Homologs in group_2323

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17570 FBDBKF_17570 96.7 Morganella morganii S1 rplL 50S ribosomal protein L7/L12
EHELCC_18055 EHELCC_18055 96.7 Morganella morganii S2 rplL 50S ribosomal protein L7/L12
NLDBIP_18095 NLDBIP_18095 96.7 Morganella morganii S4 rplL 50S ribosomal protein L7/L12
LHKJJB_18290 LHKJJB_18290 96.7 Morganella morganii S3 rplL 50S ribosomal protein L7/L12
HKOGLL_17910 HKOGLL_17910 96.7 Morganella morganii S5 rplL 50S ribosomal protein L7/L12
PMI_RS13760 PMI_RS13760 91.7 Proteus mirabilis HI4320 rplL 50S ribosomal protein L7/L12

Distribution of the homologs in the orthogroup group_2323

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2323

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B7MRB2 2.74e-60 183 89 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O81 (strain ED1a)
P0A7K5 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella flexneri
Q0SY14 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella flexneri serotype 5b (strain 8401)
Q32AF8 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella dysenteriae serotype 1 (strain Sd197)
Q31U11 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella boydii serotype 4 (strain Sb227)
B2TWH2 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUL6 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5V1 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain UTI89 / UPEC)
B1LNT8 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain SMS-3-5 / SECEC)
B6I5J6 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain SE11)
B7NFS6 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7K2 8.84e-55 169 90 0 121 1 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain K12)
B1IUR1 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7K3 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA79 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A785 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O9:H4 (strain HS)
B1XBY8 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain K12 / DH10B)
C5A0S6 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M733 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O8 (strain IAI1)
B7NRR4 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z082 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7K4 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O157:H7
B7LA79 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli (strain 55989 / EAEC)
B7MIX2 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPE1 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUK0 8.84e-55 169 90 0 121 3 rplL Large ribosomal subunit protein bL12 Escherichia coli O139:H28 (strain E24377A / ETEC)
B4EYV0 1.15e-54 169 91 0 121 3 rplL Large ribosomal subunit protein bL12 Proteus mirabilis (strain HI4320)
Q6DAN1 1.46e-54 169 88 0 121 3 rplL Large ribosomal subunit protein bL12 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3YUZ8 1.88e-54 169 89 0 121 3 rplL Large ribosomal subunit protein bL12 Shigella sonnei (strain Ss046)
A8AKU0 4.38e-54 168 88 0 121 3 rplL Large ribosomal subunit protein bL12 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TGN9 5.95e-54 167 87 0 121 3 rplL Large ribosomal subunit protein bL12 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XYF6 5.95e-54 167 87 0 121 3 rplL Large ribosomal subunit protein bL12 Klebsiella pneumoniae (strain 342)
P41188 1.03e-53 167 68 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C3LR59 1.37e-53 166 78 2 123 3 rplL Large ribosomal subunit protein bL12 Vibrio cholerae serotype O1 (strain M66-2)
Q9KV31 1.37e-53 166 78 2 123 3 rplL Large ribosomal subunit protein bL12 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3P4 1.37e-53 166 78 2 123 3 rplL Large ribosomal subunit protein bL12 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C6DHR4 1.5e-53 166 86 0 121 3 rplL Large ribosomal subunit protein bL12 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B8D6V1 6.85e-53 165 66 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57147 6.85e-53 165 66 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8J7 6.85e-53 165 66 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A4W5A6 1.16e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Enterobacter sp. (strain 638)
P0A299 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2A0 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella typhi
B4TQJ4 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella schwarzengrund (strain CVM19633)
B5BJQ2 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi A (strain AKU_12601)
C0Q2R6 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi C (strain RKS4594)
A9N0J3 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK94 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0Y8 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella newport (strain SL254)
B4TCS3 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella heidelberg (strain SL476)
B5RFK2 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYD7 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella enteritidis PT4 (strain P125109)
B5FQJ8 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella dublin (strain CT_02021853)
Q57H70 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella choleraesuis (strain SC-B67)
B5F0W6 2.05e-52 164 89 0 121 3 rplL Large ribosomal subunit protein bL12 Salmonella agona (strain SL483)
Q1LSX8 2.91e-52 163 66 0 121 3 rplL Large ribosomal subunit protein bL12 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q2NWR7 2.94e-52 163 86 1 122 3 rplL Large ribosomal subunit protein bL12 Sodalis glossinidius (strain morsitans)
A0KQA6 6e-51 160 77 0 121 3 rplL Large ribosomal subunit protein bL12 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A7MQP6 1.42e-50 159 84 1 122 3 rplL Large ribosomal subunit protein bL12 Cronobacter sakazakii (strain ATCC BAA-894)
B2VG95 2.49e-50 158 80 0 121 3 rplL Large ribosomal subunit protein bL12 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A9MHF3 4.16e-50 158 83 1 123 3 rplL Large ribosomal subunit protein bL12 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8G8E6 6.4e-50 157 79 0 121 3 rplL Large ribosomal subunit protein bL12 Serratia proteamaculans (strain 568)
Q7N9A5 1.04e-49 157 81 2 123 3 rplL Large ribosomal subunit protein bL12 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1REA6 2.77e-49 155 73 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain W3-18-1)
A4YBZ1 2.77e-49 155 73 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK75 2.77e-49 155 73 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q492B8 4.16e-49 155 63 1 122 3 rplL Large ribosomal subunit protein bL12 Blochmanniella pennsylvanica (strain BPEN)
Q3ILQ0 6.61e-49 155 72 2 122 3 rplL Large ribosomal subunit protein bL12 Pseudoalteromonas translucida (strain TAC 125)
