Homologs in group_72

Help

12 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18735 FBDBKF_18735 38.0 Morganella morganii S1 lexA LexA family transcriptional regulator
FBDBKF_19920 FBDBKF_19920 40.4 Morganella morganii S1 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
EHELCC_07695 EHELCC_07695 40.4 Morganella morganii S2 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
EHELCC_15310 EHELCC_15310 38.0 Morganella morganii S2 lexA LexA family transcriptional regulator
NLDBIP_08020 NLDBIP_08020 40.4 Morganella morganii S4 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
NLDBIP_15840 NLDBIP_15840 38.0 Morganella morganii S4 lexA LexA family transcriptional regulator
LHKJJB_06245 LHKJJB_06245 40.4 Morganella morganii S3 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
LHKJJB_16000 LHKJJB_16000 38.0 Morganella morganii S3 lexA LexA family transcriptional regulator
HKOGLL_15120 HKOGLL_15120 38.0 Morganella morganii S5 lexA LexA family transcriptional regulator
HKOGLL_19100 HKOGLL_19100 40.4 Morganella morganii S5 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
F4V73_RS02025 F4V73_RS02025 28.0 Morganella psychrotolerans - S24 family peptidase
F4V73_RS06245 F4V73_RS06245 34.5 Morganella psychrotolerans - S24 family peptidase

Distribution of the homologs in the orthogroup group_72

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_72

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q79S39 1.38e-159 442 100 0 215 4 s087 HTH-type transcriptional regulator for conjugative element SXT Vibrio cholerae
Q8GJK1 1.38e-159 442 100 0 215 4 None HTH-type transcriptional regulator for conjugative element pMERPH Shewanella putrefaciens
Q79RI9 1.38e-159 442 100 0 215 4 ORF-96 HTH-type transcriptional regulator for conjugative element R391 Providencia rettgeri
P69202 2.14e-43 147 41 4 212 1 C2 Repressor protein C2 Salmonella phage P22
P03034 2.01e-31 117 34 6 212 1 cI Repressor protein cI Escherichia phage lambda
P75974 3.8e-23 95 43 2 125 4 cohE Prophage repressor CohE Escherichia coli (strain K12)
Q83BT6 5.42e-19 84 28 5 225 1 CBU_1416 Uncharacterized HTH-type transcriptional regulator CBU_1416 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P16117 5.48e-13 65 39 2 97 1 CI Repressor protein CI (Fragment) Enterobacteria phage 434
Q37906 5.78e-12 65 30 3 155 4 CI Repressor protein CI Pseudomonas phage D3
P03036 9.21e-09 53 45 0 64 1 CRO Regulatory protein cro Enterobacteria phage 434
Q605V8 6.65e-07 51 32 6 137 3 lexA LexA repressor Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A0L9E2 7.16e-07 51 37 5 137 3 lexA LexA repressor Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q314F2 1.03e-06 50 36 4 113 3 lexA LexA repressor Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A9B5H8 2.36e-06 50 27 4 133 3 lexA LexA repressor Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q12ID6 5.16e-06 48 27 11 226 3 lexA LexA repressor Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q47587 5.29e-06 49 37 0 64 4 rdgA HTH-type transcriptional regulator RdgA Pectobacterium carotovorum subsp. carotovorum
B3GXZ4 1.22e-05 47 30 9 195 3 lexA LexA repressor Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q06553 1.24e-05 48 35 0 64 2 prtR HTH-type transcriptional regulator PrtR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B0BQ48 1.33e-05 47 30 11 215 3 lexA LexA repressor Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N1B4 1.33e-05 47 30 11 215 3 lexA LexA repressor Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8JA57 1.59e-05 47 31 7 157 3 lexA LexA repressor Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A7HC61 3.67e-05 46 31 6 130 3 lexA LexA repressor Anaeromyxobacter sp. (strain Fw109-5)
A1W897 5.1e-05 46 28 5 136 3 lexA LexA repressor Acidovorax sp. (strain JS42)
B9MI78 5.1e-05 46 28 5 136 3 lexA LexA repressor Acidovorax ebreus (strain TPSY)
Q3ACC4 0.000105 45 34 5 136 3 lexA LexA repressor Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B8F317 0.000126 45 29 9 205 3 lexA LexA repressor Glaesserella parasuis serovar 5 (strain SH0165)
Q2IIJ0 0.000167 44 30 6 130 3 lexA LexA repressor Anaeromyxobacter dehalogenans (strain 2CP-C)
B4UCX8 0.000179 44 30 6 130 3 lexA LexA repressor Anaeromyxobacter sp. (strain K)
P61609 0.000208 44 33 4 112 3 lexA2 LexA repressor 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B0SPA2 0.000236 44 33 5 123 3 lexA LexA repressor Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SFV4 0.000236 44 33 5 123 3 lexA LexA repressor Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B0TNT3 0.000326 43 26 11 239 3 lexA LexA repressor Shewanella halifaxensis (strain HAW-EB4)
P15238 0.000348 43 36 0 57 1 C Repressor protein C Rhizobium phage 16-3
Q49848 0.000351 43 32 5 127 3 lexA LexA repressor Mycobacterium leprae (strain TN)
B8ZQU5 0.000351 43 32 5 127 3 lexA LexA repressor Mycobacterium leprae (strain Br4923)
Q39VQ1 0.00051 43 32 5 127 3 lexA LexA repressor Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B8FIX5 0.000662 42 30 5 125 3 lexA LexA repressor Desulfatibacillum aliphaticivorans
Q9PH24 0.000767 42 37 2 78 3 lexA LexA repressor Xylella fastidiosa (strain 9a5c)
Q053A1 0.000785 42 32 5 124 3 lexA LexA repressor Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RH1 0.000785 42 32 5 124 3 lexA LexA repressor Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B8CUX0 0.000786 42 26 10 226 3 lexA LexA repressor Shewanella piezotolerans (strain WP3 / JCM 13877)
Q8F663 0.000839 42 31 5 124 3 lexA LexA repressor Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P61611 0.000839 42 31 5 124 3 lexA LexA repressor Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B0U1K7 0.000851 42 37 2 78 3 lexA LexA repressor Xylella fastidiosa (strain M12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11985
Feature type CDS
Gene -
Product LexA family transcriptional regulator
Location 2651345 - 2651992 (strand: -1)
Length 648 (nucleotides) / 215 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_72
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF00717 Peptidase S24-like
PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1974 Transcription (K)
Signal transduction mechanisms (T)		 KT SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)

