Homologs in group_866

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03740 FBDBKF_03740 80.5 Morganella morganii S1 hyfB hydrogenase 4 subunit B
EHELCC_06795 EHELCC_06795 80.5 Morganella morganii S2 hyfB hydrogenase 4 subunit B
NLDBIP_07120 NLDBIP_07120 80.5 Morganella morganii S4 hyfB hydrogenase 4 subunit B
LHKJJB_06655 LHKJJB_06655 80.5 Morganella morganii S3 hyfB hydrogenase 4 subunit B
HKOGLL_04275 HKOGLL_04275 80.5 Morganella morganii S5 hyfB hydrogenase 4 subunit B
F4V73_RS11130 F4V73_RS11130 80.8 Morganella psychrotolerans hyfB hydrogenase 4 subunit B

Distribution of the homologs in the orthogroup group_866

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_866

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P23482 0.0 786 61 2 672 1 hyfB Hydrogenase-4 component B Escherichia coli (strain K12)
P16429 1.88e-120 375 36 5 602 1 hycC Formate hydrogenlyase subunit 3 Escherichia coli (strain K12)
P9WIW3 6.75e-67 234 35 5 426 3 Rv0083 Uncharacterized protein Rv0083 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIW2 6.75e-67 234 35 5 426 3 MT0090 Uncharacterized protein MT0090 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9RGZ5 1.15e-39 159 29 11 451 1 mrpA Na(+)/H(+) antiporter subunit A Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P77437 4.1e-39 155 30 6 364 3 hyfF Hydrogenase-4 component F Escherichia coli (strain K12)
Q9K2S2 7.93e-38 154 29 10 413 1 mrpA Na(+)/H(+) antiporter subunit A Bacillus subtilis (strain 168)
Q9RGZ2 7.12e-34 139 25 13 474 1 mrpD Na(+)/H(+) antiporter subunit D Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q49W91 4.14e-33 139 27 16 510 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q99VZ2 4.63e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain N315)
Q932F5 4.63e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IQH5 4.63e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain JH9)
A6TZ99 4.63e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain JH1)
A7WZ76 4.63e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8NXT2 5.2e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain MW2)
Q6GBK7 5.2e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain MSSA476)
Q0Q2K0 5.74e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus
A8Z144 5.74e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain USA300 / TCH1516)
A6QET3 5.74e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain Newman)
Q5HI45 5.74e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain COL)
Q2G2U8 5.74e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJ15 5.74e-33 139 31 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain USA300)
Q49VG9 5.92e-33 139 29 15 427 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P77416 1.07e-32 135 26 7 428 3 hyfD Hydrogenase-4 component D Escherichia coli (strain K12)
Q4L4W7 1.64e-32 137 28 13 432 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus haemolyticus (strain JCSC1435)
P29925 1.7e-32 135 31 7 302 3 nqo13 NADH-quinone oxidoreductase chain 13 Paracoccus denitrificans
B1I6I5 2.74e-32 134 29 13 432 3 nuoN NADH-quinone oxidoreductase subunit N Desulforudis audaxviator (strain MP104C)
Q9ZCG0 3.06e-32 134 25 3 336 3 nuoM NADH-quinone oxidoreductase subunit M Rickettsia prowazekii (strain Madrid E)
Q2YST2 3.67e-32 136 30 11 345 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GJ47 4.08e-32 136 30 10 343 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus aureus (strain MRSA252)
P60675 8e-32 135 27 13 419 1 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain N315)
P60674 8e-32 135 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IRD0 8e-32 135 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain JH9)
A6U059 8e-32 135 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain JH1)
A7X0G4 8e-32 135 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain Mu3 / ATCC 700698)
P31971 8.77e-32 134 27 15 472 3 ndhF NAD(P)H-quinone oxidoreductase chain 5 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q8CPU8 8.9e-32 135 27 15 461 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQL0 8.9e-32 135 27 15 461 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2YWT4 1.25e-31 135 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q68VV6 1.33e-31 132 26 5 340 3 nuoM NADH-quinone oxidoreductase subunit M Rickettsia typhi (strain ATCC VR-144 / Wilmington)
B1X491 1.46e-31 134 28 13 422 3 ndhF1 NAD(P)H-quinone oxidoreductase subunit 5, organellar chromatophore 1 Paulinella chromatophora
Q1RKE5 1.58e-31 132 23 6 418 3 nuoM NADH-quinone oxidoreductase subunit M Rickettsia bellii (strain RML369-C)
Q8NXF6 2.06e-31 134 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain MW2)
A8Z059 2.06e-31 134 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain USA300 / TCH1516)
Q6GAX4 2.06e-31 134 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain MSSA476)
Q6GID6 2.06e-31 134 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain MRSA252)
A6QFG2 2.06e-31 134 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain Newman)
Q5HHD3 2.06e-31 134 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain COL)
Q2FZV1 2.06e-31 134 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIC3 2.06e-31 134 27 13 419 3 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus (strain USA300)
Q9ZNG6 2.44e-31 134 27 13 419 1 mnhA1 Na(+)/H(+) antiporter subunit A1 Staphylococcus aureus
Q7A725 3.33e-31 131 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain N315)
Q99VY9 3.33e-31 131 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7WZ79 3.33e-31 131 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q85T01 6.03e-31 132 26 15 484 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
Q0Q2J7 1.64e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus
Q8NXT1 1.68e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain MW2)
A8Z147 1.68e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBK4 1.68e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain MSSA476)
A6QET6 1.68e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain Newman)
Q5HI42 1.68e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain COL)
Q2YSV4 1.68e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IQH8 1.68e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain JH9)
Q2G212 1.68e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJ12 1.68e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain USA300)
A6TZA2 1.68e-30 129 23 10 461 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain JH1)
Q4L443 2.09e-30 131 28 20 494 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus haemolyticus (strain JCSC1435)
P20679 2.14e-30 130 25 27 687 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383)
P50974 2.26e-30 129 30 7 310 3 nuoM NADH-quinone oxidoreductase subunit M Rhodobacter capsulatus