Q089R2 4.39e-48 152 71 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella frigidimarina (strain NCIMB 400)
A8GYW8 5.01e-48 152 71 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q65W43 6.54e-48 152 74 1 122 3 rplL Large ribosomal subunit protein bL12 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q89B19 6.94e-48 152 66 1 122 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P44348 1.86e-47 151 75 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHD2 1.86e-47 151 75 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain PittGG)
A5UE95 1.86e-47 151 75 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain PittEE)
Q4QMS6 1.86e-47 151 75 1 123 3 rplL Large ribosomal subunit protein bL12 Haemophilus influenzae (strain 86-028NP)
A4SHU8 2.46e-47 150 77 1 121 3 rplL Large ribosomal subunit protein bL12 Aeromonas salmonicida (strain A449)
B1JJJ7 3.55e-47 150 75 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FQ3 3.55e-47 150 75 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS30 3.55e-47 150 75 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis (strain Pestoides F)
Q1CN79 3.55e-47 150 75 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAP4 3.55e-47 150 75 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis
B2K111 3.55e-47 150 75 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1U0 3.55e-47 150 75 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNI4 3.55e-47 150 75 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7VKL5 3.92e-46 147 75 1 121 3 rplL Large ribosomal subunit protein bL12 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0TM20 6.34e-46 147 72 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella halifaxensis (strain HAW-EB4)
A9R0H7 7.92e-46 147 67 1 128 3 rplL Large ribosomal subunit protein bL12 Yersinia pestis bv. Antiqua (strain Angola)
A1JIH9 8.32e-46 147 74 0 120 3 rplL Large ribosomal subunit protein bL12 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B0BSE8 1.71e-45 146 74 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYU7 1.71e-45 146 74 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N319 1.71e-45 146 74 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B6ENR4 4.5e-45 145 78 0 121 3 rplL Large ribosomal subunit protein bL12 Aliivibrio salmonicida (strain LFI1238)
C4LBV3 4.97e-45 145 75 0 121 3 rplL Large ribosomal subunit protein bL12 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A6VKC6 5.35e-45 145 71 1 122 3 rplL Large ribosomal subunit protein bL12 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B7VM70 5.61e-45 145 78 0 121 3 rplL Large ribosomal subunit protein bL12 Vibrio atlanticus (strain LGP32)
Q7VRP6 6.12e-45 145 59 2 126 3 rplL Large ribosomal subunit protein bL12 Blochmanniella floridana
Q5NID3 2.52e-44 143 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JT6 2.52e-44 143 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. tularensis (strain FSC 198)
B8F6N0 1.43e-43 141 73 1 122 3 rplL Large ribosomal subunit protein bL12 Glaesserella parasuis serovar 5 (strain SH0165)
B5FC89 1.84e-43 141 74 1 122 3 rplL Large ribosomal subunit protein bL12 Aliivibrio fischeri (strain MJ11)
Q5E236 1.84e-43 141 74 1 122 3 rplL Large ribosomal subunit protein bL12 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B0UUZ7 2.53e-43 140 69 1 122 3 rplL Large ribosomal subunit protein bL12 Histophilus somni (strain 2336)
Q0I0U9 2.53e-43 140 69 1 122 3 rplL Large ribosomal subunit protein bL12 Histophilus somni (strain 129Pt)
A1T066 3.15e-43 140 75 0 121 3 rplL Large ribosomal subunit protein bL12 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7MGR7 4.41e-43 140 74 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio vulnificus (strain YJ016)
Q8DD21 4.41e-43 140 74 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio vulnificus (strain CMCP6)
B0TX09 1.01e-42 139 75 1 124 3 rplL Large ribosomal subunit protein bL12 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A9KW94 1.34e-42 139 71 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella baltica (strain OS195)
A6WHS0 1.34e-42 139 71 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella baltica (strain OS185)
Q9CK90 1.83e-42 138 72 1 122 3 rplL Large ribosomal subunit protein bL12 Pasteurella multocida (strain Pm70)
A3Q974 2.23e-42 138 72 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q4FQH2 3.37e-42 138 69 1 123 3 rplL Large ribosomal subunit protein bL12 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A7MXF2 3.94e-42 137 71 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio campbellii (strain ATCC BAA-1116)
Q6LLW1 7.8e-42 137 75 0 121 3 rplL Large ribosomal subunit protein bL12 Photobacterium profundum (strain SS9)
B8EBL3 8.69e-42 137 70 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella baltica (strain OS223)
B8CNC4 1.01e-41 137 70 0 121 3 rplL Large ribosomal subunit protein bL12 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q1Q8P8 1.38e-41 136 69 1 123 3 rplL Large ribosomal subunit protein bL12 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q87KQ3 2.73e-41 135 75 1 122 3 rplL Large ribosomal subunit protein bL12 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q12SW7 4.01e-41 135 72 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B1KMZ1 9.62e-41 134 68 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella woodyi (strain ATCC 51908 / MS32)
C4K4F2 1.31e-40 134 67 1 124 3 rplL Large ribosomal subunit protein bL12 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q15YB2 1.68e-40 134 69 1 123 3 rplL Large ribosomal subunit protein bL12 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5QWA6 1.93e-40 133 71 1 124 3 rplL Large ribosomal subunit protein bL12 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3J8Q6 4.65e-40 132 64 1 126 3 rplL Large ribosomal subunit protein bL12 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0HNU5 5.84e-40 132 70 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain MR-4)
Q5WZM0 1.22e-39 131 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila (strain Lens)
Q5ZYQ1 1.22e-39 131 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHS2 1.22e-39 131 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila (strain Corby)
Q5X867 1.22e-39 131 62 1 126 3 rplL Large ribosomal subunit protein bL12 Legionella pneumophila (strain Paris)
A8ZV50 1.58e-39 131 61 1 126 3 rplL Large ribosomal subunit protein bL12 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q2S904 2e-39 131 68 1 124 3 rplL Large ribosomal subunit protein bL12 Hahella chejuensis (strain KCTC 2396)
Q058E4 2.15e-39 130 52 1 121 3 rplL Large ribosomal subunit protein bL12 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A5WH36 4.07e-39 130 67 1 125 3 rplL Large ribosomal subunit protein bL12 Psychrobacter sp. (strain PRwf-1)
Q31IZ0 4.14e-39 130 67 1 123 3 rplL Large ribosomal subunit protein bL12 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A8G1F6 5.05e-39 130 66 1 122 3 rplL Large ribosomal subunit protein bL12 Shewanella sediminis (strain HAW-EB3)
