Homologs in group_1494

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09065 FBDBKF_09065 100.0 Morganella morganii S1 atoC DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains
EHELCC_10345 EHELCC_10345 100.0 Morganella morganii S2 atoC DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains
NLDBIP_10690 NLDBIP_10690 100.0 Morganella morganii S4 atoC DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains
LHKJJB_10665 LHKJJB_10665 100.0 Morganella morganii S3 atoC DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains
F4V73_RS10880 F4V73_RS10880 90.4 Morganella psychrotolerans - sigma-54 dependent transcriptional regulator
PMI_RS11900 PMI_RS11900 41.4 Proteus mirabilis HI4320 - sigma-54 dependent transcriptional regulator

Distribution of the homologs in the orthogroup group_1494

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1494

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06184 7.46e-162 464 58 0 415 3 pgtA Phosphoglycerate transport system transcriptional regulatory protein PgtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9HU19 1.24e-61 209 32 7 444 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P13632 3.29e-58 200 29 5 440 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P10046 3.75e-56 194 30 6 440 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
Q04849 6.19e-37 143 24 10 453 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9APD9 6.36e-37 142 28 10 447 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P14375 8.04e-35 137 27 7 442 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q8X613 6.07e-34 134 27 8 448 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
Q9I4N3 2.96e-33 133 27 12 474 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P25852 6.4e-33 131 27 9 447 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z333 1.5e-32 130 27 9 447 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q04848 1.43e-31 128 25 4 360 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q4UL27 2.55e-30 125 21 10 451 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q00934 5.5e-30 123 25 10 446 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P10576 6.02e-30 124 25 4 366 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
P03029 8.81e-30 123 23 8 466 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P28787 1.27e-29 123 23 10 473 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q06065 2.05e-29 122 23 6 451 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P0AFB8 2.75e-29 122 23 8 468 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 2.75e-29 122 23 8 468 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P41789 3.91e-29 121 23 8 468 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q68WH4 7.63e-29 120 21 10 451 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZCY9 8.33e-29 120 22 10 451 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q92HC2 4.72e-28 118 21 9 450 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q1RJS1 2.89e-27 116 21 10 454 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P0AFU5 6.12e-27 115 24 11 449 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 6.12e-27 115 24 11 449 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
P45671 3.34e-26 113 24 8 409 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
P10577 2.52e-25 110 24 5 360 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P23747 4.53e-24 107 25 9 442 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88RJ6 1.05e-23 105 23 10 450 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O25408 6.56e-23 102 25 12 370 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
P26408 1.74e-22 102 25 12 484 1 hupR1 Hydrogenase transcriptional regulatory protein HupR1 Rhodobacter capsulatus
Q88AQ2 6.98e-22 100 23 10 444 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P23221 4.53e-21 94 32 3 193 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P37930 2.99e-20 94 27 6 276 4 hrpR Pathogenicity locus probable regulatory protein HrpR Pseudomonas syringae pv. syringae
Q8KR08 1.02e-19 90 40 0 121 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
Q9KT84 1.87e-19 93 21 9 418 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3LWR6 2.26e-19 89 36 3 170 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 2.26e-19 89 36 3 170 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 2.26e-19 89 36 3 170 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q46802 5.6e-19 92 25 7 320 4 uacR Putative uric acid sigma-54-dependent transcriptional regulator UacR Escherichia coli (strain K12)