Q8DHX4 2.95e-30 129 28 3 292 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4 2 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8YM86 3.34e-30 129 28 3 292 3 ndhD3 NAD(P)H-quinone oxidoreductase chain 4-3 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q2JWW3 3.77e-30 128 28 2 293 3 ndhD1 NAD(P)H-quinone oxidoreductase chain 4 1 Synechococcus sp. (strain JA-3-3Ab)
Q6QU67 5.29e-30 129 25 15 496 3 nad5 NADH-ubiquinone oxidoreductase chain 5 Aspergillus niger
Q3MAR0 5.37e-30 128 28 3 292 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4 2 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q4UK26 6.3e-30 127 24 4 355 3 nuoM NADH-quinone oxidoreductase subunit M Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9I0J0 8.85e-30 127 27 7 344 3 nuoM NADH-quinone oxidoreductase subunit M Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q55429 1.04e-29 128 27 13 428 3 ndhF NAD(P)H-quinone oxidoreductase chain 5 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8CQ47 1.33e-29 126 23 11 477 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRA9 1.41e-29 126 23 11 477 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q92G96 1.46e-29 126 24 5 355 3 nuoM NADH-quinone oxidoreductase subunit M Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q6GJ44 1.9e-29 126 25 11 439 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus aureus (strain MRSA252)
Q10ZG8 1.95e-29 127 28 7 319 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4 2 Trichodesmium erythraeum (strain IMS101)
F1SVK0 3.79e-29 127 26 15 443 1 fpoL F(420)H(2) dehydrogenase subunit L Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q52978 4.17e-29 127 27 14 443 3 phaAB Probable K(+)/H(+) antiporter subunit A/B Rhizobium meliloti (strain 1021)
Q8CQ50 4.63e-29 127 30 11 340 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q35099 5.43e-29 125 29 12 360 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Metridium senile
Q5HRB2 5.78e-29 126 30 11 340 3 mnhA2 Putative antiporter subunit mnhA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P72823 5.8e-29 125 28 7 318 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4-2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B0JS85 7.01e-29 125 28 5 288 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4 2 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
F1SVH9 1.35e-28 123 30 9 305 1 fpoM F(420)H(2) dehydrogenase subunit M Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8M9U5 1.62e-28 124 27 14 439 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Chaetosphaeridium globosum
P9WIW1 1.89e-28 124 29 12 424 1 nuoL NADH-quinone oxidoreductase subunit L Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIW0 1.89e-28 124 29 12 424 3 nuoL NADH-quinone oxidoreductase subunit L Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q3M9C7 3.01e-28 123 28 3 285 3 ndhD3 NAD(P)H-quinone oxidoreductase chain 4 3 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A1XG02 4.28e-28 124 27 12 399 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Nuphar advena
P03916 5.39e-28 122 30 16 356 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Pan paniscus
Q8YZV7 5.81e-28 122 27 3 285 3 ndhD1 NAD(P)H-quinone oxidoreductase chain 4 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q2JPJ1 6.47e-28 122 26 2 293 3 ndhD1 NAD(P)H-quinone oxidoreductase chain 4 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
P50368 1.01e-27 122 25 24 581 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Schizophyllum commune
P11628 1.37e-27 122 25 18 492 3 nd5 NADH-ubiquinone oxidoreductase chain 5 Emericella nidulans
Q6EW03 1.38e-27 122 27 12 399 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Nymphaea alba
Q34879 1.41e-27 121 29 14 356 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Lemur catta
P33607 1.51e-27 121 30 20 430 1 nuoL NADH-quinone oxidoreductase subunit L Escherichia coli (strain K12)
P48919 1.82e-27 120 26 14 435 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Candida parapsilosis
P0AFE8 1.98e-27 120 27 8 343 1 nuoM NADH-quinone oxidoreductase subunit M Escherichia coli (strain K12)
P0AFE9 1.98e-27 120 27 8 343 3 nuoM NADH-quinone oxidoreductase subunit M Escherichia coli O157:H7
Q8HHD2 2.25e-27 121 26 20 499 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Cryphonectria parasitica
Q95885 2.32e-27 120 30 16 360 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Papio hamadryas
P03915 3.18e-27 120 29 17 407 1 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Homo sapiens
O05229 3.58e-27 119 25 5 336 1 mrpD Na(+)/H(+) antiporter subunit D Bacillus subtilis (strain 168)
Q06GK2 3.72e-27 120 27 12 412 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Piper cenocladum
Q4L446 3.76e-27 119 25 9 426 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus haemolyticus (strain JCSC1435)
Q4L4W4 3.76e-27 119 24 10 406 3 mnhD Na+/H+-antiporter, MnhD subunit Staphylococcus haemolyticus (strain JCSC1435)
A7Y3L2 3.83e-27 119 26 5 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Ipomoea purpurea
B1XHP2 3.92e-27 119 29 5 287 3 ndhD1 NAD(P)H-quinone oxidoreductase chain 4 1 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q35648 3.94e-27 120 30 16 356 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Pan troglodytes
Q09MC9 4.68e-27 120 26 18 524 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Citrus sinensis
P05510 4.93e-27 120 25 17 466 3 ndh-5 NADH-ubiquinone oxidoreductase chain 5 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
B1XJL9 5.17e-27 119 27 6 317 3 ndhD3 NAD(P)H-quinone oxidoreductase chain 4 3 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q32126 6.01e-27 120 28 12 407 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Dampiera diversifolia
Q5N5W1 6.3e-27 119 32 1 205 3 ndhD1 NAD(P)H-quinone oxidoreductase chain 4 1 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31NA0 6.3e-27 119 32 1 205 3 ndhD1 NAD(P)H-quinone oxidoreductase chain 4 1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8SHP7 1.17e-26 119 27 19 447 3 nd5 NADH-ubiquinone oxidoreductase chain 5 Hypocrea jecorina
P26848 1.27e-26 117 23 7 344 3 ND4 NADH-ubiquinone oxidoreductase chain 4 Marchantia polymorpha
Q6GID9 1.34e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain MRSA252)
Q6V9D9 1.39e-26 119 26 15 427 3 nad5 NADH-ubiquinone oxidoreductase chain 5 Talaromyces marneffei
Q9MUK8 1.64e-26 118 27 15 442 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Mesostigma viride
Q5HHD6 1.74e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain COL)
P29924 1.74e-26 118 29 24 483 3 nqo12 NADH-quinone oxidoreductase chain 12 Paracoccus denitrificans
P60687 1.83e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain MW2)
P60686 1.83e-26 117 23 7 378 1 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus
Q6GAX7 1.83e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain MSSA476)
P60685 1.83e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain N315)
