 2 123 3 rplL Large ribosomal subunit protein bL12 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A7GJ83 3.29e-26 97 58 1 122 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5FIJ2 3.65e-26 97 53 1 118 3 rplL Large ribosomal subunit protein bL12 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B8DF04 4e-26 97 58 1 121 3 rplL Large ribosomal subunit protein bL12 Listeria monocytogenes serotype 4a (strain HCC23)
Q92F24 4e-26 97 58 1 121 3 rplL Large ribosomal subunit protein bL12 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A4J102 4.05e-26 97 57 1 119 3 rplL Large ribosomal subunit protein bL12 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q65PB7 4.07e-26 97 55 1 123 3 rplL Large ribosomal subunit protein bL12 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3MA16 4.88e-26 97 52 2 128 3 rplL Large ribosomal subunit protein bL12 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q1GSF9 5.12e-26 97 58 1 120 3 rplL Large ribosomal subunit protein bL12 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B1KSN4 5.25e-26 97 58 1 122 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Loch Maree / Type A3)
C3KVR0 5.25e-26 97 58 1 122 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain 657 / Type Ba4)
B8G988 5.27e-26 97 53 1 128 3 rplL Large ribosomal subunit protein bL12 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q98QS2 5.37e-26 97 46 0 118 3 rplL Large ribosomal subunit protein bL12 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q6GJC8 5.73e-26 97 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain MRSA252)
Q1D7U4 5.99e-26 97 54 1 116 3 rplL Large ribosomal subunit protein bL12 Myxococcus xanthus (strain DK1622)
Q8YAA3 6.11e-26 96 57 1 121 3 rplL Large ribosomal subunit protein bL12 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17570
Feature type CDS
Gene rplL
Product 50S ribosomal protein L7/L12
Location 4124 - 4489 (strand: 1)
Length 366 (nucleotides) / 121 (amino acids)
In genomic island -

Contig

Accession contig_29
Length 39360 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2323
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00542 Ribosomal protein L7/L12 C-terminal domain
PF16320 Ribosomal protein L7/L12 dimerisation domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0222 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L7/L12

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02935 large subunit ribosomal protein L7/L12 Ribosome -

Protein Sequence

MSITKEQILDAVAEMSVMDVVELITMMEEKFGVSAAAAVAVAAGPAEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDEAETLKKSLEEAGAEVEVK

Flanking regions ( +/- flanking 50bp)

TCGTTGCTTTTTAACGTATAAACTTATTCTGAATTTTAGGAACATATCGTATGTCTATCACTAAAGAACAAATCCTGGACGCAGTTGCTGAAATGTCTGTAATGGACGTTGTTGAACTGATCACCATGATGGAAGAAAAATTCGGCGTTTCTGCTGCTGCTGCTGTAGCAGTTGCTGCGGGTCCTGCTGAAGCTGCTGAAGAGAAAACTGAGTTCGACGTTATTCTGAAAGCTGCCGGCGCTAACAAAGTTGCAGTAATCAAAGCTGTTCGCGGCGCAACTGGTCTGGGCCTGAAAGAAGCTAAAGACTTAGTTGAAAGCGCACCTGCTGCACTGAAAGAAGGTGTGAGCAAAGATGAAGCTGAAACTCTGAAAAAATCTCTGGAAGAAGCTGGCGCGGAAGTTGAAGTTAAATAAGCCACTTTTTGCAGTAGCAGCCTGAAAATGGCTGATGGCTGGTGACTTAT