P12627 6.36e-19 92 24 6 320 1 vnfA Nitrogen fixation protein VnfA Azotobacter vinelandii
P26487 1.15e-18 87 34 5 195 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P0C5S5 1.24e-18 90 20 9 451 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 1.24e-18 90 20 9 451 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q7MM78 2.5e-18 90 22 11 412 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 2.5e-18 90 22 11 412 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
P36219 5.26e-18 87 26 7 288 4 wtsA Pathogenicity locus probable regulatory protein WtsA Pantoea stewartii subsp. stewartii
P09432 1.41e-17 87 23 6 334 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P12626 1.57e-17 88 24 10 314 4 anfA Nitrogen fixation protein AnfA Azotobacter vinelandii
G3XCV0 1.65e-17 87 26 18 484 1 fleQ Transcriptional regulator FleQ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q87MX7 4.55e-17 86 21 6 360 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P26047 5.07e-17 86 24 10 312 4 stc Signal-transduction and transcriptional-control protein Clostridium beijerinckii
P26316 9.55e-17 83 26 6 270 4 hrpS Pathogenicity locus probable regulatory protein HrpS Pseudomonas savastanoi pv. phaseolicola
P37931 1.1e-16 83 25 5 272 4 hrpS Pathogenicity locus probable regulatory protein HrpS Pseudomonas syringae pv. syringae
P29267 3.59e-16 83 20 11 490 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q7CQM8 4.07e-16 80 42 2 127 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P38022 5.6e-16 83 24 8 316 1 rocR Transcriptional activator RocR Bacillus subtilis (strain 168)
O31551 3.6e-15 80 24 7 313 2 acoR Acetoin dehydrogenase operon transcriptional activator AcoR Bacillus subtilis (strain 168)
P15940 1.46e-14 75 29 6 178 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P10958 2.18e-14 75 32 0 116 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
Q845S7 3.71e-14 77 27 5 210 2 sfnR Sigma54-dependent transcriptional activator SfnR Pseudomonas putida
Q43965 6.01e-14 77 23 6 322 1 mopR Phenol regulator MopR Acinetobacter guillouiae
O87455 1.32e-13 75 22 7 343 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P76016 1.75e-13 75 25 8 296 1 dhaR PTS-dependent dihydroxyacetone kinase operon regulatory protein Escherichia coli (strain K12)
Q7MFY9 2.47e-13 75 22 7 338 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Vibrio vulnificus (strain YJ016)
Q3K999 5.58e-13 73 25 4 211 3 sfnR Sigma54-dependent transcriptional regulator SfnR Pseudomonas fluorescens (strain Pf0-1)
P45512 1.2e-12 73 24 8 307 4 dhaR Glycerol metabolism operon regulatory protein Citrobacter freundii
Q8D4F9 1.22e-12 72 22 7 338 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Vibrio vulnificus (strain CMCP6)
P37740 1.39e-12 69 31 4 132 3 dctR C4-dicarboxylate transport transcriptional regulatory protein DctR Rhodobacter capsulatus
P74839 1.71e-12 72 25 12 343 4 prpR Propionate catabolism operon regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P31908 2.49e-12 72 23 19 482 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
E1WAA4 5.19e-12 71 23 8 308 3 fhlA Formate hydrogenlyase transcriptional activator Salmonella typhimurium (strain SL1344)
P0CL46 5.62e-12 71 23 8 310 1 fhlA Formate hydrogenlyase transcriptional activator Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0CY94 6.2e-12 70 27 9 242 4 nifA1 Nif-specific regulatory protein Rhodobacter capsulatus
D5ARW9 6.53e-12 70 27 9 242 4 nifA1 Nif-specific regulatory protein Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P27713 1.02e-11 70 26 7 262 4 nifA Nif-specific regulatory protein Herbaspirillum seropedicae
P71229 1.07e-11 70 25 12 333 1 hyfR DNA-binding transcriptional activator HyfR Escherichia coli (strain K12)
P19323 2e-11 69 23 8 310 1 fhlA Formate hydrogenlyase transcriptional activator FhlA Escherichia coli (strain K12)
Q1XDE4 2.19e-11 66 23 3 188 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P54529 2.24e-11 69 23 9 345 4 yqiR Putative sigma L-dependent transcriptional regulator YqiR Bacillus subtilis (strain 168)
P77743 2.61e-11 68 24 11 341 1 prpR Propionate catabolism operon regulatory protein Escherichia coli (strain K12)
O87940 3.86e-11 65 30 2 136 1 tdiR Transcriptional regulatory protein TdiR Thauera aromatica