P60684 1.83e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QFF9 1.83e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain Newman)
A5IRC7 1.83e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain JH9)
Q2G2H7 1.83e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
A6U056 1.83e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain JH1)
A7X0F9 1.83e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YWT7 1.95e-26 117 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A8Z056 2.62e-26 116 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain USA300 / TCH1516)
Q2FIC6 2.62e-26 116 23 7 378 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus aureus (strain USA300)
Q49VH2 3.44e-26 116 24 7 428 3 mnhD2 Putative antiporter subunit mnhD2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q85BG0 3.7e-26 116 26 7 327 2 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Anthoceros angustus
P50365 3.82e-26 117 27 15 404 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Allomyces macrogynus
Q6YXQ3 5.1e-26 115 27 7 343 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Physcomitrium patens
Q37617 5.8e-26 115 24 8 384 3 ND4 NADH-ubiquinone oxidoreductase chain 4 Prototheca wickerhamii
Q9TLC2 6.49e-26 117 27 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Tecoma stans
P93313 7.15e-26 115 23 8 399 1 ND4 NADH-ubiquinone oxidoreductase chain 4 Arabidopsis thaliana
Q9TKV7 8.82e-26 116 26 12 444 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Nephroselmis olivacea
Q9TDR1 1.16e-25 115 29 15 350 1 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Sus scrofa
A4QLP4 1.25e-25 116 28 14 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Lobularia maritima
P24978 1.39e-25 115 28 15 355 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Balaenoptera physalus
B1VKJ3 1.43e-25 115 28 14 404 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Cryptomeria japonica
Q0G9R5 1.46e-25 115 27 13 407 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Daucus carota
O47815 1.57e-25 115 24 16 478 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Geomys personatus
Q9PMA7 1.7e-25 115 26 9 386 3 nuoL NADH-quinone oxidoreductase subunit L Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q1RKE6 1.79e-25 115 26 13 447 3 nuoL NADH-quinone oxidoreductase subunit L Rickettsia bellii (strain RML369-C)
O47497 1.8e-25 114 24 5 369 3 ND4 NADH-ubiquinone oxidoreductase chain 4 Metridium senile
P06264 2.01e-25 115 27 13 416 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Marchantia polymorpha
Q9ZCG1 2.41e-25 115 26 11 424 3 nuoL NADH-quinone oxidoreductase subunit L Rickettsia prowazekii (strain Madrid E)
P03917 2.63e-25 114 32 13 294 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Gorilla gorilla gorilla
A9QPJ1 2.68e-25 113 25 10 414 3 hyfF Hydrogenase-4 component F homolog Methylacidiphilum infernorum (isolate V4)
A4QLF6 2.73e-25 115 26 19 523 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Lepidium virginicum
Q9BBP6 2.84e-25 115 28 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Lotus japonicus
Q2QD43 2.97e-25 115 28 12 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Cucumis sativus
Q06FL7 2.97e-25 115 25 15 490 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Pelargonium hortorum
B1A981 3.06e-25 115 25 14 490 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Carica papaya
P29388 3.46e-25 114 27 15 423 1 ND5 NADH-ubiquinone oxidoreductase chain 5 Arabidopsis thaliana
Q9I0J1 3.54e-25 114 29 18 428 3 nuoL NADH-quinone oxidoreductase subunit L Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q32RH9 3.74e-25 114 29 11 350 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Zygnema circumcarinatum
Q9M3J4 3.75e-25 114 25 17 504 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Spinacia oleracea
Q9B8C9 4.08e-25 113 24 13 432 3 NAD5 NADH-ubiquinone oxidoreductase chain 5 Candida albicans (strain SC5314 / ATCC MYA-2876)
P50367 4.34e-25 114 25 15 423 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Rhizopus stolonifer
Q2PMM9 4.39e-25 114 27 10 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Glycine max
Q49KV1 6.05e-25 114 26 19 542 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Eucalyptus globulus subsp. globulus
Q85FH9 6.09e-25 114 27 10 372 2 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Adiantum capillus-veneris
Q68RV9 6.58e-25 114 28 12 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Panax ginseng
B1NWJ6 6.73e-25 114 28 13 396 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Manihot esculenta
Q0H8X0 6.76e-25 113 25 18 446 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Ustilago maydis (strain 521 / FGSC 9021)
Q8M9U1 6.99e-25 112 24 6 358 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Chaetosphaeridium globosum
A4QKF4 7.14e-25 114 25 16 503 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Barbarea verna
Q37680 7.3e-25 113 26 20 475 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Triticum aestivum
Q8S8V0 7.37e-25 113 28 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Atropa belladonna
P03920 7.72e-25 113 28 13 355 1 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Bos taurus
Q06R80 8.58e-25 112 30 2 212 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Jasminum nudiflorum
Q2JTD6 9.06e-25 112 21 3 355 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4 2 Synechococcus sp. (strain JA-3-3Ab)
Q70XW6 9.13e-25 113 27 13 411 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Amborella trichopoda
Q2PMN2 9.15e-25 112 29 3 216 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Glycine max
A4QKP2 9.46e-25 113 28 14 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Capsella bursa-pastoris
Q33BX5 9.94e-25 113 27 10 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Nicotiana tomentosiformis
Q9ZZY1 1.11e-24 112 26 11 355 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Hippopotamus amphibius
A1EA56 1.15e-24 113 26 15 429 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Agrostis stolonifera
A9LYE7 1.18e-24 113 27 15 437 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Acorus calamus var. americanus
A4QJX9 1.23e-24 113 28 13 392 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Olimarabidopsis pumila
Q3V4Y7 1.24e-24 113 27 15 437 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Acorus calamus
Q2A7B8 1.28e-24 111 25 4 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Solanum lycopersicum
Q859V1 1.31e-24 112 27 11 351 2 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Anthoceros angustus
P06263 1.36e-24 111 28 4 251 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Marchantia polymorpha
B3TN96 1.37e-24 112 27 15 426 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Brachypodium distachyon
Q8CPV1 1.4e-24 111 22 7 389 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q32440 1.62e-24 112 26 15 429 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Hordeum vulgare
