Homologs in group_2437

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19920 FBDBKF_19920 59.8 Morganella morganii S1 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
EHELCC_07695 EHELCC_07695 59.8 Morganella morganii S2 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
NLDBIP_08020 NLDBIP_08020 59.8 Morganella morganii S4 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
LHKJJB_06245 LHKJJB_06245 59.8 Morganella morganii S3 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
HKOGLL_19100 HKOGLL_19100 59.8 Morganella morganii S5 lexA SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)
F4V73_RS02025 F4V73_RS02025 28.6 Morganella psychrotolerans - S24 family peptidase

Distribution of the homologs in the orthogroup group_2437

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2437

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P69202 6.59e-54 175 46 1 191 1 C2 Repressor protein C2 Salmonella phage P22
Q79S39 1.19e-37 133 35 5 220 4 s087 HTH-type transcriptional regulator for conjugative element SXT Vibrio cholerae
Q8GJK1 1.19e-37 133 35 5 220 4 None HTH-type transcriptional regulator for conjugative element pMERPH Shewanella putrefaciens
Q79RI9 1.19e-37 133 35 5 220 4 ORF-96 HTH-type transcriptional regulator for conjugative element R391 Providencia rettgeri
P03034 5.93e-27 106 42 2 126 1 cI Repressor protein cI Escherichia phage lambda
P75974 2.22e-19 86 41 2 124 4 cohE Prophage repressor CohE Escherichia coli (strain K12)
P18680 1.95e-17 81 53 2 76 4 CI-HTT 26 kDa repressor protein Escherichia phage HK022
Q83BT6 1.98e-08 56 21 3 176 1 CBU_1416 Uncharacterized HTH-type transcriptional regulator CBU_1416 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P16117 1.04e-06 48 31 4 105 1 CI Repressor protein CI (Fragment) Enterobacteria phage 434
A8F429 1.83e-06 50 34 5 127 3 lexA LexA repressor Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q28R71 1.88e-06 50 32 4 114 3 lexA LexA repressor Jannaschia sp. (strain CCS1)
A7INJ8 5e-06 49 33 6 132 3 lexA LexA repressor Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A0AIA3 1.63e-05 47 32 5 125 3 lexA LexA repressor Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P61609 1.68e-05 47 33 7 125 3 lexA2 LexA repressor 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q5LRH4 1.7e-05 47 28 6 149 3 lexA LexA repressor Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q92C51 1.93e-05 47 32 5 125 3 lexA LexA repressor Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B7GQ64 2.06e-05 47 36 4 95 3 lexA LexA repressor Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G4R6 2.1e-05 47 36 4 95 3 lexA LexA repressor Bifidobacterium longum (strain NCC 2705)
B3DQB4 2.1e-05 47 36 4 95 3 lexA LexA repressor Bifidobacterium longum (strain DJO10A)
A7HY01 2.57e-05 47 36 4 96 3 lexA LexA repressor Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B8EK86 2.63e-05 47 32 6 132 3 lexA LexA repressor Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A8I825 3.27e-05 47 33 6 130 3 lexA LexA repressor Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B1LUJ7 3.29e-05 47 33 3 95 3 lexA LexA repressor Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B6IST2 4.16e-05 46 32 3 95 3 lexA LexA repressor Rhodospirillum centenum (strain ATCC 51521 / SW)
Q5YP21 4.44e-05 46 30 7 159 3 lexA1 LexA repressor 1 Nocardia farcinica (strain IFM 10152)
B0UGH4 4.45e-05 46 28 5 151 3 lexA LexA repressor Methylobacterium sp. (strain 4-46)
A1A2G3 5.24e-05 46 37 4 95 3 lexA LexA repressor Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
B4RBX6 5.37e-05 46 34 4 96 3 lexA LexA repressor Phenylobacterium zucineum (strain HLK1)
P0DOW5 6.84e-05 45 31 4 122 1 lexA LexA repressor Verrucomicrobium spinosum (strain ATCC 43997 / DSM 4136 / JCM 18804 / IFAM 1439)
A1W897 7.04e-05 45 30 3 115 3 lexA LexA repressor Acidovorax sp. (strain JS42)
B9MI78 7.04e-05 45 30 3 115 3 lexA LexA repressor Acidovorax ebreus (strain TPSY)
Q47MY4 7.96e-05 46 39 4 96 3 lexA LexA repressor Thermobifida fusca (strain YX)
Q8G0F1 9.32e-05 45 34 4 96 3 lexA LexA repressor Brucella suis biovar 1 (strain 1330)
B0CGU2 9.32e-05 45 34 4 96 3 lexA LexA repressor Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQR8 9.32e-05 45 34 4 96 3 lexA LexA repressor Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
C0RJB4 9.32e-05 45 34 4 96 3 lexA LexA repressor Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5F7 9.32e-05 45 34 4 96 3 lexA LexA repressor Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CZ5 9.32e-05 45 34 4 96 3 lexA LexA repressor Brucella abortus biovar 1 (strain 9-941)
Q2YRR1 9.32e-05 45 34 4 96 3 lexA LexA repressor Brucella abortus (strain 2308)
B2S5Z4 9.32e-05 45 34 4 96 3 lexA LexA repressor Brucella abortus (strain S19)
B8IN87 9.4e-05 45 33 3 95 3 lexA LexA repressor Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A9B5H8 9.51e-05 45 30 2 92 3 lexA LexA repressor Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
C4L2T2 9.95e-05 45 32 5 124 3 lexA LexA repressor Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
P61608 0.000104 45 31 5 126 3 lexA1 LexA repressor 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A6X0K7 0.000108 45 31 6 132 3 lexA LexA repressor Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q98MD2 0.000111 45 31 6 130 3 lexA LexA repressor Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8YHG1 0.000132 45 33 4 96 3 lexA LexA repressor Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q163X5 0.000138 45 36 2 73 3 lexA LexA repressor Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A5GAQ4 0.000166 44 32 7 128 3 lexA LexA repressor Geotalea uraniireducens (strain Rf4)
Q11HT8 0.000183 45 31 6 130 3 lexA LexA repressor Chelativorans sp. (strain BNC1)
Q03WX0 0.000185 44 31 5 116 3 lexA LexA repressor Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q9KAD3 0.000222 44 28 6 125 3 lexA LexA repressor Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q895H6 0.000225 44 35 4 92 3 lexA LexA repressor Clostridium tetani (strain Massachusetts / E88)
A1TQ93 0.000268 44 33 5 118 3 lexA LexA repressor Paracidovorax citrulli (strain AAC00-1)
B9JEY4 0.000309 44 34 4 96 3 lexA LexA repressor Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A5N8J0 0.000313 43 28 5 131 3 lexA LexA repressor Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E1Z5 0.000313 43 28 5 131 3 lexA LexA repressor Clostridium kluyveri (strain NBRC 12016)
A2SGY5 0.000341 43 29 7 147 3 lexA LexA repressor Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q1GHJ8 0.000377 43 36 2 73 3 lexA LexA repressor Ruegeria sp. (strain TM1040)
Q6HFB0 0.000461 43 32 4 95 3 lexA LexA repressor Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q637D7 0.000461 43 32 4 95 3 lexA LexA repressor Bacillus cereus (strain ZK / E33L)
Q81A92 0.000461 43 32 4 95 3 lexA LexA repressor Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IUL2 0.000461 43 32 4 95 3 lexA LexA repressor Bacillus cereus (strain Q1)
P61606 0.000461 43 32 4 95 3 lexA LexA repressor Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JIC6 0.000461 43 32 4 95 3 lexA LexA repressor Bacillus cereus (strain AH820)
Q81Y06 0.000461 43 32 4 95 3 lexA LexA repressor Bacillus anthracis
A0RH75 0.000461 43 32 4 95 3 lexA LexA repressor Bacillus thuringiensis (strain Al Hakam)
A8YVS7 0.000464 43 33 5 99 3 lexA LexA repressor Lactobacillus helveticus (strain DPC 4571)
Q5WG03 0.000505 43 29 7 143 3 lexA LexA repressor Shouchella clausii (strain KSM-K16)
A9HJ64 0.00052 43 33 3 96 3 lexA LexA repressor Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q4FM55 0.000545 43 30 6 131 3 lexA LexA repressor Pelagibacter ubique (strain HTCC1062)
Q8KT78 0.000573 43 36 3 86 3 lexA LexA repressor Pseudomonas chlororaphis
B1YE71 0.000743 42 31 6 125 3 lexA LexA repressor Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q605V8 0.000768 42 30 2 75 3 lexA LexA repressor Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A9VPX5 0.00084 42 45 2 53 3 lexA LexA repressor Bacillus mycoides (strain KBAB4)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06245
Feature type CDS
Gene -
Product S24 family peptidase
Location 1306862 - 1307542 (strand: 1)
Length 681 (nucleotides) / 226 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2437
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF00717 Peptidase S24-like
PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1974 Transcription (K)
Signal transduction mechanisms (T)		 KT SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)