Q9HWA4 5.67e-11 66 29 4 167 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P55610 2.02e-10 66 23 8 328 4 NGR_a02110 Putative transcriptional regulatory protein y4pA Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9KN48 2.08e-10 66 23 8 344 4 vasH Transcriptional regulator VasH Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P44694 2.27e-10 65 22 9 306 1 tyrR HTH-type transcriptional regulatory protein TyrR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P17899 2.38e-10 65 23 6 289 4 flbD Transcriptional regulatory protein FlbD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q01265 3.45e-10 64 22 6 267 4 None Uncharacterized protein in HyuA 5'region (Fragment) Pseudomonas sp. (strain NS671)
Q9LYP5 3.61e-10 65 29 3 133 2 ARR21 Putative two-component response regulator ARR21 Arabidopsis thaliana
O34903 3.76e-10 63 28 1 147 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
P37344 4.39e-10 64 25 4 228 1 pspF Psp operon transcriptional activator Escherichia coli (strain K12)
O85057 5.46e-10 64 25 15 305 1 None Limonene hydroxylase Geobacillus stearothermophilus
P28614 7.96e-10 64 24 9 299 1 acoR Acetoin catabolism regulatory protein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P45605 8.17e-10 62 28 1 109 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P0A2D7 1.05e-09 63 22 9 303 3 tyrR HTH-type transcriptional regulatory protein TyrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D8 1.05e-09 63 22 9 303 3 tyrR HTH-type transcriptional regulatory protein TyrR Salmonella typhi
O54426 1.21e-09 63 22 9 306 3 tyrR HTH-type transcriptional regulatory protein TyrR Citrobacter braakii
P45607 1.25e-09 61 28 1 109 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P45606 1.36e-09 61 28 1 109 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P51586 1.42e-09 59 32 1 115 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P0AFJ5 1.49e-09 61 28 1 109 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.49e-09 61 28 1 109 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P54929 1.79e-09 63 26 6 223 4 nifA Nif-specific regulatory protein Azospirillum lipoferum
P30667 2.29e-09 62 26 6 223 1 nifA Nif-specific regulatory protein Azospirillum brasilense
Q53206 2.82e-09 62 26 9 242 4 nifA Nif-specific regulatory protein Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6TCX4 2.95e-09 62 21 6 310 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P07604 3.18e-09 62 23 9 299 1 tyrR HTH-type transcriptional regulatory protein TyrR Escherichia coli (strain K12)
P0CL17 4.23e-09 60 32 0 106 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 4.23e-09 60 32 0 106 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
P42508 5.28e-09 58 27 0 108 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
Q689G6 7.45e-09 61 32 2 113 2 PRR95 Two-component response regulator-like PRR95 Oryza sativa subsp. japonica
Q7A0U4 8.62e-09 59 29 2 123 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 8.62e-09 59 29 2 123 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 8.62e-09 59 29 2 123 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 8.62e-09 59 29 2 123 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 8.62e-09 59 29 2 123 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 8.62e-09 59 29 2 123 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 8.62e-09 59 29 2 123 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 8.62e-09 59 29 2 123 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q31S42 8.66e-09 59 30 2 134 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P09828 9.36e-09 60 26 6 232 4 nifA Nif-specific regulatory protein Rhizobium leguminosarum
Q8L9Y3 1.06e-08 60 32 4 134 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
Q9ZIB7 1.46e-08 60 22 9 306 1 tyrR HTH-type transcriptional regulatory protein TyrR Enterobacter agglomerans
B5XVA2 1.46e-08 60 21 6 310 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Klebsiella pneumoniae (strain 342)
O49397 1.69e-08 60 35 3 112 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
P54443 2.37e-08 57 32 2 108 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
Q9CD68 2.56e-08 57 34 0 107 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P72781 2.73e-08 57 25 3 157 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0PWB4 2.79e-08 57 33 0 107 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
P31079 3.27e-08 57 31 1 107 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q55890 3.39e-08 57 29 2 134 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O78428 3.87e-08 57 25 3 162 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q4UU85 4.27e-08 58 29 7 210 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