Q32516 1.66e-24 112 26 10 406 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Solanum lycopersicum
P46620 1.66e-24 112 26 12 404 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Zea mays
A2T379 1.67e-24 112 29 11 350 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Angiopteris evecta
P51095 1.74e-24 112 26 13 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Adenocaulon himalaicum
Q19V61 1.93e-24 111 25 4 300 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Chlorokybus atmophyticus
Q5HQL3 1.96e-24 110 22 7 389 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A6H5N8 1.97e-24 112 28 10 350 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Cycas taitungensis
P06262 2.01e-24 110 26 4 273 2 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Nicotiana tabacum
Q3C1Q4 2.01e-24 110 26 4 273 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Nicotiana sylvestris
Q576B4 2.08e-24 111 28 13 346 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Bos indicus
Q33BX2 2.09e-24 110 26 4 273 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Nicotiana tomentosiformis
Q6ENQ0 2.09e-24 112 26 13 404 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Saccharum officinarum
Q09FZ9 2.17e-24 112 28 12 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Platanus occidentalis
Q58705 2.25e-24 110 26 9 375 4 MJ1309 Uncharacterized protein MJ1309 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q6L3E3 2.28e-24 112 26 13 404 2 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Saccharum hybrid
Q2VED3 2.39e-24 112 28 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Solanum tuberosum
P15958 2.4e-24 112 27 10 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Vicia faba
Q33066 2.51e-24 112 26 13 404 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Sorghum bicolor
B2LMQ1 2.53e-24 112 27 14 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Guizotia abyssinica
P56752 2.74e-24 112 28 13 392 1 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Arabidopsis thaliana
Q9XAR5 3.02e-24 111 27 13 442 3 nuoL NADH-quinone oxidoreductase subunit L Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q37710 3.07e-24 110 28 7 286 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Artemia franciscana
B5LMS9 3.14e-24 111 27 10 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Cicer arietinum
A7Y3K7 3.19e-24 111 29 9 340 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Ipomoea purpurea
A4GGE3 3.21e-24 111 27 10 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Phaseolus vulgaris
Q32880 3.33e-24 111 26 15 426 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) Poa pratensis
Q32S08 3.46e-24 110 25 3 293 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Staurastrum punctulatum
Q4UK27 3.47e-24 111 28 9 373 3 nuoL NADH-quinone oxidoreductase subunit L Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q0G9R2 3.5e-24 110 24 2 309 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Daucus carota
Q76LN2 3.68e-24 110 28 13 346 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Rousettus amplexicaudatus
P41299 4.08e-24 110 30 13 293 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Balaenoptera musculus
Q1ACF3 4.15e-24 111 26 14 439 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Chara vulgaris
Q92G97 4.74e-24 110 27 8 373 3 nuoL NADH-quinone oxidoreductase subunit L Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P51098 5.02e-24 111 27 13 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Athroisma gracile
Q32551 5.1e-24 111 26 13 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Mutisia acuminata
Q95H46 5.41e-24 110 25 13 428 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Triticum aestivum
O78756 5.82e-24 110 28 13 355 1 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Ovis aries
Q8YQ78 6.21e-24 109 26 5 283 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4-2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q0G9H2 6.42e-24 110 27 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Liriodendron tulipifera
Q2L960 6.69e-24 110 28 15 412 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Gossypium hirsutum
Q8W8H5 7.19e-24 110 25 12 420 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Psilotum nudum
Q2MIE0 7.51e-24 110 28 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Solanum bulbocastanum
Q94RJ2 7.79e-24 110 27 13 347 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Chimaera monstrosa
Q09FR3 7.86e-24 110 27 15 412 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Nandina domestica
Q9TKV8 8.06e-24 108 24 9 362 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Nephroselmis olivacea
Q3MCB9 8.21e-24 109 26 5 283 3 ndhD1 NAD(P)H-quinone oxidoreductase chain 4 1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A4GGE6 8.61e-24 108 28 3 216 2 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Phaseolus vulgaris
O63908 8.66e-24 109 30 19 344 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Glis glis
A0ZZ82 8.73e-24 110 28 15 412 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Gossypium barbadense
Q8S8U7 9.57e-24 108 26 4 273 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Atropa belladonna
A4QL68 9.71e-24 110 27 14 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Draba nemorosa
P06265 1e-23 110 28 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Nicotiana tabacum
Q3C1N9 1.03e-23 110 28 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Nicotiana sylvestris
Q6YXQ6 1.03e-23 110 26 15 429 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Physcomitrium patens
A8Y9D4 1.09e-23 110 26 15 426 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Lolium perenne
Q2VED0 1.14e-23 108 25 4 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Solanum tuberosum
A9L9E4 1.16e-23 110 28 15 395 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Lemna minor
Q2JK43 1.17e-23 108 21 4 358 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
A4QK67 1.18e-23 110 25 15 482 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Arabis hirsuta
Q32238 1.21e-23 110 26 13 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Flaveria ramosissima
P51099 1.24e-23 110 27 13 407 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Atractylodes lancea
Q1ACE9 1.28e-23 108 24 3 293 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Chara vulgaris
B0Z5H4 1.32e-23 109 28 14 402 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Oenothera parviflora
B0Z590 1.32e-23 109 28 14 402 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Oenothera glazioviana
B0Z506 1.32e-23 109 28 14 402 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Oenothera biennis
B0Z4S2 1.32e-23 109 28 14 402 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Oenothera argillicola
Q9TA19 1.39e-23 109 27 13 356 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Loxodonta africana
