Homologs in group_1494

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09065 FBDBKF_09065 41.4 Morganella morganii S1 atoC DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains
EHELCC_10345 EHELCC_10345 41.4 Morganella morganii S2 atoC DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains
NLDBIP_10690 NLDBIP_10690 41.4 Morganella morganii S4 atoC DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains
LHKJJB_10665 LHKJJB_10665 41.4 Morganella morganii S3 atoC DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains
HKOGLL_13725 HKOGLL_13725 41.4 Morganella morganii S5 atoC DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains
F4V73_RS10880 F4V73_RS10880 40.9 Morganella psychrotolerans - sigma-54 dependent transcriptional regulator

Distribution of the homologs in the orthogroup group_1494

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1494

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06184 1.86e-84 267 37 4 402 3 pgtA Phosphoglycerate transport system transcriptional regulatory protein PgtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9HU19 7.18e-66 220 33 6 440 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P13632 7.58e-65 218 30 7 447 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P10046 2.97e-58 200 30 6 446 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
Q04849 2.96e-45 166 26 6 449 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q1RJS1 6.4e-44 162 27 10 460 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
Q68WH4 1.1e-43 162 27 11 459 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UL27 1.53e-42 159 27 13 463 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ZCY9 3.57e-42 158 26 11 459 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q9APD9 1.12e-40 153 29 10 444 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q92HC2 2.92e-39 150 27 11 458 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P14375 2.99e-39 149 28 7 438 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q8Z333 3.78e-39 149 28 8 442 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q8X613 4.27e-39 149 28 8 440 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P25852 7.95e-39 148 28 8 443 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q88RJ6 1.2e-38 147 28 7 440 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9I4N3 4.15e-37 144 29 7 361 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q00934 4.55e-37 143 28 11 450 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P03029 1.09e-36 142 27 9 462 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P28787 1.95e-36 142 26 12 476 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q88AQ2 2.45e-36 141 27 7 440 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P0AFU5 2.65e-36 141 25 6 443 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 2.65e-36 141 25 6 443 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
P0AFB8 3.05e-36 141 28 5 367 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 3.05e-36 141 28 5 367 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P41789 3.58e-36 141 28 5 367 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P10577 1.24e-35 140 26 11 496 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P23747 1.97e-35 139 26 5 367 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q04848 2.92e-35 139 28 9 419 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q06065 4.08e-34 135 26 9 455 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P09432 3.21e-33 133 25 6 453 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P45671 4.66e-31 127 25 9 483 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
Q87MX7 5.76e-30 124 24 5 357 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MM78 5.88e-30 124 24 5 357 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 5.88e-30 124 24 5 357 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
P10576 1.02e-29 123 25 8 486 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
P0C5S5 1.14e-29 123 23 5 357 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 1.14e-29 123 23 5 357 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q9KT84 3e-28 119 24 6 357 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P26408 1.28e-25 112 24 10 474 1 hupR1 Hydrogenase transcriptional regulatory protein HupR1 Rhodobacter capsulatus
P29267 9.37e-25 109 24 11 487 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P26047 1.21e-24 110 27 7 316 4 stc Signal-transduction and transcriptional-control protein Clostridium beijerinckii
P12627 1.43e-24 109 27 8 316 1 vnfA Nitrogen fixation protein VnfA Azotobacter vinelandii
P36219 2.02e-23 103 28 7 281 4 wtsA Pathogenicity locus probable regulatory protein WtsA Pantoea stewartii subsp. stewartii
P12626 2.98e-23 105 26 7 314 4 anfA Nitrogen fixation protein AnfA Azotobacter vinelandii
Q46802 9.44e-23 104 27 8 322 4 uacR Putative uric acid sigma-54-dependent transcriptional regulator UacR Escherichia coli (strain K12)
O25408 5.84e-22 100 21 6 369 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