A1KHB7 4.86e-08 57 32 0 107 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 4.86e-08 57 32 0 107 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5SML5 5.38e-08 58 34 3 109 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 5.43e-08 58 34 3 109 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
Q742C1 6.16e-08 56 32 0 107 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 6.16e-08 56 32 0 107 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q6H805 6.38e-08 58 29 4 157 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
A2X1N2 6.55e-08 58 29 4 157 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
P23620 6.78e-08 56 29 2 110 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O82868 8.58e-08 55 26 0 108 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q9WY30 8.74e-08 57 30 1 117 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P43501 9.76e-08 53 31 2 119 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WGM9 9.77e-08 56 32 0 107 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 9.77e-08 56 32 0 107 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 9.77e-08 56 32 0 107 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P62598 1.16e-07 57 33 3 120 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
A0A4P7TS68 1.25e-07 55 23 0 114 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 1.25e-07 55 23 0 114 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 1.25e-07 55 23 0 114 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 1.25e-07 55 23 0 114 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 1.25e-07 55 23 0 114 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 1.25e-07 55 23 0 114 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 1.25e-07 55 23 0 114 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 1.25e-07 55 23 0 114 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
P09570 1.34e-07 57 23 6 230 4 nifA Nif-specific regulatory protein Azotobacter vinelandii
Q8L500 1.4e-07 57 30 2 113 1 APRR9 Two-component response regulator-like APRR9 Arabidopsis thaliana
Q6D8R9 2.18e-07 56 20 6 325 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9ZHD3 2.71e-07 54 26 0 135 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
A1TEL7 3.08e-07 54 33 0 107 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q53228 3.08e-07 53 26 0 108 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P54931 3.12e-07 56 23 5 226 4 nifA Nif-specific regulatory protein Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q5E3W8 3.41e-07 55 22 5 278 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9ZWJ9 3.59e-07 56 27 6 185 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
Q1B3X8 3.6e-07 54 32 0 107 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 3.6e-07 54 32 0 107 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 3.6e-07 54 32 0 107 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q9ZEP4 4.08e-07 54 30 1 111 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P36556 4.48e-07 53 25 1 141 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A4WDR5 5.29e-07 55 21 6 314 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Enterobacter sp. (strain 638)
P52942 5.33e-07 51 26 0 115 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q9K4U8 5.55e-07 55 24 5 250 2 norR2 Nitric oxide reductase transcription regulator NorR2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P45365 5.56e-07 55 26 2 137 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
Q93CB8 6.65e-07 53 29 1 105 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P28257 6.68e-07 53 29 1 106 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P09133 6.93e-07 55 24 6 227 2 nifA Nif-specific regulatory protein Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A0KEJ0 7.43e-07 55 24 11 321 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
P9WGM7 7.76e-07 53 29 1 105 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 7.76e-07 53 29 1 105 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 7.76e-07 53 29 1 105 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CCJ2 8.64e-07 53 29 1 105 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
A8GG93 9.58e-07 54 22 5 265 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Serratia proteamaculans (strain 568)
P06628 9.67e-07 50 25 0 117 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
A0R3I8 1.07e-06 52 26 1 161 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
O05251 1.15e-06 52 27 6 162 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
P66795 1.26e-06 52 32 5 152 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 1.26e-06 52 32 5 152 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