Q9TLA3 1.42e-23 109 27 12 391 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Ligustrum vulgare
A4QJG3 1.61e-23 109 26 18 512 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Aethionema cordifolium
Q9MTI4 1.68e-23 109 28 14 402 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Oenothera elata subsp. hookeri
Q31952 1.73e-23 109 28 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) Capsicum baccatum
Q32131 1.73e-23 109 27 12 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) Digitalis grandiflora
P51097 1.75e-23 109 26 13 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Symphyotrichum cordifolium
Q96069 1.75e-23 108 27 12 346 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Rhinoceros unicornis
Q32091 1.75e-23 109 27 13 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Carthamus tinctorius
Q09MC6 1.76e-23 108 26 4 273 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Citrus sinensis
P27572 1.78e-23 108 23 6 342 2 ND4 NADH-ubiquinone oxidoreductase chain 4 Triticum aestivum
Q31849 1.87e-23 109 26 13 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Ambrosia trifida
Q06R83 1.92e-23 109 27 9 340 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Jasminum nudiflorum
A4QLY2 2.03e-23 109 25 15 503 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Nasturtium officinale
A6MMI0 2.11e-23 109 27 12 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Chloranthus spicatus
P92699 2.12e-23 108 28 12 333 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Pongo abelii
P57262 2.22e-23 108 28 12 351 3 nuoL NADH-quinone oxidoreductase subunit L Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B0C4B4 2.34e-23 108 25 6 327 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Acaryochloris marina (strain MBIC 11017)
Q0ZIX1 2.43e-23 108 27 12 392 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Vitis vinifera
Q68RV6 2.45e-23 107 30 3 216 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Panax ginseng
Q9MVL6 2.53e-23 108 27 14 412 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) Malvaviscus arboreus
P0C328 2.65e-23 108 27 14 407 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Oryza sativa subsp. japonica
P0C327 2.65e-23 108 27 14 407 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Oryza sativa subsp. indica
P0C326 2.65e-23 108 27 14 407 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Oryza sativa
Q6ENB0 2.65e-23 108 27 14 407 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Oryza nivara
P51100 2.66e-23 108 26 13 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Gerbera jamesonii
O03205 3.01e-23 108 28 14 347 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Ceratotherium simum
Q38PR2 3.03e-23 108 27 13 356 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Mammuthus primigenius
Q32007 3.07e-23 108 27 12 393 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Cichorium intybus
Q32384 3.21e-23 108 26 13 415 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Helianthus annuus
Q34313 3.58e-23 108 27 19 442 3 nad5 NADH-ubiquinone oxidoreductase chain 5 Dictyostelium discoideum
Q01561 3.63e-23 108 25 15 419 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Trichophyton rubrum
P48920 3.87e-23 108 25 12 395 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Chondrus crispus
Q3AGZ9 4.17e-23 107 30 1 188 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Synechococcus sp. (strain CC9605)
A6H5P2 4.18e-23 107 25 6 358 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Cycas taitungensis
Q32RL9 4.24e-23 107 25 3 293 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Zygnema circumcarinatum
A6MMZ5 4.33e-23 107 29 3 216 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Illicium oligandrum
Q7U413 4.34e-23 107 30 1 188 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Parasynechococcus marenigrum (strain WH8102)
Q5SCZ6 4.85e-23 106 25 4 314 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Huperzia lucidula
Q33113 5.47e-23 107 26 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) Sesamum indicum
P26849 5.65e-23 107 26 18 446 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Marchantia polymorpha
A6MMR6 5.82e-23 107 29 11 394 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Dioscorea elephantipes
A4QKY1 6.29e-23 107 27 11 391 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Crucihimalaya wallichii
A2T383 6.53e-23 106 24 3 300 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Angiopteris evecta
Q0I6X0 6.56e-23 106 27 2 215 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Synechococcus sp. (strain CC9311)
P51096 7.3e-23 107 25 11 410 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Anisothrix integra
Q9MVK2 7.55e-23 107 28 15 412 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) Pachira aquatica
A4QJP7 7.55e-23 107 26 18 512 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Aethionema grandiflorum
Q8KX53 7.69e-23 106 24 3 292 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4 2 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q2I3G4 7.85e-23 107 29 11 294 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Elephas maximus
P10330 8.2e-23 107 26 15 423 2 ND5 NADH-ubiquinone oxidoreductase chain 5 Oenothera berteroana
B2XWI8 9.84e-23 107 29 10 340 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Fagopyrum esculentum subsp. ancestrale
Q49W88 9.97e-23 105 26 7 346 3 mnhD1 Na(+)/H(+) antiporter subunit D1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q1KXQ3 1e-22 105 25 4 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Helianthus annuus
A1XGU4 1.02e-22 107 28 14 408 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Ranunculus macranthus
Q09WW8 1.04e-22 105 29 3 216 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Morus indica
O79437 1.08e-22 106 27 12 347 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Oryctolagus cuniculus
Q06GU9 1.09e-22 107 26 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Drimys granadensis
A0A385 1.28e-22 105 26 5 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Coffea arabica
Q32539 1.28e-22 106 27 14 412 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Lactuca sativa
P50939 1.38e-22 106 28 11 346 3 nuoL NADH-quinone oxidoreductase subunit L Rhodobacter capsulatus
Q32S06 1.39e-22 106 27 19 474 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Staurastrum punctulatum
Q9BBP3 1.43e-22 105 26 1 215 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Lotus japonicus
Q85FH5 1.43e-22 105 23 2 293 2 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Adiantum capillus-veneris
Q1KXG6 1.62e-22 105 25 4 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Lactuca sativa
A0A382 1.75e-22 106 28 11 343 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Coffea arabica
P38602 1.94e-22 105 28 11 294 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Halichoerus grypus