Q0I0B3 5.74e-39 130 69 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain MR-7)
A0KRL6 5.74e-39 130 69 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella sp. (strain ANA-3)
A5CW26 7.28e-39 129 59 1 121 3 rplL Large ribosomal subunit protein bL12 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A4IW98 4.46e-38 127 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BKC3 4.46e-38 127 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q868 4.46e-38 127 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. novicida (strain U112)
Q2A1M6 4.46e-38 127 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. holarctica (strain LVS)
A7NEC1 4.46e-38 127 73 1 125 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B2SFD5 6.52e-38 127 68 1 126 3 rplL Large ribosomal subunit protein bL12 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q0VSM3 7.14e-38 127 64 1 125 3 rplL Large ribosomal subunit protein bL12 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q0ABI3 1.01e-37 127 63 1 125 3 rplL Large ribosomal subunit protein bL12 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q8D234 1.63e-37 126 53 2 123 3 rplL Large ribosomal subunit protein bL12 Wigglesworthia glossinidia brevipalpis
Q21M94 2.4e-37 125 68 1 126 3 rplL Large ribosomal subunit protein bL12 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A5EX71 3.92e-37 125 63 1 122 3 rplL Large ribosomal subunit protein bL12 Dichelobacter nodosus (strain VCS1703A)
Q47UV8 5.8e-37 124 73 2 121 3 rplL Large ribosomal subunit protein bL12 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1AX76 1.65e-36 124 59 1 122 3 rplL Large ribosomal subunit protein bL12 Ruthia magnifica subsp. Calyptogena magnifica
Q7VJ81 5.77e-36 122 57 1 126 3 rplL Large ribosomal subunit protein bL12 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B8GV66 9.26e-36 122 58 1 125 3 rplL Large ribosomal subunit protein bL12 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1TYI9 1.29e-35 121 64 1 124 3 rplL Large ribosomal subunit protein bL12 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
C1DKK4 1.48e-35 121 63 1 122 3 rplL Large ribosomal subunit protein bL12 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1WVD0 1.73e-35 121 59 1 128 3 rplL Large ribosomal subunit protein bL12 Halorhodospira halophila (strain DSM 244 / SL1)
A1S210 2.18e-35 120 69 1 123 3 rplL Large ribosomal subunit protein bL12 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A1KB35 2.37e-35 120 60 1 125 3 rplL Large ribosomal subunit protein bL12 Azoarcus sp. (strain BH72)
Q0SNB7 2.38e-35 120 57 1 124 3 rplL Large ribosomal subunit protein bL12 Borreliella afzelii (strain PKo)
Q82T74 3.84e-35 120 60 1 124 3 rplL Large ribosomal subunit protein bL12 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q60A07 3.96e-35 120 63 1 125 3 rplL Large ribosomal subunit protein bL12 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P0A467 4.47e-35 120 59 1 126 3 rplL Large ribosomal subunit protein bL12 Aquifex pyrophilus
P0A466 4.47e-35 120 59 1 126 3 rplL Large ribosomal subunit protein bL12 Aquifex aeolicus (strain VF5)
B3PK29 4.98e-35 120 69 1 122 3 rplL Large ribosomal subunit protein bL12 Cellvibrio japonicus (strain Ueda107)
B5Z8J6 6.06e-35 119 55 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain G27)
B6JN38 6.06e-35 119 55 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain P12)
B2UUW1 6.26e-35 119 55 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain Shi470)
P56875 6.26e-35 119 55 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain J99 / ATCC 700824)
Q1CS67 6.26e-35 119 55 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain HPAG1)
B2V7M1 7.31e-35 119 60 1 126 3 rplL Large ribosomal subunit protein bL12 Sulfurihydrogenibium sp. (strain YO3AOP1)
P02393 9.12e-35 119 58 1 125 1 rplL Large ribosomal subunit protein bL12 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B5YEX7 9.59e-35 119 56 1 125 3 rplL Large ribosomal subunit protein bL12 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B0K5G7 1.23e-34 119 61 1 125 3 rplL Large ribosomal subunit protein bL12 Thermoanaerobacter sp. (strain X514)
B0KCJ1 1.5e-34 119 61 1 125 3 rplL Large ribosomal subunit protein bL12 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
C5BQ38 1.51e-34 119 65 1 126 3 rplL Large ribosomal subunit protein bL12 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A7ZCN6 1.77e-34 118 54 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter concisus (strain 13826)
P55834 2.59e-34 118 54 1 125 1 rplL Large ribosomal subunit protein bL12 Helicobacter pylori (strain ATCC 700392 / 26695)
Q18CE7 3e-34 117 58 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridioides difficile (strain 630)
Q3SLQ7 3.03e-34 118 61 1 127 3 rplL Large ribosomal subunit protein bL12 Thiobacillus denitrificans (strain ATCC 25259)
A1ALT3 3.38e-34 118 62 1 124 3 rplL Large ribosomal subunit protein bL12 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
P0A0W9 3.52e-34 117 59 1 122 3 rplL Large ribosomal subunit protein bL12 Neisseria sicca
P0A0W8 3.52e-34 117 59 1 122 3 rplL Large ribosomal subunit protein bL12 Neisseria lactamica
Q17VN5 3.52e-34 117 53 1 125 3 rplL Large ribosomal subunit protein bL12 Helicobacter acinonychis (strain Sheeba)
Q1LI19 3.57e-34 117 62 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8PC57 3.77e-34 117 66 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU90 3.77e-34 117 66 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas campestris pv. campestris (strain B100)
Q4URD1 3.77e-34 117 66 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas campestris pv. campestris (strain 8004)
Q5P340 3.98e-34 117 61 1 124 3 rplL Large ribosomal subunit protein bL12 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
C1DAQ9 4.04e-34 117 59 1 123 3 rplL Large ribosomal subunit protein bL12 Laribacter hongkongensis (strain HLHK9)
Q8PNT1 4.25e-34 117 64 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas axonopodis pv. citri (strain 306)
B4U736 5.53e-34 117 60 1 125 3 rplL Large ribosomal subunit protein bL12 Hydrogenobaculum sp. (strain Y04AAS1)
Q3BWZ2 6.23e-34 117 64 2 122 3 rplL Large ribosomal subunit protein bL12 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A8MLD1 6.23e-34 117 57 2 122 3 rplL Large ribosomal subunit protein bL12 Alkaliphilus oremlandii (strain OhILAs)
A6LKB9 1.09e-33 116 58 2 125 3 rplL Large ribosomal subunit protein bL12 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B1GZ74 1.24e-33 116 54 1 122 3 rplL Large ribosomal subunit protein bL12 Endomicrobium trichonymphae
C0QQL5 1.38e-33 116 60 1 125 3 rplL Large ribosomal subunit protein bL12 Persephonella marina (strain DSM 14350 / EX-H1)