P03028 1.31e-06 54 23 5 253 4 nifA Nif-specific regulatory protein Rhizobium meliloti (strain 1021)
Q2YIF7 1.36e-06 50 31 0 116 1 cpdR Response regulator receiver protein CpdR Brucella abortus (strain 2308)
Q82EB1 1.39e-06 52 30 1 102 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q54YZ9 1.39e-06 54 28 1 123 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q9FXD6 1.47e-06 53 31 3 124 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
Q6LA42 1.58e-06 53 30 2 113 1 APRR5 Two-component response regulator-like APRR5 Arabidopsis thaliana
P54156 1.76e-06 53 22 6 247 2 yplP Putative sigma L-dependent transcriptional regulator YplP Bacillus subtilis (strain 168)
A0QTK2 2.11e-06 52 29 1 105 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P0A4H5 2.12e-06 49 36 0 69 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 2.12e-06 49 36 0 69 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q6K8X6 2.27e-06 53 31 4 131 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
B8AEH1 2.27e-06 53 31 4 131 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
Q55933 2.7e-06 51 33 1 109 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P42244 4.23e-06 51 25 8 215 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q47744 4.4e-06 50 27 2 133 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
O69730 4.49e-06 51 27 0 107 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
L7N689 4.57e-06 51 27 0 107 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q44929 5.19e-06 51 26 1 103 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P0C5S3 5.23e-06 50 26 0 111 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
Q07783 5.39e-06 50 28 4 152 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q23917 5.59e-06 52 31 5 145 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
P48259 5.97e-06 50 26 2 139 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
O31517 6.13e-06 51 24 3 142 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
Q04803 6.56e-06 51 30 1 100 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8GZM2 6.74e-06 51 36 6 112 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 6.74e-06 51 36 6 112 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q940D0 7.05e-06 52 28 5 156 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
P44918 7.66e-06 50 25 1 106 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6UEL7 7.75e-06 49 26 0 111 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
P30843 8.77e-06 50 25 1 141 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q9KQD5 9.09e-06 48 31 3 122 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 9.09e-06 48 31 3 122 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P06519 9.2e-06 51 22 7 265 4 xylR Transcriptional regulatory protein XylR Pseudomonas putida
Q06239 9.66e-06 50 23 1 119 3 vanR Regulatory protein VanR Enterococcus faecium
P50350 1.07e-05 50 31 1 100 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
B8H358 1.13e-05 50 21 1 151 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.13e-05 50 21 1 151 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
C0PWN2 1.18e-05 51 22 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi C (strain RKS4594)
A2YQ93 1.37e-05 51 27 2 113 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
Q8CQ17 1.37e-05 49 26 1 115 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 1.37e-05 49 26 1 115 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0A9Q4 1.39e-05 49 24 3 137 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 1.39e-05 49 24 3 137 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 1.39e-05 49 24 3 137 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 1.39e-05 49 24 3 137 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q8GP20 1.43e-05 49 25 1 135 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q0D3B6 1.44e-05 51 27 2 113 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
Q9ZVD3 1.55e-05 50 26 3 125 3 ARR13 Putative two-component response regulator ARR13 Arabidopsis thaliana
Q5N6V8 1.56e-05 50 32 3 104 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
P50351 1.61e-05 49 31 1 100 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9LVG4 1.67e-05 50 29 2 113 1 APRR3 Two-component response regulator-like APRR3 Arabidopsis thaliana
P48359 1.8e-05 48 26 3 119 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