B2LMP8 1.99e-22 104 26 4 273 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Guizotia abyssinica
Q7YJT6 2.11e-22 105 27 11 390 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Calycanthus floridus var. glaucus
P03921 2.45e-22 105 28 15 348 1 Mtnd5 NADH-ubiquinone oxidoreductase chain 5 Mus musculus
Q1HK80 2.46e-22 105 29 13 299 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Canis lupus
A4GYW6 2.61e-22 104 24 5 303 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Populus trichocarpa
P03918 3.06e-22 105 30 11 293 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Pongo pygmaeus
P48921 3.7e-22 104 29 13 294 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Felis catus
Q14FA8 4.05e-22 103 24 5 303 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Populus alba
A2CD41 4.14e-22 104 27 3 242 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain MIT 9303)
P48656 4.58e-22 104 27 13 354 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Equus caballus
Q953I4 4.78e-22 104 27 13 355 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Episoriculus fumidus
Q7VE41 5.17e-22 103 28 1 197 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q8W9M6 5.69e-22 104 27 15 357 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Dugong dugon
Q00542 5.97e-22 103 29 12 295 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Phoca vitulina
Q2LCP6 7.36e-22 103 26 17 438 3 nad5 NADH-ubiquinone oxidoreductase chain 5 Dictyostelium citrinum
Q89AT5 7.4e-22 103 24 8 404 3 nuoM NADH-quinone oxidoreductase subunit M Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8DKY0 8.79e-22 103 29 1 189 1 ndhD1 NAD(P)H-quinone oxidoreductase chain 4 1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A5GP41 9.03e-22 103 28 1 188 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Synechococcus sp. (strain WH7803)
Q3B063 9.56e-22 103 29 1 188 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Synechococcus sp. (strain CC9902)
Q7NP39 9.62e-22 102 26 2 218 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A6MMZ2 9.63e-22 103 27 14 398 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Illicium oligandrum
B0Z5H7 9.88e-22 102 24 4 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Oenothera parviflora
A8SEF0 1.13e-21 103 27 11 393 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Ceratophyllum demersum
Q37372 1.21e-21 103 34 8 213 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Acanthamoeba castellanii
Q7YJT3 1.23e-21 102 27 3 227 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Calycanthus floridus var. glaucus
B1VKI4 1.28e-21 102 23 4 310 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Cryptomeria japonica
P33510 1.29e-21 102 28 9 350 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Anopheles quadrimaculatus
A1XGU1 1.36e-21 102 24 4 310 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Ranunculus macranthus
Q7V4E4 1.43e-21 102 26 3 242 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain MIT 9313)
Q118H6 1.43e-21 102 24 5 306 3 ndhD1 NAD(P)H-quinone oxidoreductase chain 4 1 Trichodesmium erythraeum (strain IMS101)
Q5SCZ9 1.48e-21 103 26 10 354 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Huperzia lucidula
P03919 1.66e-21 102 27 15 355 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Hylobates lar
A9L9E7 1.77e-21 102 24 4 301 2 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Lemna minor
P18932 1.79e-21 102 28 9 350 1 mt:ND5 NADH-ubiquinone oxidoreductase chain 5 Drosophila melanogaster
A4QJG6 1.87e-21 102 27 2 212 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Aethionema cordifolium
B0Z4S5 2.09e-21 102 24 4 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Oenothera argillicola
A4QJQ0 2.34e-21 101 27 2 212 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Aethionema grandiflorum
Q9MUM8 2.36e-21 101 24 3 250 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Mesostigma viride
Q36459 2.54e-21 102 28 14 360 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Ornithorhynchus anatinus
P58419 2.8e-21 101 24 4 301 2 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Oenothera elata subsp. hookeri
B0Z593 2.9e-21 101 24 4 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Oenothera glazioviana
B0Z509 2.9e-21 101 24 4 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Oenothera biennis
Q68VV7 2.97e-21 102 26 11 416 3 nuoL NADH-quinone oxidoreductase subunit L Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P51899 3.04e-21 99 27 10 355 3 ND5 NADH-ubiquinone oxidoreductase chain 5 (Fragment) Anopheles arabiensis
O21335 3.06e-21 102 29 11 293 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Dasypus novemcinctus
P92485 3.08e-21 102 27 13 354 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Equus asinus
Q04050 3.21e-21 101 22 6 341 3 ND4 NADH-ubiquinone oxidoreductase chain 4 Brassica campestris
P9WIW5 3.31e-21 101 26 5 302 1 nuoM NADH-quinone oxidoreductase subunit M Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIW4 3.31e-21 101 26 5 302 3 nuoM NADH-quinone oxidoreductase subunit M Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1XG05 3.32e-21 101 24 5 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Nuphar advena
A9LYF0 3.73e-21 100 24 4 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Acorus calamus var. americanus
A4GYW4 4.04e-21 102 26 13 416 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Populus trichocarpa
Q70XV2 4.12e-21 100 24 5 310 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Amborella trichopoda
O78688 4.25e-21 101 28 14 351 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Carassius auratus
Q14FB0 4.81e-21 101 27 12 393 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Populus alba
P11993 5.16e-21 101 27 13 346 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Patiria pectinifera
P41309 5.44e-21 101 28 14 347 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Didelphis virginiana
A2BZX6 6.17e-21 100 27 5 257 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain NATL1A)
P32421 7.4e-21 100 22 9 418 3 ndhD1 NAD(P)H-quinone oxidoreductase chain 4-1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q09FR0 7.45e-21 100 24 2 272 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Nandina domestica
Q3V4Y4 7.51e-21 100 24 4 301 2 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Acorus calamus
Q46HM4 7.57e-21 100 27 5 257 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain NATL2A)
A8SEF4 7.93e-21 100 24 4 294 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Ceratophyllum demersum
Q9ZZM3 8.07e-21 100 28 16 354 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Salmo salar
P18940 8.7e-21 100 29 16 362 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Gallus gallus
P34854 8.7e-21 100 27 10 355 3 mt:ND5 NADH-ubiquinone oxidoreductase chain 5 Anopheles gambiae
B1NWJ9 8.99e-21 99 23 4 301 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Manihot esculenta