Protein Sequence

MKTLSERLNHALQLTGVTQSELARRIGIKQQSISQICSGKSARSRYTMQIAEALRVNAHWLATGDGEIGLGVGNVEVGPDIKGRIPLINWVQAGDWTEIAEGFAHEDAEEWREVTGKAHEGCFALRVKGDSMENPSGKKSIPEGAVIVVDPELPYSSGSLVVARLDDSKEATFKQLVIDGEQKYLKPLNPQYPAIPINGNCTIIGVVRQAIIDFW

Flanking regions ( +/- flanking 50bp)

ACAGTTAAAATTGTTGAAAGACTACAGTTTTATTTGTAGAATGCGGGCTTATGAAAACTTTATCCGAACGACTAAACCATGCCTTGCAGCTTACTGGGGTAACTCAGTCTGAGTTGGCTCGTCGCATTGGTATCAAACAGCAGTCGATCAGCCAGATTTGCTCTGGTAAATCGGCTAGGTCTCGTTACACCATGCAGATCGCGGAGGCGCTTCGCGTGAATGCTCATTGGCTCGCCACAGGTGATGGCGAGATTGGCTTGGGGGTCGGTAATGTAGAAGTCGGGCCTGATATTAAGGGAAGAATTCCTCTCATTAACTGGGTTCAGGCCGGTGATTGGACTGAAATAGCGGAGGGATTTGCCCATGAAGATGCTGAGGAGTGGCGTGAAGTCACTGGGAAAGCACATGAGGGTTGTTTCGCACTTCGCGTAAAAGGCGACAGTATGGAAAATCCAAGCGGAAAAAAATCCATACCTGAGGGGGCAGTGATCGTTGTTGATCCTGAGTTACCTTACTCTTCAGGTTCATTGGTTGTTGCGCGTTTGGATGATTCGAAAGAAGCAACCTTTAAGCAGTTAGTTATTGATGGTGAACAGAAGTACCTAAAACCTTTGAACCCGCAATACCCTGCAATACCGATCAACGGCAACTGCACCATCATCGGTGTAGTACGACAAGCTATCATCGATTTCTGGTAGCGAAGGAATTTGTGGTTTAGCCACAGTTGTTCATGAGCTGAAGAAGCAAC