Q7A216 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 2e-05 49 25 3 139 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 2e-05 49 25 3 139 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 2e-05 49 25 3 139 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 2e-05 49 25 3 139 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P94504 2.05e-05 49 26 4 141 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
P51358 2.06e-05 49 25 3 143 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q56312 2.13e-05 47 27 3 118 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O25918 2.18e-05 48 30 2 109 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
P28835 2.31e-05 48 28 1 106 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
O31432 2.41e-05 48 25 2 125 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
G3XCY6 2.48e-05 48 26 2 134 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45189 2.54e-05 48 25 2 113 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P40138 2.61e-05 49 27 4 146 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
Q7A1J1 2.9e-05 48 25 3 139 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 2.9e-05 48 25 3 139 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 2.9e-05 48 25 3 139 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 2.9e-05 48 25 3 139 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 2.9e-05 48 25 3 139 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 2.9e-05 48 25 3 139 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 2.9e-05 48 25 3 139 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 2.9e-05 48 25 3 139 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 2.9e-05 48 25 3 139 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 2.9e-05 48 25 3 139 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P35163 3.09e-05 48 29 4 124 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q9LKL2 3.42e-05 49 28 3 114 1 APRR1 Two-component response regulator-like APRR1 Arabidopsis thaliana
A9MFX7 3.53e-05 49 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P0A4I0 3.58e-05 48 26 0 107 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 3.58e-05 48 26 0 107 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
P52076 3.79e-05 48 31 0 100 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P0ACZ8 3.86e-05 48 22 0 136 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 3.86e-05 48 22 0 136 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 3.86e-05 48 22 0 136 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P05407 3.87e-05 49 24 6 233 1 nifA Nif-specific regulatory protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P13792 4.22e-05 48 24 0 109 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q8XBS3 4.23e-05 48 31 0 100 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P76340 4.31e-05 48 30 1 107 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
P0AE90 4.46e-05 48 32 4 131 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 4.46e-05 48 32 4 131 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 4.46e-05 48 32 4 131 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
Q1CI99 4.82e-05 48 29 9 177 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFM0 4.82e-05 48 29 9 177 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis
Q1C6W3 4.82e-05 48 29 9 177 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Antiqua)
B4T3B0 4.83e-05 49 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella newport (strain SL254)
Q8ZMJ8 5.09e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TT16 5.09e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella schwarzengrund (strain CVM19633)
Q669T5 5.12e-05 48 29 9 177 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q5PF20 5.32e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q4LAJ9 5.66e-05 47 24 2 127 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q8CQK0 5.82e-05 47 24 2 127 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 5.82e-05 47 24 2 127 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B5RDG4 5.86e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q8Z4C6 6.4e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella typhi
A9N0D7 6.4e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5QV88 6.4e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella enteritidis PT4 (strain P125109)
Q57KT4 6.4e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella choleraesuis (strain SC-B67)
B5FSZ0 6.62e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella dublin (strain CT_02021853)
B5F363 6.62e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella agona (strain SL483)