B5EFP2 1.39e-33 116 61 1 126 3 rplL Large ribosomal subunit protein bL12 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q6AP79 1.91e-33 115 63 1 123 3 rplL Large ribosomal subunit protein bL12 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q1MPU3 2.51e-33 115 58 1 128 3 rplL Large ribosomal subunit protein bL12 Lawsonia intracellularis (strain PHE/MN1-00)
B9KFG6 3.38e-33 115 56 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A0RQI6 5.48e-33 114 54 1 124 3 rplL Large ribosomal subunit protein bL12 Campylobacter fetus subsp. fetus (strain 82-40)
Q9F5M1 6e-33 114 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria perflava
A1QZH8 6.13e-33 114 57 2 123 3 rplL Large ribosomal subunit protein bL12 Borrelia turicatae (strain 91E135)
B9L7J5 7.28e-33 114 54 1 124 3 rplL Large ribosomal subunit protein bL12 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
E6MUA0 8.61e-33 114 60 1 123 1 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)
A1KRG5 8.61e-33 114 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0X1 8.61e-33 114 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0X0 8.61e-33 114 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3X5 8.61e-33 114 60 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria meningitidis serogroup C (strain 053442)
C5CGE0 1.1e-32 114 57 2 128 3 rplL Large ribosomal subunit protein bL12 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q8R7U5 1.22e-32 114 59 1 125 3 rplL Large ribosomal subunit protein bL12 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q11QA4 1.36e-32 114 54 2 119 3 rplL Large ribosomal subunit protein bL12 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q7MA57 1.4e-32 114 57 1 124 3 rplL Large ribosomal subunit protein bL12 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q5GWS5 1.83e-32 113 65 2 123 3 rplL Large ribosomal subunit protein bL12 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQQ0 1.83e-32 113 65 2 123 3 rplL Large ribosomal subunit protein bL12 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZX7 1.83e-32 113 65 2 123 3 rplL Large ribosomal subunit protein bL12 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A7GZK0 2.18e-32 113 53 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter curvus (strain 525.92)
Q3A6Q5 2.29e-32 113 60 1 125 3 rplL Large ribosomal subunit protein bL12 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
P02395 2.39e-32 113 58 1 119 1 rplL Large ribosomal subunit protein bL12 Micrococcus luteus
B5ELX1 3.27e-32 113 57 1 128 3 rplL Large ribosomal subunit protein bL12 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J458 3.27e-32 113 57 1 128 3 rplL Large ribosomal subunit protein bL12 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B8E0K0 3.31e-32 112 55 1 125 3 rplL Large ribosomal subunit protein bL12 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q2YB06 3.37e-32 112 59 1 126 3 rplL Large ribosomal subunit protein bL12 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B6YPZ8 3.39e-32 112 47 1 116 3 rplL Large ribosomal subunit protein bL12 Azobacteroides pseudotrichonymphae genomovar. CFP2
B3EER1 3.69e-32 112 52 2 127 3 rplL Large ribosomal subunit protein bL12 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q3K5Y0 5.86e-32 112 58 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas fluorescens (strain Pf0-1)
A7I3U0 6.12e-32 112 54 1 124 3 rplL Large ribosomal subunit protein bL12 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B1JDX2 6.4e-32 112 58 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain W619)
P0A158 6.4e-32 112 58 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida
P0A157 6.4e-32 112 58 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK59 6.4e-32 112 58 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain GB-1)
A5VXN9 6.4e-32 112 58 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q39Y14 7.61e-32 112 59 1 124 3 rplL Large ribosomal subunit protein bL12 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q30X07 7.69e-32 112 58 1 124 3 rplL Large ribosomal subunit protein bL12 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B1HMZ8 8.28e-32 111 62 0 119 3 rplL Large ribosomal subunit protein bL12 Lysinibacillus sphaericus (strain C3-41)
Q1XDE8 8.42e-32 112 51 3 129 3 rpl12 Large ribosomal subunit protein bL12c Neopyropia yezoensis
Q7NQE5 8.81e-32 111 60 1 123 3 rplL Large ribosomal subunit protein bL12 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B4RQW1 9e-32 111 59 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5R4 9e-32 111 59 1 123 3 rplL Large ribosomal subunit protein bL12 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1IFX4 1.3e-31 111 59 1 122 3 rplL Large ribosomal subunit protein bL12 Pseudomonas entomophila (strain L48)
A6Q1M2 1.76e-31 111 50 1 127 3 rplL Large ribosomal subunit protein bL12 Nitratiruptor sp. (strain SB155-2)
Q748Y5 2.29e-31 110 59 1 124 3 rplL Large ribosomal subunit protein bL12 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q46WD3 2.61e-31 110 62 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
C3K2Y4 2.62e-31 110 64 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas fluorescens (strain SBW25)
P0C8S3 2.65e-31 110 61 1 122 1 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAL3 2.65e-31 110 61 1 122 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD40 2.65e-31 110 61 1 122 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain Dugway 5J108-111)
B6J272 2.65e-31 110 61 1 122 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain CbuG_Q212)
B6J5C1 2.65e-31 110 61 1 122 3 rplL Large ribosomal subunit protein bL12 Coxiella burnetii (strain CbuK_Q154)
B8J1A7 3.45e-31 110 54 1 128 3 rplL Large ribosomal subunit protein bL12 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B9M6V3 4.38e-31 110 60 1 123 3 rplL Large ribosomal subunit protein bL12 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q2W2I0 4.98e-31 109 60 1 119 3 rplL Large ribosomal subunit protein bL12 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
O78414 7.71e-31 109 52 2 125 3 rpl12 Large ribosomal subunit protein bL12c Guillardia theta
Q6FF91 1.21e-30 108 64 0 121 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0TC46 1.44e-30 108 61 1 120 3 rplL Large ribosomal subunit protein bL12 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B2FQ37 1.68e-30 108 65 2 123 3 rplL Large ribosomal subunit protein bL12 Stenotrophomonas maltophilia (strain K279a)
B3R7T7 2.1e-30 108 61 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K605 2.1e-30 108 61 1 124 3 rplL Large ribosomal subunit protein bL12 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8XUZ7 2.12e-30 108 59 1 124 3 rplL Large ribosomal subunit protein bL12 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q3ZXY0 2.41e-30 108 56 1 123 3 rplL Large ribosomal subunit protein bL12 Dehalococcoides mccartyi (strain CBDB1)