B0JPG4 9.02e-21 100 23 3 292 3 ndhD1 NAD(P)H-quinone oxidoreductase chain 4 1 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q35813 9.67e-21 100 30 12 300 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Struthio camelus
P34195 1.08e-20 100 29 17 383 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Formosania lacustris
Q9ZZ44 1.12e-20 100 29 18 356 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Squalus acanthias
Q09FZ6 1.37e-20 99 24 4 273 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Platanus occidentalis
Q0G9G9 1.45e-20 99 27 3 215 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Liriodendron tulipifera
A6MM84 1.65e-20 100 26 15 427 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Buxus microphylla
P07706 1.69e-20 99 29 11 353 3 mt:ND5 NADH-ubiquinone oxidoreductase chain 5 Drosophila yakuba
Q8WHX8 1.69e-20 99 22 3 305 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Psilotum nudum
Q09WX1 1.81e-20 100 27 14 416 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Morus indica
Q9ZZ57 1.86e-20 99 28 13 299 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Canis lupus familiaris
Q06FQ4 1.91e-20 99 31 3 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Pelargonium hortorum
P24979 1.94e-20 99 28 13 346 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Cyprinus carpio
P11661 2.18e-20 99 28 12 297 3 Mt-nd5 NADH-ubiquinone oxidoreductase chain 5 Rattus norvegicus
A9BD08 2.19e-20 99 27 1 197 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain MIT 9211)
Q9B6D3 2.29e-20 99 26 9 314 1 ND5 NADH-ubiquinone oxidoreductase chain 5 Yarrowia lipolytica (strain CLIB 122 / E 150)
Q6EW00 2.43e-20 98 23 5 310 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Nymphaea alba
A6MMH7 2.5e-20 98 28 2 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Chloranthus spicatus
B0FWD3 2.54e-20 99 29 11 355 3 mt:ND5 NADH-ubiquinone oxidoreductase chain 5 Aedes aegypti
A2BUC6 2.78e-20 98 25 3 251 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain MIT 9515)
O79411 3.25e-20 98 30 13 293 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Scyliorhinus canicula
Q9TL56 4.77e-20 98 27 13 401 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Carpenteria californica
O79422 4.96e-20 98 28 11 298 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Branchiostoma lanceolatum
Q31D31 5.59e-20 97 27 1 197 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain MIT 9312)
P15552 6.32e-20 97 32 6 187 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Strongylocentrotus purpuratus
P55782 6.45e-20 97 28 11 293 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Gadus morhua
Q7V3C8 7.18e-20 97 27 1 197 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q4JQH7 7.69e-20 97 28 14 333 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Tetraodon nigroviridis
Q5N060 8.57e-20 97 28 5 242 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4 2 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31LR3 8.57e-20 97 28 5 242 3 ndhD2 NAD(P)H-quinone oxidoreductase chain 4 2 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8K9X7 8.62e-20 97 26 11 334 3 nuoL NADH-quinone oxidoreductase subunit L Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q06GU6 9.8e-20 96 27 2 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Drimys granadensis
Q0ZIW8 1.05e-19 96 29 4 216 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Vitis vinifera
A6MMR3 1.08e-19 96 25 5 287 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Dioscorea elephantipes
Q36428 1.15e-19 96 27 9 327 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Locusta migratoria
Q9JX92 1.23e-19 97 28 19 405 3 nuoL NADH-quinone oxidoreductase subunit L Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q89AT6 1.36e-19 96 30 11 305 3 nuoL NADH-quinone oxidoreductase subunit L Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9K1B0 1.45e-19 97 28 16 364 3 nuoL NADH-quinone oxidoreductase subunit L Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A8G2F5 1.51e-19 96 23 5 325 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain MIT 9215)
P48176 1.61e-19 96 27 15 363 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Oncorhynchus mykiss
A2BNU4 1.61e-19 96 23 5 325 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain AS9601)
B1X5V5 1.95e-19 96 26 15 399 3 ndhF2 NAD(P)H-quinone oxidoreductase subunit 5, organellar chromatophore 2 Paulinella chromatophora
A3PAL7 1.98e-19 95 26 1 197 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Prochlorococcus marinus (strain MIT 9301)
O79678 2.11e-19 96 29 12 315 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Pelomedusa subrufa
P92669 2.14e-19 96 25 18 465 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Osphranter robustus
P50366 2.33e-19 96 27 9 288 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Phytophthora infestans
A5GQH5 2.4e-19 95 27 2 188 3 ndhD NAD(P)H-quinone oxidoreductase chain 4 Synechococcus sp. (strain RCC307)
Q2L955 2.97e-19 95 28 4 216 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Gossypium hirsutum
A0ZZ85 2.97e-19 95 28 4 216 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Gossypium barbadense
B1A984 3.19e-19 95 25 5 273 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Carica papaya
A1AVS5 3.47e-19 94 26 14 411 3 nuoN NADH-quinone oxidoreductase subunit N Ruthia magnifica subsp. Calyptogena magnifica
A4G631 3.99e-19 94 23 12 410 3 nuoN NADH-quinone oxidoreductase subunit N Herminiimonas arsenicoxydans
A4QKF7 4.48e-19 94 29 3 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Barbarea verna
Q9M3J0 4.81e-19 94 23 5 310 2 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Spinacia oleracea
A9RAH0 5.24e-19 94 23 13 432 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q0H8X6 8.06e-19 93 20 5 334 3 ND4 NADH-ubiquinone oxidoreductase chain 4 Ustilago maydis (strain 521 / FGSC 9021)
P26288 8.21e-19 93 27 3 212 1 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Arabidopsis thaliana
Q34947 8.77e-19 94 29 9 290 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Lumbricus terrestris
O03174 1.04e-18 94 26 13 340 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Latimeria chalumnae
O21047 1.07e-18 93 26 3 234 3 nad4 NADH-ubiquinone oxidoreductase chain 4 Dictyostelium discoideum
Q95917 1.09e-18 92 25 8 351 3 MT-ND4 NADH-ubiquinone oxidoreductase chain 4 Polypterus ornatipinnis
A4QKY4 1.35e-18 93 28 3 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Crucihimalaya wallichii
A4QLY5 1.43e-18 92 28 3 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Nasturtium officinale
A4QKP5 1.72e-18 92 28 3 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Capsella bursa-pastoris
A4QLF9 1.88e-18 92 29 3 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Lepidium virginicum
Q49KU8 2.18e-18 92 23 3 300 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Eucalyptus globulus subsp. globulus