P37930 8.62e-21 95 29 8 290 4 hrpR Pathogenicity locus probable regulatory protein HrpR Pseudomonas syringae pv. syringae
P44694 2e-20 94 28 2 221 1 tyrR HTH-type transcriptional regulatory protein TyrR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P30667 2.57e-20 97 30 7 239 1 nifA Nif-specific regulatory protein Azospirillum brasilense
P10958 4.12e-20 91 38 0 118 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
P54929 1.9e-19 94 29 7 239 4 nifA Nif-specific regulatory protein Azospirillum lipoferum
Q9KN48 2.02e-19 94 24 7 354 4 vasH Transcriptional regulator VasH Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A2D7 2.06e-19 94 24 7 307 3 tyrR HTH-type transcriptional regulatory protein TyrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D8 2.06e-19 94 24 7 307 3 tyrR HTH-type transcriptional regulatory protein TyrR Salmonella typhi
P0CL46 2.58e-19 94 28 7 310 1 fhlA Formate hydrogenlyase transcriptional activator Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P74839 2.65e-19 93 27 10 321 4 prpR Propionate catabolism operon regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P38022 2.84e-19 93 26 9 331 1 rocR Transcriptional activator RocR Bacillus subtilis (strain 168)
Q3K999 3.08e-19 92 30 4 215 3 sfnR Sigma54-dependent transcriptional regulator SfnR Pseudomonas fluorescens (strain Pf0-1)
E1WAA4 4.29e-19 93 27 8 311 3 fhlA Formate hydrogenlyase transcriptional activator Salmonella typhimurium (strain SL1344)
O54426 5.26e-19 92 23 8 329 3 tyrR HTH-type transcriptional regulatory protein TyrR Citrobacter braakii
P07604 1.37e-18 91 25 9 310 1 tyrR HTH-type transcriptional regulatory protein TyrR Escherichia coli (strain K12)
P19323 2.15e-18 91 28 7 310 1 fhlA Formate hydrogenlyase transcriptional activator FhlA Escherichia coli (strain K12)
P26316 2.75e-18 88 26 8 283 4 hrpS Pathogenicity locus probable regulatory protein HrpS Pseudomonas savastanoi pv. phaseolicola
O85057 4.34e-18 90 27 9 294 1 None Limonene hydroxylase Geobacillus stearothermophilus
Q845S7 4.67e-18 88 31 5 215 2 sfnR Sigma54-dependent transcriptional activator SfnR Pseudomonas putida
P77743 4.73e-18 89 28 10 311 1 prpR Propionate catabolism operon regulatory protein Escherichia coli (strain K12)
Q6D8R9 4.81e-18 89 24 5 326 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P31908 5.92e-18 89 23 11 478 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P55610 1.21e-17 88 30 9 295 4 NGR_a02110 Putative transcriptional regulatory protein y4pA Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9ZIB7 1.46e-17 88 24 8 322 1 tyrR HTH-type transcriptional regulatory protein TyrR Enterobacter agglomerans
P23221 1.5e-17 84 41 0 101 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3LWR6 1.84e-17 84 34 0 115 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 1.84e-17 84 34 0 115 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 1.84e-17 84 34 0 115 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8KR08 2.42e-17 84 36 0 101 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
P37931 3.53e-17 85 26 6 283 4 hrpS Pathogenicity locus probable regulatory protein HrpS Pseudomonas syringae pv. syringae
P26487 7.31e-17 82 41 0 102 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P71229 8.03e-17 86 30 4 214 1 hyfR DNA-binding transcriptional activator HyfR Escherichia coli (strain K12)
P03027 8.4e-17 85 27 10 308 1 nifA Nif-specific regulatory protein Klebsiella pneumoniae
P56266 9.28e-17 85 27 10 308 3 nifA Nif-specific regulatory protein Klebsiella oxytoca
B7UHC1 9.89e-17 85 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0TEH1 9.98e-17 85 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MZ04 9.98e-17 85 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O81 (strain ED1a)
Q8FEN6 1.03e-16 85 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7N6T9 1.06e-16 85 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q1R7Z1 1.11e-16 85 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain UTI89 / UPEC)
A1AEP9 1.11e-16 85 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O1:K1 / APEC
B7MKH8 1.11e-16 85 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O45:K1 (strain S88 / ExPEC)
B1LQ27 1.32e-16 85 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain SMS-3-5 / SECEC)
A6TCX4 1.34e-16 85 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7ZQD8 1.64e-16 85 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O139:H28 (strain E24377A / ETEC)
B6I695 2.22e-16 84 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain SE11)
Q3YYF5 2.36e-16 84 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella sonnei (strain Ss046)
A8A3I6 2.65e-16 84 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O9:H4 (strain HS)
B1IUX0 2.83e-16 84 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7LEC0 2.85e-16 84 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain 55989 / EAEC)
P28614 2.93e-16 84 27 10 323 1 acoR Acetoin catabolism regulatory protein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B7M9E6 2.93e-16 84 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O8 (strain IAI1)
Q31X73 2.99e-16 84 26 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella boydii serotype 4 (strain Sb227)