Q6MJ06 2.66e-30 107 57 1 122 3 rplL Large ribosomal subunit protein bL12 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B4SKV5 2.69e-30 107 65 2 123 3 rplL Large ribosomal subunit protein bL12 Stenotrophomonas maltophilia (strain R551-3)
C6C178 3.63e-30 107 58 1 127 3 rplL Large ribosomal subunit protein bL12 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q47JB1 3.64e-30 107 60 1 123 3 rplL Large ribosomal subunit protein bL12 Dechloromonas aromatica (strain RCB)
Q30TP8 3.95e-30 107 54 1 122 3 rplL Large ribosomal subunit protein bL12 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A6LPQ3 4.23e-30 107 58 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B1XSP2 5.01e-30 107 59 1 125 3 rplL Large ribosomal subunit protein bL12 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
P51339 5.03e-30 107 51 2 129 3 rpl12 Large ribosomal subunit protein bL12c Porphyra purpurea
B7I359 5.13e-30 107 63 1 122 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain AB0057)
A5GAY0 6e-30 107 60 1 123 3 rplL Large ribosomal subunit protein bL12 Geotalea uraniireducens (strain Rf4)
B0VDG3 7.48e-30 107 63 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain AYE)
A3M1G2 7.48e-30 107 63 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VLZ7 7.48e-30 107 63 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain SDF)
B2I1Z0 7.48e-30 107 63 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain ACICU)
B7H1J9 7.48e-30 107 63 1 123 3 rplL Large ribosomal subunit protein bL12 Acinetobacter baumannii (strain AB307-0294)
C4XIP0 7.54e-30 107 54 1 126 3 rplL Large ribosomal subunit protein bL12 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B8FEU2 7.55e-30 107 58 1 124 3 rplL Large ribosomal subunit protein bL12 Desulfatibacillum aliphaticivorans
A6X0A8 7.95e-30 106 59 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B2TIG7 8.63e-30 106 61 1 120 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYA2 8.63e-30 106 61 1 120 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Alaska E43 / Type E3)
B6JER8 8.64e-30 106 60 1 121 3 rplL Large ribosomal subunit protein bL12 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A5VR16 9.79e-30 106 59 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q4L3K1 1.04e-29 106 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus haemolyticus (strain JCSC1435)
Q1AU21 1.06e-29 106 52 1 128 3 rplL Large ribosomal subunit protein bL12 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B4S496 1.07e-29 106 55 1 122 3 rplL Large ribosomal subunit protein bL12 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q2II87 1.17e-29 106 55 1 118 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter dehalogenans (strain 2CP-C)
A7HCH8 1.28e-29 106 56 1 119 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter sp. (strain Fw109-5)
B3E7S7 1.29e-29 106 58 1 123 3 rplL Large ribosomal subunit protein bL12 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A7GK11 1.33e-29 106 58 0 119 3 rplL Large ribosomal subunit protein bL12 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7GJ57 1.34e-29 106 60 1 121 3 rplL Large ribosomal subunit protein bL12 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
P05392 1.53e-29 105 59 1 122 1 rplL Large ribosomal subunit protein bL12 Geobacillus stearothermophilus
Q1R0I3 1.62e-29 105 58 1 124 3 rplL Large ribosomal subunit protein bL12 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q134R7 1.79e-29 105 60 1 119 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain BisB5)
B2IK54 1.91e-29 105 60 1 121 3 rplL Large ribosomal subunit protein bL12 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A9VNB3 2.1e-29 105 60 0 119 3 rplL Large ribosomal subunit protein bL12 Bacillus mycoides (strain KBAB4)
A8F4F9 2.12e-29 105 58 2 126 3 rplL Large ribosomal subunit protein bL12 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
A4XZ98 2.38e-29 105 58 1 123 3 rplL Large ribosomal subunit protein bL12 Pseudomonas mendocina (strain ymp)
B1L936 2.48e-29 105 56 2 128 3 rplL Large ribosomal subunit protein bL12 Thermotoga sp. (strain RQ2)
A5IJW4 2.48e-29 105 56 2 128 3 rplL Large ribosomal subunit protein bL12 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A6Q6I1 2.58e-29 105 53 1 124 3 rplL Large ribosomal subunit protein bL12 Sulfurovum sp. (strain NBC37-1)
Q8ETZ0 3.23e-29 105 56 1 120 3 rplL Large ribosomal subunit protein bL12 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A0L5W5 3.48e-29 105 59 1 123 3 rplL Large ribosomal subunit protein bL12 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
C0Q9Y0 3.82e-29 105 54 1 125 3 rplL Large ribosomal subunit protein bL12 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A4SUV3 3.87e-29 105 58 1 124 3 rplL Large ribosomal subunit protein bL12 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B2S093 3.94e-29 105 55 1 122 3 rplL Large ribosomal subunit protein bL12 Borrelia hermsii (strain HS1 / DAH)
Q0SQD5 4.14e-29 104 59 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium perfringens (strain SM101 / Type A)
Q0TMN7 4.14e-29 104 59 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A6U850 4.16e-29 105 60 1 120 3 rplL Large ribosomal subunit protein bL12 Sinorhizobium medicae (strain WSM419)
Q9PA85 4.65e-29 104 61 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain 9a5c)
P0A469 5.03e-29 104 58 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella suis biovar 1 (strain 1330)
B0CH42 5.03e-29 104 58 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella suis (strain ATCC 23445 / NCTC 10510)
P0A468 5.03e-29 104 58 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJL2 5.03e-29 104 58 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5R1 5.03e-29 104 58 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
P0A470 5.03e-29 104 58 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella abortus biovar 1 (strain 9-941)
Q2YM14 5.03e-29 104 58 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella abortus (strain 2308)
B2S688 5.03e-29 104 58 1 119 3 rplL Large ribosomal subunit protein bL12 Brucella abortus (strain S19)
Q5FTX6 5.23e-29 104 59 1 120 3 rplL Large ribosomal subunit protein bL12 Gluconobacter oxydans (strain 621H)
Q92QH8 5.26e-29 104 58 1 121 3 rplL Large ribosomal subunit protein bL12 Rhizobium meliloti (strain 1021)
C6E4R5 6.4e-29 104 59 1 126 3 rplL Large ribosomal subunit protein bL12 Geobacter sp. (strain M21)
A9H3S4 6.79e-29 104 57 1 120 3 rplL Large ribosomal subunit protein bL12 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
P07472 6.85e-29 104 59 1 123 1 rplL Large ribosomal subunit protein bL12 Halophilic eubacterium NRCC 41227
A4G9U6 7.36e-29 104 59 1 124 3 rplL Large ribosomal subunit protein bL12 Herminiimonas arsenicoxydans
Q1IHH3 8.05e-29 104 54 1 121 3 rplL Large ribosomal subunit protein bL12 Koribacter versatilis (strain Ellin345)
B2UEN7 8.21e-29 104 58 1 124 3 rplL Large ribosomal subunit protein bL12 Ralstonia pickettii (strain 12J)