Q4A160 6.68e-05 47 23 2 137 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q51455 6.68e-05 45 29 2 115 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8H7S7 7.29e-05 48 31 3 109 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
A2XE31 7.29e-05 48 31 3 109 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q6K9T0 7.36e-05 45 28 2 117 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 7.36e-05 45 28 2 117 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
Q0PVB3 7.41e-05 47 27 4 118 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. japonica
B4TF23 7.49e-05 48 21 5 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella heidelberg (strain SL476)
Q9K4V0 8.76e-05 48 23 6 324 2 norR1 Nitric oxide reductase transcription regulator NorR1 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P51343 9.16e-05 47 24 4 189 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
A0A0H3GGB5 9.31e-05 47 31 4 133 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
A8ANR6 9.32e-05 48 20 7 311 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9FGT7 9.34e-05 48 32 2 103 2 ARR18 Two-component response regulator ARR18 Arabidopsis thaliana
Q6D6I7 9.74e-05 47 29 9 178 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P37478 0.000115 47 26 3 123 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q9I4F9 0.000129 46 30 2 117 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1XDC9 0.000138 46 25 1 113 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
A6WZ81 0.000147 46 25 3 152 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q75HW2 0.000154 47 31 2 109 2 RR27 Two-component response regulator ORR27 Oryza sativa subsp. japonica
P26275 0.000164 46 32 4 125 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8FZ93 0.000179 46 25 3 152 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 0.000179 46 25 3 152 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 0.000179 46 25 3 152 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 0.000179 46 25 3 152 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 0.000179 46 25 3 152 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 0.000179 46 25 3 152 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 0.000179 46 25 3 152 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 0.000179 46 25 3 152 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q04942 0.000182 46 28 1 101 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A7N6S2 0.000189 47 28 3 110 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
O24973 0.00021 45 26 2 133 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q93WK5 0.000212 47 27 2 113 1 APRR7 Two-component response regulator-like APRR7 Arabidopsis thaliana
P45337 0.000242 45 23 6 213 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9HV32 0.000261 45 30 0 106 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KU36 0.000272 45 27 3 120 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KM66 0.000275 47 27 1 111 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P9WGN1 0.000298 45 25 2 140 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 0.000298 45 25 2 140 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P03027 0.000314 46 23 7 232 1 nifA Nif-specific regulatory protein Klebsiella pneumoniae
Q9F868 0.000317 45 26 1 107 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A2XFB7 0.000335 46 26 2 113 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
P56266 0.000346 46 23 7 232 3 nifA Nif-specific regulatory protein Klebsiella oxytoca
Q10N34 0.000362 46 26 2 113 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
Q7D9K0 0.000398 45 27 0 107 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 0.000398 45 27 0 107 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A4STH5 0.000406 46 26 9 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aeromonas salmonicida (strain A449)
Q3YYF5 0.000469 46 20 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella sonnei (strain Ss046)
B7N6T9 0.00049 45 20 3 222 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q1R7Z1 0.000516 45 20 3 222 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain UTI89 / UPEC)
A1AEP9 0.000516 45 20 3 222 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O1:K1 / APEC
B7MKH8 0.000516 45 20 3 222 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O45:K1 (strain S88 / ExPEC)
Q8FEN6 0.00053 45 20 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UHC1 0.000535 45 20 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7MZ04 0.000544 45 20 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O81 (strain ED1a)