B0TH87 2.6e-18 92 25 10 343 3 nuoN NADH-quinone oxidoreductase subunit N Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
P12776 2.6e-18 92 30 6 187 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Paracentrotus lividus
Q9MIY0 3.36e-18 92 28 10 253 3 mt-nd5 NADH-ubiquinone oxidoreductase chain 5 Danio rerio
A4QK70 3.57e-18 91 29 3 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Arabis hirsuta
O47430 4.25e-18 92 28 11 298 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Branchiostoma floridae
A6MM87 4.28e-18 91 29 4 216 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Buxus microphylla
B2IHV3 5.24e-18 90 24 7 340 3 nuoN NADH-quinone oxidoreductase subunit N Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A4QJY2 5.51e-18 91 28 3 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Olimarabidopsis pumila
A6LXP5 6.3e-18 90 22 11 406 3 nuoN NADH-quinone oxidoreductase subunit N Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q2RJT7 7.78e-18 90 23 12 436 3 nuoN NADH-quinone oxidoreductase subunit N Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9RUA0 7.97e-18 90 28 10 308 3 nuoN NADH-quinone oxidoreductase subunit N Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q95918 8.57e-18 91 27 11 294 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Polypterus ornatipinnis
Q31HE7 9.16e-18 90 22 14 416 3 nuoN NADH-quinone oxidoreductase subunit N Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A4QL71 1.02e-17 90 28 3 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Draba nemorosa
Q1DDD3 1.27e-17 90 26 15 377 3 nuoN NADH-quinone oxidoreductase subunit N Myxococcus xanthus (strain DK1622)
Q9ZYM7 1.39e-17 90 25 10 338 3 ND5 NADH-ubiquinone oxidoreductase chain 5 Rhipicephalus sanguineus
Q56227 1.84e-17 90 27 9 318 1 nqo12 NADH-quinone oxidoreductase subunit 12 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
B3QY38 1.95e-17 89 27 12 355 3 nuoN2 NADH-quinone oxidoreductase subunit N 2 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q35543 2.2e-17 89 25 14 378 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Petromyzon marinus
F1SVL2 2.37e-17 89 24 8 356 1 fpoN F(420)H(2) dehydrogenase subunit N Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9G2W8 2.76e-17 89 32 8 199 3 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 Myxine glutinosa
Q576B5 3.13e-17 88 26 7 287 3 MT-ND4 NADH-ubiquinone oxidoreductase chain 4 Bos indicus
Q598S9 3.95e-17 88 25 8 301 3 MT-ND4 NADH-ubiquinone oxidoreductase chain 4 Caperea marginata
P03910 4.44e-17 88 26 7 287 1 MT-ND4 NADH-ubiquinone oxidoreductase chain 4 Bos taurus
Q4VZL8 4.44e-17 88 28 4 216 2 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Cucumis sativus
Q19V60 4.97e-17 89 24 16 437 3 ndhF NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic Chlorokybus atmophyticus
P0C325 6.34e-17 87 23 4 310 2 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Oryza sativa subsp. japonica
P0C324 6.34e-17 87 23 4 310 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Oryza sativa subsp. indica
P0C323 6.34e-17 87 23 4 310 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Oryza sativa
Q6ENA7 6.34e-17 87 23 4 310 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Oryza nivara
P15581 6.6e-17 87 23 9 368 3 ND4 NADH-ubiquinone oxidoreductase chain 4 Paramecium tetraurelia
A4QLP7 6.62e-17 87 28 3 203 3 ndhD NAD(P)H-quinone oxidoreductase chain 4, chloroplastic Lobularia maritima

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12495
Feature type CDS
Gene hyfB
Product hydrogenase 4 subunit B
Location 2770185 - 2772200 (strand: -1)
Length 2016 (nucleotides) / 671 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_866
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00361 Proton-conducting membrane transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0651 Energy production and conversion (C)
Inorganic ion transport and metabolism (P)
CP Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12137 hydrogenase-4 component B [EC:1.-.-.-] - -

Protein Sequence

MEPLQLLMWSIILYVVGGVIALFLKKQEGLAILISGISAIIGGVLGVLSALPVILNGETISFAMAGPFDFAAFVVRMDMLGAFMVFVISLLVTVCALYSLSYVQEYKGRGAWSMGFFMNLFIASMVGLIVMDNAFYFIILFEMMSLASWFLVIADQDDESIHAGLLYFFIAHAGSVLIMIAFFLMWRESGSLDFDSFRQLSLSPAMASVVFLLGFFGFGAKAGMLPLHSWLPKAHPAAPSHASALMSGVMVKIGIFGIIKVGIDLLGASQMWWGIVVLAFGAVSSVLGVMYALAEHDLKRLLAWHTVENIGIILMGVGVGMVGMATDHPVIAALGLLGALYHLLNHAVFKGLLFLGAGAIINQIHTRDMDKMGGLAKLMPYTATAFLIGCMAISALPPLNGFVSEWYTYQSLFTMSYDGNFVMRLSGPIAIIMLAITGALAAMCFVKVYGVSFCGGPRSEQATKAKEVPLPMTIAMGLLALFCVVLGVGAAFVAPIIANIAMSLSETSALTVTQGAILVPDSASQAMFSPALTFILLIALPLIPFLIYLGLKGGQPAFRRKGNPWACGYVWEKDMAVSAGGFTQALRSMFAPLYRMRKQLDPSPWLSRGFNKTQRGAEKVEPFWDESIIYPLVRGIQRFAKRIQCLQGGDFRLYCLYVVAALVILLLVIAA

Flanking regions ( +/- flanking 50bp)

TATGACAAGTCTTGATGATCTATCTACGTTGACACAGGAGCGCAAGTAATATGGAACCTCTTCAGTTACTGATGTGGTCAATCATCCTGTATGTTGTTGGTGGCGTTATTGCACTGTTTTTAAAGAAACAGGAAGGATTGGCAATCCTAATATCGGGGATCAGCGCAATCATCGGTGGTGTATTAGGTGTTTTAAGCGCATTACCAGTTATTTTAAATGGTGAAACAATCAGTTTTGCTATGGCTGGGCCATTTGATTTCGCCGCTTTTGTGGTGCGTATGGATATGCTTGGCGCCTTTATGGTGTTTGTCATTTCTTTACTCGTCACTGTTTGTGCGTTGTATTCACTCTCTTATGTTCAAGAATACAAAGGTCGCGGCGCATGGAGTATGGGATTTTTTATGAATCTCTTTATTGCTTCCATGGTAGGACTGATTGTTATGGATAATGCGTTTTACTTTATTATCCTATTTGAAATGATGTCGTTAGCATCTTGGTTCTTAGTCATCGCTGACCAAGATGACGAATCTATCCACGCCGGTTTACTCTACTTCTTTATCGCTCACGCAGGCTCTGTGCTAATCATGATAGCCTTCTTCTTAATGTGGCGTGAAAGCGGTAGCCTTGATTTTGATTCATTCCGTCAACTTTCTCTTTCCCCTGCAATGGCTTCTGTGGTGTTCTTACTGGGCTTCTTCGGATTTGGTGCCAAAGCCGGTATGTTGCCATTACACAGTTGGTTGCCAAAAGCGCACCCCGCAGCACCCTCTCACGCTTCAGCATTAATGTCTGGGGTGATGGTGAAAATTGGTATTTTTGGCATCATCAAAGTAGGCATTGATTTATTAGGTGCTTCACAAATGTGGTGGGGAATTGTCGTTCTCGCATTCGGTGCTGTCTCTTCTGTATTAGGGGTTATGTACGCATTAGCAGAGCACGATTTAAAACGTCTCCTTGCATGGCACACCGTTGAAAATATCGGCATCATCTTGATGGGCGTGGGAGTTGGCATGGTAGGTATGGCAACCGATCATCCAGTGATTGCCGCTCTCGGTCTGCTTGGTGCGTTATACCACTTATTAAATCACGCGGTATTTAAAGGATTATTGTTCTTAGGTGCCGGAGCCATTATTAATCAAATTCACACTCGTGATATGGATAAGATGGGTGGATTAGCCAAACTAATGCCTTACACTGCAACGGCATTCTTAATTGGTTGTATGGCAATTTCAGCATTACCGCCATTAAATGGTTTTGTGAGTGAGTGGTATACTTATCAATCACTATTTACGATGAGTTACGATGGTAACTTTGTCATGCGCTTAAGTGGTCCTATTGCCATTATTATGTTGGCAATTACCGGGGCATTAGCGGCCATGTGTTTCGTCAAAGTTTATGGCGTCAGTTTTTGCGGTGGCCCACGTAGTGAGCAAGCGACTAAAGCTAAAGAAGTACCGTTGCCAATGACCATTGCTATGGGGTTATTAGCACTTTTCTGTGTTGTATTAGGTGTGGGTGCGGCTTTTGTTGCGCCAATTATTGCCAATATTGCAATGTCACTTAGCGAAACCAGTGCATTAACAGTGACTCAAGGTGCGATATTAGTCCCTGATAGTGCATCACAAGCGATGTTCTCTCCTGCCTTAACATTTATTTTATTAATCGCCTTACCACTAATTCCATTCTTAATTTATCTCGGCTTAAAAGGTGGTCAACCTGCATTTCGCCGTAAAGGTAATCCATGGGCTTGTGGTTATGTCTGGGAAAAAGACATGGCGGTGTCCGCTGGGGGCTTTACTCAAGCACTACGTAGTATGTTTGCACCACTTTATCGTATGCGTAAACAGCTTGATCCATCACCTTGGCTTTCACGTGGCTTTAATAAAACACAGCGCGGTGCTGAAAAGGTCGAACCATTCTGGGATGAAAGCATTATTTATCCATTGGTTCGTGGTATCCAACGTTTTGCTAAACGTATCCAATGCCTACAAGGCGGCGATTTCAGACTCTATTGTCTGTACGTGGTGGCAGCGCTGGTCATCTTGCTTTTAGTTATCGCAGCGTAAGGAGAGGGAATGATGACTTTCCAAGAAACACCTTCGTTTATGATGGGAAT