Q87A31 8.28e-29 104 60 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5X8 8.28e-29 104 60 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain M12)
B2IA69 8.28e-29 104 60 2 123 3 rplL Large ribosomal subunit protein bL12 Xylella fastidiosa (strain M23)
Q5L407 8.33e-29 104 59 1 122 3 rplL Large ribosomal subunit protein bL12 Geobacillus kaustophilus (strain HTA426)
C0ZIG8 8.35e-29 103 60 1 120 3 rplL Large ribosomal subunit protein bL12 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A6W3A0 8.61e-29 104 65 1 123 3 rplL Large ribosomal subunit protein bL12 Marinomonas sp. (strain MWYL1)
Q1QN45 1.04e-28 103 59 1 120 3 rplL Large ribosomal subunit protein bL12 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B4SG12 1.09e-28 103 51 2 126 3 rplL Large ribosomal subunit protein bL12 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q07KK6 1.11e-28 103 58 1 119 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain BisA53)
Q211D7 1.19e-28 103 58 1 119 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain BisB18)
Q2K9M5 1.25e-28 103 57 1 122 3 rplL Large ribosomal subunit protein bL12 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PW58 1.25e-28 103 57 1 122 3 rplL Large ribosomal subunit protein bL12 Rhizobium etli (strain CIAT 652)
A6T3L4 1.58e-28 103 58 1 124 3 rplL Large ribosomal subunit protein bL12 Janthinobacterium sp. (strain Marseille)
A4IJH9 1.64e-28 103 59 1 122 3 rplL Large ribosomal subunit protein bL12 Geobacillus thermodenitrificans (strain NG80-2)
Q7W0S0 1.65e-28 103 59 1 127 3 rplL Large ribosomal subunit protein bL12 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2H0 1.65e-28 103 59 1 127 3 rplL Large ribosomal subunit protein bL12 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRE0 1.65e-28 103 59 1 127 3 rplL Large ribosomal subunit protein bL12 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A5FZX2 1.7e-28 103 54 1 119 3 rplL Large ribosomal subunit protein bL12 Acidiphilium cryptum (strain JF-5)
A6LE82 1.77e-28 103 56 1 112 3 rplL Large ribosomal subunit protein bL12 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q4ZMN6 1.86e-28 103 60 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas syringae pv. syringae (strain B728a)
Q48D28 1.86e-28 103 60 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1TVT1 2.01e-28 103 57 1 126 3 rplL Large ribosomal subunit protein bL12 Paracidovorax citrulli (strain AAC00-1)
Q8KG16 2.17e-28 103 55 1 121 3 rplL Large ribosomal subunit protein bL12 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q03ZH3 2.24e-28 103 52 0 121 3 rplL Large ribosomal subunit protein bL12 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A6GYU1 2.41e-28 103 53 1 117 3 rplL Large ribosomal subunit protein bL12 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
B5RRJ8 2.45e-28 103 56 1 123 3 rplL Large ribosomal subunit protein bL12 Borrelia recurrentis (strain A1)
B5RLV0 2.45e-28 103 56 1 123 3 rplL Large ribosomal subunit protein bL12 Borrelia duttonii (strain Ly)
A1VYJ3 2.48e-28 103 53 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FKR2 2.48e-28 103 53 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9PI32 2.51e-28 103 53 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q89J73 2.68e-28 102 56 1 121 3 rplL Large ribosomal subunit protein bL12 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5HVZ0 2.77e-28 102 56 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni (strain RM1221)
A5ELN8 3.37e-28 102 57 1 121 3 rplL Large ribosomal subunit protein bL12 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A6KYK4 3.66e-28 102 54 2 120 3 rplL Large ribosomal subunit protein bL12 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q63Q02 3.74e-28 102 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain K96243)
A3NEI8 3.74e-28 102 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain 668)
Q3JMQ2 3.74e-28 102 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain 1710b)
A3P0C6 3.74e-28 102 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia pseudomallei (strain 1106a)
A1V8B3 3.74e-28 102 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain SAVP1)
Q62GJ6 3.74e-28 102 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain ATCC 23344)
A2S7G5 3.74e-28 102 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain NCTC 10229)
A3MRU4 3.74e-28 102 58 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia mallei (strain NCTC 10247)
Q2IXS1 4.23e-28 102 59 1 119 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain HaA2)
A1BD22 4.24e-28 102 51 2 127 3 rplL Large ribosomal subunit protein bL12 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q9ZE21 4.58e-28 102 52 2 120 3 rplL Large ribosomal subunit protein bL12 Rickettsia prowazekii (strain Madrid E)
Q11HB2 4.78e-28 102 58 1 120 3 rplL Large ribosomal subunit protein bL12 Chelativorans sp. (strain BNC1)
Q2LQ88 5.12e-28 102 55 1 126 3 rplL Large ribosomal subunit protein bL12 Syntrophus aciditrophicus (strain SB)
B7J1W2 5.35e-28 102 54 1 124 3 rplL Large ribosomal subunit protein bL12 Borreliella burgdorferi (strain ZS7)
O51351 5.35e-28 102 54 1 124 3 rplL Large ribosomal subunit protein bL12 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8A468 5.65e-28 102 53 2 120 3 rplL Large ribosomal subunit protein bL12 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A5VC06 5.73e-28 102 58 1 122 3 rplL Large ribosomal subunit protein bL12 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q3B1H6 6.33e-28 102 52 2 125 3 rplL Large ribosomal subunit protein bL12 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q5N3N6 6.54e-28 102 53 2 128 3 rplL Large ribosomal subunit protein bL12 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31QK6 6.54e-28 102 53 2 128 3 rplL Large ribosomal subunit protein bL12 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q2L2M6 6.67e-28 102 59 1 126 3 rplL Large ribosomal subunit protein bL12 Bordetella avium (strain 197N)
B8EMS0 6.82e-28 102 59 1 122 3 rplL Large ribosomal subunit protein bL12 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B1X073 7.12e-28 102 51 2 133 3 rplL Large ribosomal subunit protein bL12 Crocosphaera subtropica (strain ATCC 51142 / BH68)
A7IKP9 7.19e-28 102 60 1 119 3 rplL Large ribosomal subunit protein bL12 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B3QC01 7.23e-28 102 56 1 121 3 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain TIE-1)
Q6N4R8 7.23e-28 102 56 1 121 1 rplL Large ribosomal subunit protein bL12 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q0BUQ8 7.39e-28 102 56 1 120 3 rplL Large ribosomal subunit protein bL12 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q9TL30 8.13e-28 102 49 2 128 3 rpl12 Large ribosomal subunit protein bL12c Nephroselmis olivacea
A8EVZ5 8.41e-28 101 52 1 123 3 rplL Large ribosomal subunit protein bL12 Aliarcobacter butzleri (strain RM4018)
