Homologs in group_1225

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06685 FBDBKF_06685 75.8 Morganella morganii S1 dppB ABC-type dipeptide/oligopeptide/nickel transport system, permease component
EHELCC_09730 EHELCC_09730 75.8 Morganella morganii S2 dppB ABC-type dipeptide/oligopeptide/nickel transport system, permease component
NLDBIP_10110 NLDBIP_10110 75.8 Morganella morganii S4 dppB ABC-type dipeptide/oligopeptide/nickel transport system, permease component
LHKJJB_07645 LHKJJB_07645 75.8 Morganella morganii S3 dppB ABC-type dipeptide/oligopeptide/nickel transport system, permease component
HKOGLL_07195 HKOGLL_07195 75.8 Morganella morganii S5 dppB ABC-type dipeptide/oligopeptide/nickel transport system, permease component
F4V73_RS15255 F4V73_RS15255 76.1 Morganella psychrotolerans - ABC transporter permease

Distribution of the homologs in the orthogroup group_1225

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1225

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q3Z3V2 7.23e-45 158 31 3 319 3 gsiC Glutathione transport system permease protein GsiC Shigella sonnei (strain Ss046)
Q8X6V7 8.39e-45 158 31 3 319 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O157:H7
Q32IB7 1.52e-44 157 31 3 319 3 gsiC Glutathione transport system permease protein GsiC Shigella dysenteriae serotype 1 (strain Sd197)
Q1RE94 1.52e-44 157 31 3 319 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain UTI89 / UPEC)
P75798 1.52e-44 157 31 3 319 1 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain K12)
Q0TJL7 1.52e-44 157 31 3 319 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A970 1.52e-44 157 31 3 319 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O1:K1 / APEC
Q0T6D1 5.05e-44 155 30 3 319 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri serotype 5b (strain 8401)
Q83S26 5.61e-44 155 30 3 319 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri
Q8FJK9 1.38e-43 154 30 3 319 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8Z862 2.11e-43 154 31 2 310 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhi
Q57RB0 2.11e-43 154 31 2 310 3 gsiC Glutathione transport system permease protein GsiC Salmonella choleraesuis (strain SC-B67)
Q323W3 2.73e-43 154 30 3 319 3 gsiC Glutathione transport system permease protein GsiC Shigella boydii serotype 4 (strain Sb227)
Q5PGP5 2.94e-43 154 31 2 311 3 gsiC Glutathione transport system permease protein GsiC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZQM2 3.87e-43 153 31 2 310 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8YBN9 4.74e-40 145 32 3 281 3 BMEII0860 Putative peptide permease protein BMEII0860 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A5VU90 4.74e-40 145 32 3 281 3 BOV_A0351 Putative peptide permease protein BOV_A0351 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q6D3B1 7.86e-40 145 32 3 315 3 gsiC Glutathione transport system permease protein GsiC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P42062 5.15e-39 143 27 4 312 3 appB Oligopeptide transport system permease protein AppB Bacillus subtilis (strain 168)
Q8FWN8 1.79e-38 142 32 3 281 3 BRA0408 Putative peptide permease protein BRA0408/BS1330_II0405 Brucella suis biovar 1 (strain 1330)
A0A0H2ZGW7 8.26e-35 132 30 4 315 1 dppB Di/tripeptide transport system permease protein DppB Pseudomonas aeruginosa (strain UCBPP-PA14)
Q53191 2.43e-34 130 29 2 273 3 NGR_a01430 Probable peptide ABC transporter permease protein y4tP Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8YDG7 5.74e-34 129 31 3 282 3 BMEII0209 Putative peptide transport system permease protein BMEII0209 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK1 7.14e-34 129 31 3 282 3 BAB2_1050 Putative peptide transport system permease protein BAB2_1050 Brucella abortus (strain 2308)
Q8VQK4 7.14e-34 129 31 3 282 3 BruAb2_1031 Putative peptide transport system permease protein BruAb2_1031 Brucella abortus biovar 1 (strain 9-941)
Q8FUX0 1.04e-33 129 31 3 282 3 BRA1092 Putative peptide transport system permease protein BRA1092/BS1330_II1084 Brucella suis biovar 1 (strain 1330)
A2RI75 4.63e-33 127 32 4 258 1 dppB Dipeptide transport system permease protein DppB Lactococcus lactis subsp. cremoris (strain MG1363)
P33591 1.26e-32 126 27 4 323 1 nikB Nickel transport system permease protein NikB Escherichia coli (strain K12)
P0AEF8 1.58e-32 126 27 5 335 1 dppB Dipeptide transport system permease protein DppB Escherichia coli (strain K12)
P0AEF9 1.58e-32 126 27 5 335 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG0 1.58e-32 126 27 5 335 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O157:H7