Protein Sequence

MVQAEKVRNSFAQRLALACKDAGLNEHGRGAAIVKAIGVSSKAVSKWLNGESLPRQDRMNDLAKFLGCDVVWLQHGSMAGFDNNVSQPKPYKPSPKYPVISLIQAGAWNDACEAYSLDQIDEWYESEVHVQGSAFWLKVEGDSMTAPMGTSIPDGSLVLVDTGRDAINGSLVIAKLTDSNEATFKKLIIDGSARFLKGLNPAWPMTPINGNCKIIGVVVQMMMRFV

Flanking regions ( +/- flanking 50bp)

ACATTATCTCTGTACTGAAAGTTATTTGCAAGGCGTTTATAATTGAACCTATGGTACAAGCTGAAAAAGTGCGGAATAGTTTTGCCCAGAGGCTAGCACTGGCCTGTAAAGATGCGGGGCTTAATGAACATGGAAGAGGCGCGGCGATAGTTAAAGCTATTGGCGTGTCGTCTAAAGCTGTCAGTAAGTGGCTTAATGGAGAATCGCTACCAAGACAAGATAGAATGAATGACCTAGCTAAGTTTTTGGGGTGCGATGTTGTTTGGTTGCAGCATGGGAGCATGGCGGGATTTGATAATAACGTCTCTCAACCTAAGCCATACAAGCCATCACCTAAATACCCTGTTATTAGCCTTATCCAGGCTGGGGCGTGGAATGACGCCTGTGAGGCATATTCACTTGATCAAATAGATGAGTGGTATGAATCAGAAGTTCATGTTCAAGGCTCTGCCTTTTGGCTGAAGGTTGAAGGCGATTCAATGACCGCTCCGATGGGAACTAGCATTCCCGATGGGTCGTTAGTGCTTGTTGATACAGGCAGAGATGCCATTAATGGAAGCTTAGTTATAGCTAAATTAACAGATTCTAATGAAGCGACATTTAAAAAACTGATAATTGACGGAAGCGCTAGATTTCTTAAGGGATTAAATCCTGCATGGCCAATGACGCCTATTAATGGCAACTGCAAAATTATCGGCGTGGTTGTGCAGATGATGATGCGGTTTGTTTGACAGCCTGACGACACGTTTTGAGGATAAAAAATGGCATTTAATGACATTGA