P14134 9.12e-28 101 59 1 122 1 rplL Large ribosomal subunit protein bL12 Halanaerobium praevalens
Q3SSY1 9.19e-28 101 57 1 121 3 rplL Large ribosomal subunit protein bL12 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A7HWQ3 1.02e-27 101 58 1 118 3 rplL Large ribosomal subunit protein bL12 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A7H4Q6 1.06e-27 101 52 1 125 3 rplL Large ribosomal subunit protein bL12 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A5GPD2 1.07e-27 101 53 2 130 3 rplL Large ribosomal subunit protein bL12 Synechococcus sp. (strain WH7803)
Q889X9 1.16e-27 101 59 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A4YSI0 1.18e-27 101 56 1 121 3 rplL Large ribosomal subunit protein bL12 Bradyrhizobium sp. (strain ORS 278)
Q49V50 1.22e-27 101 53 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q1H4P5 1.23e-27 101 58 1 128 3 rplL Large ribosomal subunit protein bL12 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B3EL60 1.25e-27 101 53 1 122 3 rplL Large ribosomal subunit protein bL12 Chlorobium phaeobacteroides (strain BS1)
Q8XHR7 1.26e-27 101 58 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium perfringens (strain 13 / Type A)
B2JA77 1.27e-27 101 49 2 130 3 rplL Large ribosomal subunit protein bL12 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A1VAJ7 1.28e-27 101 58 1 127 3 rplL Large ribosomal subunit protein bL12 Nitratidesulfovibrio vulgaris (strain DP4)
Q727C8 1.28e-27 101 58 1 127 3 rplL Large ribosomal subunit protein bL12 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8YLJ5 1.29e-27 101 50 2 130 3 rplL Large ribosomal subunit protein bL12 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A5FQQ9 1.3e-27 101 57 1 123 3 rplL Large ribosomal subunit protein bL12 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B9LI32 1.33e-27 101 53 2 128 3 rplL Large ribosomal subunit protein bL12 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WFP9 1.33e-27 101 53 2 128 3 rplL Large ribosomal subunit protein bL12 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B9MH48 1.74e-27 100 54 1 126 3 rplL Large ribosomal subunit protein bL12 Acidovorax ebreus (strain TPSY)
Q9KGE3 1.8e-27 100 57 1 121 3 rplL Large ribosomal subunit protein bL12 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q64NJ6 1.88e-27 100 53 2 120 3 rplL Large ribosomal subunit protein bL12 Bacteroides fragilis (strain YCH46)
Q5L896 1.88e-27 100 53 2 120 3 rplL Large ribosomal subunit protein bL12 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B0UHX7 1.9e-27 100 58 1 121 3 rplL Large ribosomal subunit protein bL12 Methylobacterium sp. (strain 4-46)
B9E8Q7 2.07e-27 100 56 1 121 3 rplL Large ribosomal subunit protein bL12 Macrococcus caseolyticus (strain JCSC5402)
A1WCN0 2.44e-27 100 54 1 126 3 rplL Large ribosomal subunit protein bL12 Acidovorax sp. (strain JS42)
Q3Z7T6 3e-27 100 55 1 124 3 rplL Large ribosomal subunit protein bL12 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B1I1M6 3.27e-27 100 54 1 121 3 rplL Large ribosomal subunit protein bL12 Desulforudis audaxviator (strain MP104C)
A5D5H9 3.37e-27 100 59 1 125 3 rplL Large ribosomal subunit protein bL12 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B7JWT5 3.43e-27 100 46 2 132 3 rplL Large ribosomal subunit protein bL12 Rippkaea orientalis (strain PCC 8801 / RF-1)
A9BR97 4.51e-27 99 55 1 125 3 rplL Large ribosomal subunit protein bL12 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q8CTT1 4.68e-27 99 51 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRL2 4.68e-27 99 51 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B7KIR5 5.05e-27 100 58 2 110 3 rplL Large ribosomal subunit protein bL12 Gloeothece citriformis (strain PCC 7424)
A5N4N8 5.42e-27 99 57 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYA0 5.42e-27 99 57 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium kluyveri (strain NBRC 12016)
A9IJ27 7.09e-27 99 60 1 126 3 rplL Large ribosomal subunit protein bL12 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q98N67 7.69e-27 99 55 1 120 3 rplL Large ribosomal subunit protein bL12 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5WLS2 8.5e-27 99 56 1 120 3 rplL Large ribosomal subunit protein bL12 Shouchella clausii (strain KSM-K16)
B8IS76 8.92e-27 99 57 1 121 3 rplL Large ribosomal subunit protein bL12 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q2RQV2 8.95e-27 99 59 1 118 3 rplL Large ribosomal subunit protein bL12 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q160X6 9.15e-27 99 55 3 110 3 rplL Large ribosomal subunit protein bL12 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B3QQS3 9.21e-27 99 53 1 121 3 rplL Large ribosomal subunit protein bL12 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q3A9Q5 1.01e-26 99 57 1 123 3 rplL Large ribosomal subunit protein bL12 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P23349 1.04e-26 99 55 2 128 1 rplL Large ribosomal subunit protein bL12 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B0S065 1.25e-26 98 57 2 125 3 rplL Large ribosomal subunit protein bL12 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A9GRA8 1.49e-26 98 52 1 125 3 rplL Large ribosomal subunit protein bL12 Sorangium cellulosum (strain So ce56)
B9JVM7 1.54e-26 98 60 1 119 3 rplL Large ribosomal subunit protein bL12 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q1MIF0 1.58e-26 98 59 1 120 3 rplL Large ribosomal subunit protein bL12 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B1Y7H4 1.69e-26 98 54 1 124 3 rplL Large ribosomal subunit protein bL12 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A8F973 1.81e-26 98 54 0 121 3 rplL Large ribosomal subunit protein bL12 Bacillus pumilus (strain SAFR-032)
B9JDS0 1.98e-26 98 58 1 120 3 rplL Large ribosomal subunit protein bL12 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A4SGK7 2.44e-26 97 51 2 125 3 rplL Large ribosomal subunit protein bL12 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q01VB0 2.51e-26 98 55 1 120 3 rplL Large ribosomal subunit protein bL12 Solibacter usitatus (strain Ellin6076)
B1MVU1 2.52e-26 97 52 0 121 3 rplL Large ribosomal subunit protein bL12 Leuconostoc citreum (strain KM20)
C5CKF2 2.75e-26 97 56 1 125 3 rplL Large ribosomal subunit protein bL12 Variovorax paradoxus (strain S110)
B5ZYS6 2.75e-26 97 58 1 120 3 rplL Large ribosomal subunit protein bL12 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q3ATP6 2.92e-26 97 50 2 126 3 rplL Large ribosomal subunit protein bL12 Chlorobium chlorochromatii (strain CaD3)
B8G988 3.03e-26 97 53 1 128 3 rplL Large ribosomal subunit protein bL12 Chloroflexus aggregans (strain MD-66 / DSM 9485)
A0PXT7 3.03e-26 97 53 1 121 3 rplL Large ribosomal subunit protein bL12 Clostridium novyi (strain NT)