Q5HG38 3.49e-30 120 23 1 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain COL)
Q2FYQ5 3.49e-30 120 23 1 311 1 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH55 3.49e-30 120 23 1 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain USA300)
Q8NWT4 3.95e-30 119 23 1 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MW2)
Q6G9H8 3.95e-30 119 23 1 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MSSA476)
Q7A5Q6 3.99e-30 119 23 1 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain N315)
Q99UA0 3.99e-30 119 23 1 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain Mu50 / ATCC 700699)
P94311 1.45e-28 115 27 4 327 3 dppB Dipeptide transport system permease protein DppB Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P45096 2.5e-28 115 27 4 328 3 dppB Dipeptide transport system permease protein DppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2YXY7 3.35e-28 114 23 1 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain bovine RF122 / ET3-1)
P26903 7.01e-28 113 27 5 302 2 dppB Dipeptide transport system permease protein DppB Bacillus subtilis (strain 168)
Q6GH25 7.14e-28 114 23 1 311 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MRSA252)
P0AFH5 9.67e-28 113 28 6 315 3 oppB Oligopeptide transport system permease protein OppB Shigella flexneri
P0AFH2 9.67e-28 113 28 6 315 1 oppB Oligopeptide transport system permease protein OppB Escherichia coli (strain K12)
P0AFH3 9.67e-28 113 28 6 315 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFH4 9.67e-28 113 28 6 315 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O157:H7
A0A0H3K104 1.06e-27 113 27 5 269 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain Mu50 / ATCC 700699)
P77308 1.54e-27 113 28 5 307 1 ddpB Probable D,D-dipeptide transport system permease protein DdpB Escherichia coli (strain K12)
P08005 2.46e-27 112 29 8 316 1 oppB Oligopeptide transport system permease protein OppB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2FVE8 3.03e-27 111 26 5 269 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain NCTC 8325 / PS 47)
P0A4N8 7.4e-26 108 26 3 273 3 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N7 7.4e-26 108 26 3 273 1 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. lactis (strain IL1403)
P45054 1.57e-25 107 29 7 316 3 oppB Oligopeptide transport system permease protein OppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P24138 2.3e-25 106 28 5 300 1 oppB Oligopeptide transport system permease protein OppB Bacillus subtilis (strain 168)
P66967 3.46e-25 106 29 6 295 3 BQ2027_MB1314C Putative peptide transport permease protein Mb1314c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ7 3.46e-25 106 29 6 295 1 Rv1283c Putative peptide transport permease protein Rv1283c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ6 3.46e-25 106 29 6 295 3 MT1320 Putative peptide transport permease protein MT1320 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0AGH3 2.18e-23 101 27 3 269 1 sapB Putrescine export system permease protein SapB Escherichia coli (strain K12)
P0AGH4 2.18e-23 101 27 3 269 3 sapB Peptide transport system permease protein SapB Escherichia coli O157:H7
P0A2J3 5.62e-18 86 27 3 269 2 sapB Peptide transport system permease protein SapB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J4 5.62e-18 86 27 3 269 3 sapB Peptide transport system permease protein SapB Salmonella typhi
P75554 2.58e-16 82 23 5 277 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A9CKL3 4.16e-14 75 25 11 343 3 yejB Peptidoglycan transport system permease protein YejB Agrobacterium fabrum (strain C58 / ATCC 33970)
P47323 5.86e-14 75 22 7 287 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P0A4M8 9.28e-11 66 26 5 190 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M7 9.28e-11 66 26 5 190 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P45286 1.54e-09 61 21 4 247 3 sapB Peptide transport system permease protein SapB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AFU0 7.09e-09 60 23 6 271 1 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli (strain K12)
P0AFU1 7.09e-09 60 23 6 271 3 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli O157:H7
P94312 0.000866 44 23 4 162 3 dppC Dipeptide transport system permease protein DppC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12435
Feature type CDS
Gene -
Product ABC transporter permease
Location 2757190 - 2758173 (strand: -1)
Length 984 (nucleotides) / 327 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1225
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF19300 Binding-prot-dependent transport system membrane comp, N-term