B7NSI9 4.61e-16 83 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5XVA2 7.28e-16 83 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Klebsiella pneumoniae (strain 342)
G3XCV0 8.34e-16 82 24 15 491 1 fleQ Transcriptional regulator FleQ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O87455 9.43e-16 82 25 4 253 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P37013 1.14e-15 82 25 3 227 1 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain K12)
B1XCN6 1.14e-15 82 25 3 227 2 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain K12 / DH10B)
C4ZYV4 1.14e-15 82 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain K12 / MC4100 / BW2952)
B5Z370 1.16e-15 82 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X854 1.16e-15 82 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O157:H7
P59402 1.19e-15 82 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella flexneri
Q0T1D4 1.19e-15 82 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella flexneri serotype 5b (strain 8401)
Q32CL9 1.19e-15 82 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella dysenteriae serotype 1 (strain Sd197)
P15940 2.05e-15 78 32 1 119 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P09133 2.32e-15 81 27 8 251 2 nifA Nif-specific regulatory protein Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P05407 2.95e-15 81 26 4 230 1 nifA Nif-specific regulatory protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P17899 3.89e-15 80 23 9 383 4 flbD Transcriptional regulatory protein FlbD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O31551 5.62e-15 80 24 9 318 2 acoR Acetoin dehydrogenase operon transcriptional activator AcoR Bacillus subtilis (strain 168)
B7LW25 5.93e-15 80 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8ANR6 6.18e-15 80 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9K4U8 6.34e-15 80 27 4 235 2 norR2 Nitric oxide reductase transcription regulator NorR2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A4STH5 9.25e-15 79 26 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aeromonas salmonicida (strain A449)
Q7MFY9 1.06e-14 79 25 3 235 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Vibrio vulnificus (strain YJ016)
P37344 1.25e-14 77 26 9 307 1 pspF Psp operon transcriptional activator Escherichia coli (strain K12)
C0PWN2 1.88e-14 78 25 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi C (strain RKS4594)
Q8D4F9 1.97e-14 78 25 3 235 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Vibrio vulnificus (strain CMCP6)
P54930 3.83e-14 77 28 4 232 4 nifA Nif-specific regulatory protein Enterobacter agglomerans
Q43965 5.48e-14 77 23 8 319 1 mopR Phenol regulator MopR Acinetobacter guillouiae
B4T3B0 5.79e-14 77 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella newport (strain SL254)
A9MFX7 6.11e-14 77 25 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q53206 6.48e-14 77 26 5 234 4 nifA Nif-specific regulatory protein Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B4TF23 6.81e-14 77 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella heidelberg (strain SL476)
A0KEJ0 7.09e-14 77 25 3 233 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B5FSZ0 7.72e-14 76 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella dublin (strain CT_02021853)
B5F363 7.72e-14 76 25 3 227 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella agona (strain SL483)
Q5PF20 7.93e-14 76 25 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZMJ8 8e-14 76 25 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TT16 8e-14 76 25 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella schwarzengrund (strain CVM19633)
Q8Z4C6 8.44e-14 76 25 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella typhi
A9N0D7 8.44e-14 76 25 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5QV88 8.44e-14 76 25 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella enteritidis PT4 (strain P125109)
Q57KT4 8.44e-14 76 25 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella choleraesuis (strain SC-B67)
B5RDG4 8.52e-14 76 25 5 231 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella gallinarum (strain 287/91 / NCTC 13346)
D5ARW9 1.83e-13 75 25 7 246 4 nifA1 Nif-specific regulatory protein Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0CY94 1.9e-13 75 25 7 246 4 nifA1 Nif-specific regulatory protein Rhodobacter capsulatus
P45512 3.07e-13 75 24 10 342 4 dhaR Glycerol metabolism operon regulatory protein Citrobacter freundii
P54529 3.65e-13 75 23 9 375 4 yqiR Putative sigma L-dependent transcriptional regulator YqiR Bacillus subtilis (strain 168)
A4WDR5 4.33e-13 74 24 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Enterobacter sp. (strain 638)
P09570 5.09e-13 74 24 4 230 4 nifA Nif-specific regulatory protein Azotobacter vinelandii
Q7CQM8 5.4e-13 71 34 0 100 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P24426 6.03e-13 73 26 7 234 4 nifA Nif-specific regulatory protein Rhizobium leguminosarum bv. trifolii
P76016 6.58e-13 74 24 10 377 1 dhaR PTS-dependent dihydroxyacetone kinase operon regulatory protein Escherichia coli (strain K12)