P9WGL9 0.000551 44 27 1 107 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 0.000551 44 27 1 107 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 0.000551 44 27 1 107 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q0TEH1 0.000568 45 20 3 222 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q9ZWS7 0.000607 44 35 1 59 1 ARR7 Two-component response regulator ARR7 Arabidopsis thaliana
Q49XM7 0.00065 44 24 1 120 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B1IUX0 0.000689 45 20 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7LEC0 0.000689 45 20 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain 55989 / EAEC)
B1LQ27 0.00072 45 20 3 222 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain SMS-3-5 / SECEC)
Q01473 0.000741 45 26 0 107 3 rcaC Protein RcaC Microchaete diplosiphon
B7NSI9 0.000745 45 20 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A8A3I6 0.000752 45 20 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O9:H4 (strain HS)
Q31X73 0.000778 45 20 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella boydii serotype 4 (strain Sb227)
B7M9E6 0.000785 45 20 3 222 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O8 (strain IAI1)
A7ZQD8 0.000864 45 20 3 224 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O139:H28 (strain E24377A / ETEC)
A2XYV5 0.000874 43 27 4 118 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
Q8Z7H2 0.0009 43 23 1 136 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P0DM78 0.001 43 25 0 108 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 0.001 43 25 0 108 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 0.001 43 25 0 108 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 0.001 43 25 0 108 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 0.001 43 25 0 108 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7XQA6 0.001 43 27 4 118 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
Q5A4X5 0.001 45 25 0 122 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q5HLN2 0.001 43 24 1 106 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_13725
Feature type CDS
Gene atoC
Product DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains
Location 29217 - 30464 (strand: -1)
Length 1248 (nucleotides) / 415 (amino acids)
In genomic island -

Contig

Accession ZDB_692
Length 124746 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1494
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF02954 Bacterial regulatory protein, Fis family
PF14532 Sigma-54 interaction domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2204 Signal transduction mechanisms (T) T DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08476 two-component system, NtrC family, phosphoglycerate transport system response regulator PgtA Two-component system -

Protein Sequence

MLDDNYDILLIDDDTDVLEAYCMLLEQAGYRVYACHDPLAAKELVHRDWCGIVLSDVCMPGCSGIDLMALFLEKDKYLPVLLITGHGDVPMAVEAVKQGAWDFLQKPVDPEHLLTLTEKALAARKQRVTQRRWSSEQLTLNLAGESEWTEHVRQQLRGLAETRAAVFLHGEPGSGRTYLARYLHQISSNKCGPLVIKTLLSDEEIPLDAWLDEVTDGTLVIKNIDLMPLSQQRWLVQHIRQEQRIFRLIGIADTPLIMLTKQQKIIAELYYCFSMTQIACLPLSQRKADIAPIFRYYLEQACSRLNHPLPNLAEPLVKKLTRRHWPGNVSELANAAELYAVGIMPMGDTANPLLPSVAPTALDQRVESYERQIITEALNIHQGRINDVSEYLQIPRKKLYLRMKKYGLDKHHYRI

Flanking regions ( +/- flanking 50bp)

GCTGACCCGCCACGGATGTGTGATCCTGAGTTTTAAAAAGGTAACTGAATATGCTTGATGATAACTACGATATCTTATTAATAGATGATGATACGGATGTCCTGGAAGCTTACTGTATGCTGCTGGAGCAGGCCGGATATCGTGTTTATGCCTGTCATGACCCGCTGGCGGCAAAAGAGCTGGTTCACCGCGACTGGTGCGGTATTGTGCTCAGCGACGTCTGTATGCCGGGGTGCTCAGGTATCGATCTGATGGCATTGTTCCTGGAAAAAGACAAATATCTGCCGGTGCTGCTGATCACCGGCCACGGTGATGTGCCGATGGCGGTGGAAGCCGTCAAACAGGGGGCGTGGGATTTTCTGCAGAAACCGGTGGATCCGGAGCATCTGCTGACCCTGACAGAAAAAGCTCTGGCAGCCCGCAAACAGCGGGTAACCCAGCGCCGCTGGAGCTCAGAGCAGCTGACACTGAATCTTGCCGGTGAGAGTGAATGGACAGAGCACGTCCGCCAGCAGTTGCGCGGACTGGCGGAAACCCGTGCTGCGGTCTTTCTGCATGGTGAGCCGGGGAGCGGCCGCACCTATCTGGCGCGCTACCTGCATCAGATAAGCAGCAATAAATGCGGGCCGCTGGTCATCAAAACCCTGCTCAGTGATGAGGAGATCCCGCTGGATGCCTGGCTGGATGAAGTGACGGACGGCACACTGGTGATCAAAAATATCGATCTGATGCCGCTCAGCCAGCAGCGCTGGCTGGTACAGCATATCCGTCAGGAGCAGCGGATATTCCGTCTGATCGGGATTGCCGACACGCCGCTGATTATGCTGACCAAACAGCAGAAGATTATCGCTGAGCTCTATTACTGTTTCTCCATGACACAGATTGCCTGCCTGCCGTTGTCCCAGCGCAAAGCCGATATTGCACCGATATTCCGTTACTATCTGGAACAGGCCTGTTCCCGTCTGAATCATCCGCTGCCGAACCTTGCGGAGCCGCTGGTGAAAAAACTGACCCGCCGGCACTGGCCGGGCAATGTCAGTGAACTGGCGAATGCGGCGGAGCTGTATGCGGTCGGGATTATGCCGATGGGCGATACCGCGAACCCGCTGCTGCCGTCCGTGGCACCGACTGCGCTGGACCAGCGGGTGGAGAGCTATGAGCGGCAGATTATCACCGAAGCCCTGAATATCCACCAGGGGCGAATTAACGATGTCTCAGAGTATCTGCAAATCCCGCGTAAAAAACTCTATCTGCGGATGAAAAAGTACGGGCTGGACAAGCATCACTACCGTATATGACATAAATTAATCTGATGGTTTTTACCCGTAAGCCGGTTTGTATAAAATAA