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0601 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02033 peptide/nickel transport system permease protein Quorum sensing -

Protein Sequence

MDLSVIRQTVGFFLRLLCLLLVTTAGVFILLSFSPIDPIKAYIGSDLLNVPPEQYPLIAARWGMDQPLWMRFWLWFSQIIQGDFGYSILYNMPVIDVIRQRAGPSFILLFSAWLFSGVIGVLMGLVAGRYLNRWPDRIISTLSYLLASLPTFWVGLLLLSLFSVTLHWAPICCAWPMGSSAEAATLGQRFSHLILPMIALGLLGTGNIALHTRAKVAEVMGSEFIHFAKAQGDKGWAMMLFHVLRHAITPALCLQFASIGELLGGSLLAEKVFAYPGLGQATVDAGLRGDIPLLMGIVVFSTILIFFGNSISNYLLRRINKGILRDL

Flanking regions ( +/- flanking 50bp)

CCGGAAATTCACGGTTCATGGTCATTATTAAATAGCGTAGATACTTGGAAGTGGACTTGTCAGTAATACGTCAAACAGTAGGATTTTTCCTGCGATTATTATGCCTGCTGCTGGTAACAACAGCAGGTGTTTTTATTTTATTAAGTTTTTCGCCGATTGATCCGATCAAGGCCTATATCGGTAGTGATTTGCTAAACGTTCCGCCTGAGCAGTATCCGCTGATAGCGGCTCGCTGGGGGATGGATCAGCCACTATGGATGCGTTTTTGGCTCTGGTTTAGCCAGATAATCCAAGGTGATTTTGGTTATTCCATACTCTATAACATGCCGGTTATTGATGTTATTCGCCAACGGGCAGGGCCTTCGTTTATCCTGCTTTTTTCTGCGTGGCTATTTTCAGGTGTAATAGGGGTGTTAATGGGGTTAGTGGCAGGACGATATCTTAATCGTTGGCCTGATAGGATCATCTCAACCCTCTCTTATTTGCTGGCCTCATTACCGACTTTTTGGGTTGGATTGCTGTTGTTATCGCTGTTTTCGGTAACGTTACACTGGGCACCTATTTGCTGTGCATGGCCGATGGGCAGTAGTGCTGAAGCAGCCACATTGGGCCAACGTTTTTCGCATCTTATTTTACCTATGATAGCGTTAGGATTATTAGGTACAGGTAATATCGCACTGCATACTCGCGCAAAAGTTGCTGAAGTGATGGGCAGTGAATTTATTCATTTTGCTAAAGCCCAAGGTGATAAAGGTTGGGCTATGATGCTTTTTCATGTTCTACGTCATGCCATTACTCCCGCACTTTGCTTACAGTTTGCATCAATTGGTGAATTGTTAGGTGGTTCATTATTGGCGGAGAAGGTTTTTGCTTATCCGGGATTAGGGCAAGCGACAGTAGATGCCGGATTGCGTGGGGATATCCCCCTATTAATGGGGATTGTTGTATTTAGCACAATTCTCATTTTCTTTGGAAACAGTATCTCTAACTACTTGTTACGACGAATTAATAAAGGAATTTTGCGCGACTTATGATTTACGATCCCAATAAGCCTTTATTTAGACTGCTATTTGTCTCAATCGTA