P37740 6.64e-13 70 36 2 106 3 dctR C4-dicarboxylate transport transcriptional regulatory protein DctR Rhodobacter capsulatus
Q9K4V0 8.71e-13 73 26 3 236 2 norR1 Nitric oxide reductase transcription regulator NorR1 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P27713 1.43e-12 72 26 7 234 4 nifA Nif-specific regulatory protein Herbaspirillum seropedicae
Q5E3W8 3.43e-12 71 25 3 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q01265 4.5e-12 70 25 5 237 4 None Uncharacterized protein in HyuA 5'region (Fragment) Pseudomonas sp. (strain NS671)
P54931 5.49e-12 71 24 5 234 4 nifA Nif-specific regulatory protein Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A8GG93 7.99e-12 70 24 5 244 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Serratia proteamaculans (strain 568)
O87940 8.44e-12 68 28 1 134 1 tdiR Transcriptional regulatory protein TdiR Thauera aromatica
P09828 1.29e-11 70 26 7 236 4 nifA Nif-specific regulatory protein Rhizobium leguminosarum
P54156 1.6e-11 68 25 11 282 2 yplP Putative sigma L-dependent transcriptional regulator YplP Bacillus subtilis (strain 168)
P0A4H5 1.81e-11 64 48 0 70 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 1.81e-11 64 48 0 70 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P51586 8.7e-11 62 31 2 118 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P06519 1.26e-10 67 23 7 320 4 xylR Transcriptional regulatory protein XylR Pseudomonas putida
P03028 1.96e-10 66 25 4 230 4 nifA Nif-specific regulatory protein Rhizobium meliloti (strain 1021)
A1TEL7 2.36e-10 63 27 2 145 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q56312 4.63e-10 60 31 1 116 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O78428 8.49e-10 62 33 1 103 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q9WY30 1.24e-09 63 30 1 117 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A8R3S7 1.49e-09 61 31 1 114 2 exaE Transcriptional activator protein ExaE Pseudomonas putida
Q9LYP5 4.68e-09 62 26 4 181 2 ARR21 Putative two-component response regulator ARR21 Arabidopsis thaliana
Q1B3X8 5.55e-09 59 29 0 103 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 5.55e-09 59 29 0 103 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 5.55e-09 59 29 0 103 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P42508 7.06e-09 58 28 0 108 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
A0PWB4 9.17e-09 59 27 0 103 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
A1KHB7 1.21e-08 58 27 0 103 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 1.21e-08 58 27 0 103 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q742C1 1.41e-08 58 27 0 101 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 1.41e-08 58 27 0 101 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
A0R3I8 1.91e-08 58 27 0 103 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WGM9 1.96e-08 58 27 0 103 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 1.96e-08 58 27 0 103 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 1.96e-08 58 27 0 103 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q9CD68 2.04e-08 58 27 0 101 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P24072 3.83e-08 55 38 0 67 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q53228 4.14e-08 56 29 0 108 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q7A1J1 6.33e-08 56 30 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 6.33e-08 56 30 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 6.33e-08 56 30 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 6.33e-08 56 30 1 103 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 6.33e-08 56 30 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 6.33e-08 56 30 1 103 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 6.33e-08 56 30 1 103 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 6.33e-08 56 30 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 6.33e-08 56 30 1 103 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 6.33e-08 56 30 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
Q9ZHD3 6.63e-08 56 31 4 133 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
O34903 8.14e-08 56 28 0 101 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q04942 9.47e-08 56 32 1 102 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P51358 9.87e-08 56 29 1 103 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
P48259 1.02e-07 56 30 1 103 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P45709 1.18e-07 53 33 1 113 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q1XDC9 1.24e-07 55 29 1 103 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
Q9TLQ4 1.42e-07 55 30 1 103 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
O05251 1.53e-07 55 27 2 122 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
P06628 1.66e-07 53 30 0 102 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
P28835 2.78e-07 54 31 1 103 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P50350 3.08e-07 54 34 1 110 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