B1ZGR9 4.28e-26 97 57 1 121 3 rplL Large ribosomal subunit protein bL12 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A6TWJ1 4.46e-26 97 56 1 120 3 rplL Large ribosomal subunit protein bL12 Alkaliphilus metalliredigens (strain QYMF)
C3MAX1 4.75e-26 97 58 1 122 3 rplL Large ribosomal subunit protein bL12 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A1WK54 5.14e-26 97 53 1 124 3 rplL Large ribosomal subunit protein bL12 Verminephrobacter eiseniae (strain EF01-2)
Q250P5 5.32e-26 97 59 2 125 3 rplL Large ribosomal subunit protein bL12 Desulfitobacterium hafniense (strain Y51)
B8G1V3 5.32e-26 97 59 2 125 3 rplL Large ribosomal subunit protein bL12 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q3MA16 7.14e-26 97 52 2 128 3 rplL Large ribosomal subunit protein bL12 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q0BJ55 7.29e-26 96 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRC1 7.29e-26 96 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia ambifaria (strain MC40-6)
A0LII3 8.18e-26 96 52 1 125 3 rplL Large ribosomal subunit protein bL12 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q4K525 9.51e-26 96 57 0 121 3 rplL Large ribosomal subunit protein bL12 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B8D0B5 9.62e-26 96 56 1 123 3 rplL Large ribosomal subunit protein bL12 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B6IRP5 1.08e-25 96 56 1 122 3 rplL Large ribosomal subunit protein bL12 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q9RST0 1.1e-25 96 47 2 123 1 rplL Large ribosomal subunit protein bL12 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
B3ETZ1 1.11e-25 96 50 1 114 3 rplL Large ribosomal subunit protein bL12 Amoebophilus asiaticus (strain 5a2)
Q2SU18 1.34e-25 96 59 1 124 3 rplL Large ribosomal subunit protein bL12 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1GSF9 1.39e-25 96 58 1 120 3 rplL Large ribosomal subunit protein bL12 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q74L08 1.41e-25 95 52 1 121 3 rplL Large ribosomal subunit protein bL12 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q045V5 1.41e-25 95 52 1 121 3 rplL Large ribosomal subunit protein bL12 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8UE07 1.42e-25 95 58 1 120 1 rplL Large ribosomal subunit protein bL12 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6FZL8 1.57e-25 95 57 1 118 3 rplL Large ribosomal subunit protein bL12 Bartonella quintana (strain Toulouse)
B2S2I7 1.57e-25 95 50 5 126 3 rplL Large ribosomal subunit protein bL12 Treponema pallidum subsp. pallidum (strain SS14)
O83268 1.57e-25 95 50 5 126 3 rplL Large ribosomal subunit protein bL12 Treponema pallidum (strain Nichols)
Q03E51 1.59e-25 95 52 0 121 3 rplL Large ribosomal subunit protein bL12 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A6QEJ2 1.92e-25 95 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain Newman)
Q6G3X6 1.97e-25 95 59 1 118 3 rplL Large ribosomal subunit protein bL12 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q21SF6 2.2e-25 95 56 1 123 3 rplL Large ribosomal subunit protein bL12 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1USC7 2.25e-25 95 58 1 118 3 rplL Large ribosomal subunit protein bL12 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A4J102 2.44e-25 95 56 1 119 3 rplL Large ribosomal subunit protein bL12 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q97EG8 2.77e-25 95 54 1 123 3 rplL Large ribosomal subunit protein bL12 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q830Q8 3.53e-25 95 57 1 122 3 rplL Large ribosomal subunit protein bL12 Enterococcus faecalis (strain ATCC 700802 / V583)
B8DF04 3.89e-25 94 57 1 121 3 rplL Large ribosomal subunit protein bL12 Listeria monocytogenes serotype 4a (strain HCC23)
Q92F24 3.89e-25 94 57 1 121 3 rplL Large ribosomal subunit protein bL12 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P66062 4.2e-25 94 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain MW2)
A8YZN8 4.2e-25 94 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBU7 4.2e-25 94 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain MSSA476)
P99154 4.2e-25 94 54 1 120 1 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain N315)
P66061 4.2e-25 94 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HID5 4.2e-25 94 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain COL)
A5IQ94 4.2e-25 94 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain JH9)
P48860 4.2e-25 94 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJA0 4.2e-25 94 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain USA300)
A6TZ17 4.2e-25 94 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain JH1)
A7WYW4 4.2e-25 94 54 1 120 3 rplL Large ribosomal subunit protein bL12 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8YAA3 5.17e-25 94 56 1 121 3 rplL Large ribosomal subunit protein bL12 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B4UDT3 5.2e-25 94 55 1 119 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter sp. (strain K)
B8JB71 5.2e-25 94 55 1 119 3 rplL Large ribosomal subunit protein bL12 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q65PB7 5.43e-25 94 53 1 123 3 rplL Large ribosomal subunit protein bL12 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B1LY44 8.13e-25 94 57 1 120 3 rplL Large ribosomal subunit protein bL12 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q98QS2 8.26e-25 94 45 0 116 3 rplL Large ribosomal subunit protein bL12 Mycoplasmopsis pulmonis (strain UAB CTIP)
A7GJ83 8.44e-25 94 56 1 122 3 rplL Large ribosomal subunit protein bL12 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q7MX28 9.06e-25 94 51 1 119 3 rplL Large ribosomal subunit protein bL12 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14955
Feature type CDS
Gene rplL
Product 50S ribosomal protein L7/L12
Location 222682 - 223047 (strand: 1)
Length 366 (nucleotides) / 121 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2323
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00542 Ribosomal protein L7/L12 C-terminal domain
PF16320 Ribosomal protein L7/L12 dimerisation domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0222 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L7/L12

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02935 large subunit ribosomal protein L7/L12 Ribosome -

Protein Sequence

MSITKEQILDAVAEMSVMDVVELITMMEEKFGVSAAAAVAVAAGPAEAAEEKTEFDVILKAVGPNKVAVIKAVRGATGLGLKEAKDLVESAPAAMKEGVSKDEAETLKKALEEAGAEVEVK

Flanking regions ( +/- flanking 50bp)

TCGTTGCTTTTTAACGTATAAACTTATTCTGAATTTTAGGAACATATCGTATGTCTATCACTAAAGAACAAATTCTGGACGCAGTTGCTGAAATGTCTGTAATGGACGTTGTTGAACTGATCACCATGATGGAAGAAAAATTCGGCGTTTCTGCTGCTGCTGCTGTTGCTGTAGCTGCGGGTCCTGCTGAAGCTGCTGAAGAAAAAACTGAATTTGACGTTATTCTGAAAGCTGTTGGTCCGAACAAAGTAGCAGTAATCAAAGCTGTTCGCGGCGCAACTGGTCTGGGCCTGAAAGAAGCTAAAGATTTAGTTGAAAGTGCACCAGCTGCAATGAAAGAAGGCGTGAGCAAAGATGAAGCGGAAACGCTGAAGAAAGCTCTGGAAGAAGCTGGCGCAGAAGTTGAAGTTAAATAAGCCACTTTTTTTAGCAACAGCCTGAAAATGGCTGCTGGCTGGTGACTTAT