P50351 3.08e-07 54 34 1 110 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q93CB8 3.33e-07 54 31 1 103 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q07783 3.6e-07 54 34 1 110 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q8CQ17 3.65e-07 54 28 1 103 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 3.65e-07 54 28 1 103 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P9WGM7 3.78e-07 54 31 1 103 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 3.78e-07 54 31 1 103 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 3.78e-07 54 31 1 103 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CCJ2 3.8e-07 54 31 1 103 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P28257 4.34e-07 54 31 1 103 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
A0QTK2 5.44e-07 53 30 1 103 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0A4P7TS68 5.87e-07 53 30 0 103 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 5.87e-07 53 30 0 103 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 5.87e-07 53 30 0 103 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 5.87e-07 53 30 0 103 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 5.87e-07 53 30 0 103 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 5.87e-07 53 30 0 103 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 5.87e-07 53 30 0 103 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 5.87e-07 53 30 0 103 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
A7HD44 6.68e-07 53 27 0 115 1 Anae109_2439 Response regulator receiver protein Anae109_2439 Anaeromyxobacter sp. (strain Fw109-5)
Q4UU85 1.19e-06 53 27 3 146 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
P76340 1.41e-06 52 25 3 156 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
O31517 1.47e-06 53 26 2 106 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
Q9HWA4 1.51e-06 53 27 3 133 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7D9K0 1.53e-06 52 28 3 122 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 1.53e-06 52 28 3 122 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q1IRH0 1.53e-06 53 37 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
Q9ZVD3 1.8e-06 53 27 4 143 3 ARR13 Putative two-component response regulator ARR13 Arabidopsis thaliana
Q7A0U4 1.88e-06 52 26 4 134 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 1.88e-06 52 26 4 134 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 1.88e-06 52 26 4 134 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 1.88e-06 52 26 4 134 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 1.88e-06 52 26 4 134 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 1.88e-06 52 26 4 134 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 1.88e-06 52 26 4 134 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 1.88e-06 52 26 4 134 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
L7N689 1.99e-06 52 27 3 155 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8FZ93 2.3e-06 52 26 1 150 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 2.3e-06 52 26 1 150 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 2.3e-06 52 26 1 150 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 2.3e-06 52 26 1 150 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 2.3e-06 52 26 1 150 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 2.3e-06 52 26 1 150 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 2.3e-06 52 26 1 150 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 2.3e-06 52 26 1 150 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
P13792 2.53e-06 52 28 0 103 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
A6WZ81 2.93e-06 51 28 1 130 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
O82868 3.01e-06 50 25 0 105 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
O49397 3.15e-06 53 32 2 103 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
P23620 3.51e-06 51 28 2 114 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8H358 5.74e-06 50 27 1 114 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 5.74e-06 50 27 1 114 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8L9Y3 6.39e-06 51 31 4 112 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
P62598 6.48e-06 52 32 2 103 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
Q52883 7.08e-06 51 32 8 143 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q01473 8.01e-06 52 30 2 104 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 9.83e-05 48 25 3 115 3 rcaC Protein RcaC Microchaete diplosiphon
P9WGM1 8.87e-06 50 32 4 128 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 8.87e-06 50 32 4 128 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 8.87e-06 50 32 4 128 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B0R4K1 8.89e-06 48 28 0 111 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P45337 1.09e-05 49 31 2 102 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52929 1.43e-05 49 32 4 115 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P56644 1.47e-05 49 28 1 132 3 sgaR Probable transcriptional regulatory protein SgaR Hyphomicrobium methylovorum
Q2INJ8 1.48e-05 50 32 2 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Anaeromyxobacter dehalogenans (strain 2CP-C)
P0ACZ8 1.6e-05 49 27 3 113 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 1.6e-05 49 27 3 113 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 1.6e-05 49 27 3 113 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P44895 1.63e-05 49 35 2 102 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0C5S3 1.67e-05 48 26 0 105 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
Q2SFK0 1.9e-05 50 30 4 110 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q49ZT8 1.92e-05 49 32 1 101 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P66797 2.1e-05 48 28 2 107 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 2.1e-05 48 28 2 107 3 uvrY Response regulator UvrY Escherichia coli O157:H7
P0A4I4 2.11e-05 49 33 3 112 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 2.11e-05 49 33 3 112 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5V0B3 2.14e-05 50 34 5 103 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P45365 2.19e-05 50 25 2 134 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
P0AED6 2.2e-05 48 28 2 107 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 2.2e-05 48 28 2 107 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
Q75HW2 2.25e-05 50 34 3 106 2 RR27 Two-component response regulator ORR27 Oryza sativa subsp. japonica
A0QTU7 2.29e-05 50 23 10 283 4 mimR Propane 2-monooxygenase operon transcriptional activator MimR Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q47744 2.44e-05 48 30 3 113 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q31S42 2.45e-05 49 32 2 105 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A6UEL7 2.47e-05 48 26 0 105 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
P9WGN1 2.49e-05 48 26 2 149 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 2.49e-05 48 26 2 149 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9I4F9 2.52e-05 48 28 3 114 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P42244 2.61e-05 48 33 4 112 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
P52931 2.68e-05 48 25 3 158 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P39486 2.73e-05 48 24 3 158 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
P0CL17 2.84e-05 48 28 0 101 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 2.84e-05 48 28 0 101 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q65JK6 3.4e-05 49 33 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
G3XCY6 3.8e-05 48 29 2 114 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5HLN2 3.99e-05 48 28 1 103 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN92 4.26e-05 48 28 1 103 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q10WZ6 4.87e-05 48 26 7 196 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
P0DMK7 4.98e-05 48 27 2 112 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 4.98e-05 48 27 2 112 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
P0A4I0 5.12e-05 47 25 3 151 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 5.12e-05 47 25 3 151 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
Q95PI2 5.46e-05 49 26 4 148 1 dhkC Hybrid signal transduction histidine kinase C Dictyostelium discoideum
Q2RRX2 5.53e-05 48 33 4 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P94504 5.83e-05 47 27 5 133 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q940D0 6.17e-05 48 27 3 142 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
Q1XDE4 6.4e-05 47 25 1 112 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q50136 6.54e-05 47 29 2 127 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
O25918 7e-05 47 29 1 103 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
Q8FW53 7.28e-05 45 28 4 116 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 7.28e-05 45 28 4 116 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 7.28e-05 45 28 4 116 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 7.28e-05 45 28 4 116 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 7.28e-05 45 28 4 116 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 7.28e-05 45 28 4 116 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 7.28e-05 45 28 4 116 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 7.28e-05 45 28 4 116 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
P13800 7.46e-05 47 23 1 117 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
P54443 7.66e-05 47 30 4 103 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
O69730 8.15e-05 47 24 0 104 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P52928 9.34e-05 47 33 4 112 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
Q2YZ24 9.6e-05 47 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A0A0H3GGB5 9.99e-05 47 34 3 112 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P52942 0.000112 45 26 0 102 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
P52076 0.000113 46 30 2 102 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P94413 0.000114 47 25 2 112 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q99U73 0.000119 46 29 4 108 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
A6QJK3 0.000121 46 27 3 140 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 0.000121 46 27 3 140 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
P96602 0.000129 46 29 2 103 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q8XBS3 0.000138 46 30 2 102 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P0C001 0.000143 46 35 2 74 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 0.000143 46 35 2 74 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 0.000143 46 35 2 74 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 0.000143 46 35 2 74 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 0.000143 46 35 2 74 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 0.000143 46 35 2 74 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 0.000143 46 35 2 74 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 0.000143 46 35 2 74 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q3IRR4 0.000147 47 30 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q9ZWJ9 0.000149 47 28 2 107 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
Q4L8L9 0.000156 46 30 1 103 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
Q9FXD6 0.000158 47 30 2 103 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
A6X580 0.000188 44 28 4 116 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q6H805 0.000198 47 29 2 103 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
A2X1N2 0.000205 47 29 2 103 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
Q87S86 0.000208 46 31 6 121 3 VP0538 Uncharacterized response regulatory protein VP0538 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8EQW0 0.000214 47 32 3 90 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9HV32 0.000239 45 30 2 103 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5L0L0 0.000247 46 32 6 117 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
Q44929 0.000248 45 25 3 139 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P31079 0.000255 45 28 1 103 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q7A039 0.000259 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 0.000259 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 0.000259 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 0.000259 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 0.000259 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 0.000259 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 0.000259 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 0.000259 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 0.000259 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 0.000259 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q86AT9 0.000259 47 31 1 69 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
P52941 0.00026 46 27 2 111 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9KA55 0.000263 46 29 9 192 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5A599 0.000274 47 30 2 78 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q6GE73 0.000298 45 31 1 103 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
P0C5S6 0.000323 47 26 0 78 3 luxN Autoinducer 1 sensor kinase/phosphatase LuxN Vibrio harveyi
Q9HV27 0.000327 46 35 2 68 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6H468 0.000331 44 33 5 84 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 0.000331 44 33 5 84 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
A7MRY4 0.000332 47 26 0 78 1 luxN Autoinducer 1 sensor kinase/phosphatase LuxN Vibrio campbellii (strain ATCC BAA-1116)
P0AE90 0.000335 45 34 3 112 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 0.000335 45 34 3 112 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 0.000335 45 34 3 112 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P45606 0.000337 45 26 2 114 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
Q9LKL2 0.000341 46 27 2 137 1 APRR1 Two-component response regulator-like APRR1 Arabidopsis thaliana
Q9AE24 0.000342 45 26 0 102 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
P0C0F6 0.000344 46 26 4 146 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P45607 0.000366 45 26 2 114 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P0AFJ5 0.000383 45 26 2 114 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 0.000383 45 26 2 114 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P0C0F7 0.000409 46 26 4 146 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain 8004)
Q44006 0.000414 45 25 2 115 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P0AD01 0.000432 45 28 4 128 1 dcuR Transcriptional regulatory protein DcuR Escherichia coli (strain K12)
P0AD02 0.000432 45 28 4 128 3 dcuR Transcriptional regulatory protein DcuR Escherichia coli O157:H7
Q2YIF7 0.000452 43 32 0 84 1 cpdR Response regulator receiver protein CpdR Brucella abortus (strain 2308)
Q54SP4 0.000485 46 26 9 178 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P45605 0.000486 45 27 2 114 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P08368 0.00049 45 22 0 103 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q52990 0.000492 45 30 3 88 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P35163 0.000512 45 25 1 107 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q2HWH1 0.000543 43 27 2 106 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 0.000543 43 27 2 106 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
Q2FWH6 0.000556 44 25 6 151 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q9KL96 0.000572 45 26 8 179 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q21G20 0.000592 45 33 3 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8H7S7 0.000595 45 26 2 105 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
Q9KSB1 0.000597 45 29 4 140 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A2XE31 0.000606 45 26 2 105 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
P52940 0.000614 45 32 4 116 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
P26275 0.000618 44 29 4 131 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A4H2 0.000639 44 32 1 103 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 0.000639 44 32 1 103 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 0.000639 44 32 1 103 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9HUI2 0.000654 44 30 3 118 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8GZM2 0.000656 45 32 5 93 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 0.000656 45 32 5 93 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q47I43 0.000717 45 29 4 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Dechloromonas aromatica (strain RCB)
B8ASH8 0.000725 45 28 2 114 3 RR29 Two-component response regulator ORR29 Oryza sativa subsp. indica
Q7XS69 0.000744 45 28 2 107 3 RR29 Two-component response regulator ORR29 Oryza sativa subsp. japonica
P66795 0.000751 44 28 2 102 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 0.000751 44 28 2 102 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
P71403 0.000776 42 34 2 66 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
P59338 0.000781 44 28 4 128 3 dcuR Transcriptional regulatory protein DcuR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P59339 0.000832 44 26 3 126 3 dcuR Transcriptional regulatory protein DcuR Shigella flexneri
Q5SML5 0.000837 45 29 2 103 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 0.000866 45 29 2 103 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
Q55933 0.000889 44 28 5 123 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8GP20 0.001 43 27 3 118 1 rssB Swarming motility regulation protein RssB Serratia marcescens

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11900
Feature type CDS
Gene -
Product sigma-54 dependent transcriptional regulator
Location 2627627 - 2628904 (strand: -1)
Length 1278 (nucleotides) / 425 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1494
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF02954 Bacterial regulatory protein, Fis family
PF14532 Sigma-54 interaction domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2204 Signal transduction mechanisms (T) T DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08476 two-component system, NtrC family, phosphoglycerate transport system response regulator PgtA Two-component system -

Protein Sequence

MTQSLLSDIDVLLIDDDEDILESYRHLLNLAGMVARVTDSPEKALSLLTPEYEGAVVLDIYMPAMNGMEVLARIQQIDPRIPVIMITGHGDIPLAVEAVKKGAYDFIEKPINPPLFLELVAKAHKERKSLLSLRKTMITTTQERLVGDSAQITAIRQQVQQIADIDKDLMIEGEMGTGRHLLAQLLHELSPHSDKAVTTVDCQNLVDIKPLIAQIEQEEVGTLILRSPYDLPSGAQRWLSAYLLDMERQGKRQFRTIAILENNTQQLVTEGRLIPEFYYYFSQITFSLPPLSARRPDIIPLFRAFLRQSAQRLGIAVPKIDRNYLDILKRYDWPGNIRELRNVAELYAVGIVKMVDSEQHRAIIPPEGPLDNLVDDYERRLIEDALYLFAGRVSDVADYLGIPRKKLYLRMKKHELDKESYKPKV

Flanking regions ( +/- flanking 50bp)

CTTAGCATCGGCATTAAATGGCGGTGCGATGGTTGTTTTGGAGTTTACTCATGACACAGTCACTGCTGTCTGATATTGATGTACTATTAATTGATGATGATGAGGATATTCTCGAATCTTATCGTCATTTGCTTAATCTTGCCGGAATGGTTGCCAGAGTGACTGATTCGCCAGAAAAAGCATTGAGTCTGCTGACACCAGAATATGAAGGTGCGGTAGTGTTAGATATTTACATGCCTGCGATGAATGGCATGGAAGTCTTAGCGCGTATTCAACAAATTGATCCTCGTATTCCGGTGATTATGATCACCGGCCACGGTGATATACCCCTTGCTGTAGAGGCCGTTAAAAAAGGCGCTTATGATTTTATTGAAAAGCCCATTAATCCACCGCTATTTTTAGAGTTAGTTGCTAAAGCGCATAAAGAGCGAAAATCACTTCTTTCACTTAGAAAAACGATGATCACCACCACTCAAGAGCGTCTAGTTGGCGATAGTGCACAAATTACCGCCATTAGACAGCAAGTACAGCAAATTGCTGATATTGATAAAGACTTAATGATTGAAGGTGAGATGGGGACAGGGCGACATCTACTCGCTCAGTTATTACATGAATTAAGTCCTCACAGCGATAAAGCGGTGACTACGGTAGATTGTCAAAATTTAGTAGATATTAAGCCACTGATTGCTCAAATAGAGCAAGAGGAAGTCGGCACACTTATTTTACGCTCCCCTTATGATTTACCTTCTGGTGCACAACGTTGGTTAAGTGCTTACCTATTAGATATGGAAAGGCAGGGTAAGCGCCAATTTAGAACGATCGCGATTTTAGAAAATAATACCCAGCAATTAGTCACTGAAGGGCGATTGATACCTGAGTTCTATTACTACTTTTCGCAAATAACTTTTTCTTTGCCACCATTAAGCGCAAGACGCCCGGATATTATTCCTCTATTTAGAGCCTTTTTACGGCAAAGTGCTCAGCGGCTTGGGATCGCCGTACCAAAAATTGATCGTAATTATCTCGATATATTAAAACGTTATGATTGGCCTGGAAACATTCGTGAGCTACGGAATGTCGCTGAACTCTATGCTGTTGGTATTGTGAAAATGGTTGATAGTGAGCAACATCGTGCCATTATCCCCCCTGAAGGGCCTTTAGATAACTTAGTTGATGATTATGAGCGTCGCTTAATTGAAGATGCACTCTATTTATTTGCTGGCCGTGTGAGCGATGTGGCTGATTATTTAGGTATCCCACGTAAAAAACTCTATTTACGCATGAAAAAGCATGAACTGGATAAAGAGAGTTATAAACCTAAGGTTTGATAGTTATCAATAAGCGCCATTTGGCGCTTATTGCATTAGCACATTAATTT