Homologs in group_1159

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06235 FBDBKF_06235 79.6 Morganella morganii S1 rluA bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA
EHELCC_09280 EHELCC_09280 79.6 Morganella morganii S2 rluA bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA
NLDBIP_09660 NLDBIP_09660 79.6 Morganella morganii S4 rluA bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA
LHKJJB_08095 LHKJJB_08095 79.6 Morganella morganii S3 rluA bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA
HKOGLL_07645 HKOGLL_07645 79.6 Morganella morganii S5 rluA bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA
F4V73_RS15680 F4V73_RS15680 80.1 Morganella psychrotolerans rluA bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA

Distribution of the homologs in the orthogroup group_1159

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1159

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8FL93 6.93e-120 342 76 1 217 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA38 1.16e-119 342 75 1 217 3 rluA Dual-specificity RNA pseudouridine synthase RluA Shigella flexneri
P0AA37 1.16e-119 342 75 1 217 1 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli (strain K12)
Q8ZIK1 4.95e-119 339 77 1 204 3 rluA Dual-specificity RNA pseudouridine synthase RluA Yersinia pestis
Q8ZRV9 4.98e-118 337 75 1 217 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XA10 5.55e-118 337 74 1 217 3 rluA Dual-specificity RNA pseudouridine synthase RluA Escherichia coli O157:H7
Q8Z9J5 2.39e-117 335 74 1 217 3 rluA Dual-specificity RNA pseudouridine synthase RluA Salmonella typhi
P44782 2.79e-95 280 62 1 214 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CK02 7.56e-95 279 62 1 214 3 rluA Dual-specificity RNA pseudouridine synthase RluA Pasteurella multocida (strain Pm70)
P59831 1.54e-91 270 63 2 203 3 rluA Dual-specificity RNA pseudouridine synthase RluA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87LD3 3.33e-88 263 59 2 211 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KP71 1.33e-84 254 59 0 205 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DCG0 1.79e-83 251 57 2 211 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio vulnificus (strain CMCP6)
Q82WZ5 2.66e-34 127 38 4 203 3 rluD Ribosomal large subunit pseudouridine synthase D Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8D8G1 3.83e-32 121 37 4 207 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
Q87N15 6.52e-31 118 36 4 198 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1RJX7 1.24e-30 117 33 3 203 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia bellii (strain RML369-C)
Q9KQH0 1.61e-30 117 36 5 209 3 rluC Ribosomal large subunit pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P70870 2.49e-30 117 35 3 203 3 rluD Ribosomal large subunit pseudouridine synthase D Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8Z7J7 7.03e-30 115 37 5 213 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhi
Q8ZQ16 8.22e-30 115 37 5 213 3 rluC Ribosomal large subunit pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X8J3 1.9e-29 114 37 5 213 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O157:H7
P0AA40 1.98e-29 114 37 5 213 3 rluC Ribosomal large subunit pseudouridine synthase C Shigella flexneri
P0AA39 1.98e-29 114 37 5 213 1 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli (strain K12)
Q8FIP7 2.03e-29 114 37 5 213 3 rluC Ribosomal large subunit pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P74346 2.95e-29 114 34 6 223 3 slr1629 Uncharacterized RNA pseudouridine synthase slr1629 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P59835 3.99e-29 114 36 4 199 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4UKQ3 4.01e-29 113 33 3 203 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
O67638 8.15e-29 112 37 6 221 3 aq_1758 Uncharacterized RNA pseudouridine synthase aq_1758 Aquifex aeolicus (strain VF5)
Q9CM51 9.06e-29 112 36 4 199 3 rluC Ribosomal large subunit pseudouridine synthase C Pasteurella multocida (strain Pm70)
Q8XYX8 1.09e-28 113 36 9 222 3 rluD Ribosomal large subunit pseudouridine synthase D Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q92IS6 4.55e-28 110 33 3 203 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P59838 7.52e-28 110 35 3 179 3 rluD Ribosomal large subunit pseudouridine synthase D Blochmanniella floridana
Q8ZFU1 1.69e-27 109 35 5 209 3 rluC Ribosomal large subunit pseudouridine synthase C Yersinia pestis
P75485 2.55e-27 108 33 3 213 3 MPN_292 Uncharacterized RNA pseudouridine synthase MG209 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P44433 1.43e-26 107 33 4 212 3 rluC Ribosomal large subunit pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q87AR7 1.71e-26 107 36 6 225 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9K0B0 2.9e-26 107 35 4 217 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q08C69 3.15e-26 105 35 6 217 2 rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Danio rerio
Q9PET9 3.22e-26 106 36 6 225 3 rluD Ribosomal large subunit pseudouridine synthase D Xylella fastidiosa (strain 9a5c)
P54604 4.81e-26 105 32 4 198 3 yhcT Uncharacterized RNA pseudouridine synthase YhcT Bacillus subtilis (strain 168)
Q9CKA6 6.67e-26 105 35 4 183 3 rluD Ribosomal large subunit pseudouridine synthase D Pasteurella multocida (strain Pm70)
P50513 6.75e-26 105 34 5 226 3 rluD Ribosomal large subunit pseudouridine synthase D Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q9JVB6 7.08e-26 106 35 4 220 3 rluD Ribosomal large subunit pseudouridine synthase D Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q68XB2 1.26e-25 104 30 4 210 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P33640 1.5e-25 104 36 8 225 3 rluD Ribosomal large subunit pseudouridine synthase D Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P57430 2.06e-25 103 30 3 220 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9ZDR7 4.27e-25 102 30 4 205 3 rluC Ribosomal large subunit pseudouridine synthase C Rickettsia prowazekii (strain Madrid E)
P59840 5.34e-25 101 35 10 237 3 truC tRNA pseudouridine synthase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8X9F0 6.52e-25 102 34 6 225 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O157:H7
P65835 7.16e-25 102 34 6 225 3 rluD Ribosomal large subunit pseudouridine synthase D Shigella flexneri
P65834 7.16e-25 102 34 6 225 3 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P44445 7.62e-25 102 37 4 178 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KU20 8.99e-25 102 34 7 224 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P33643 1.04e-24 102 34 6 225 1 rluD Ribosomal large subunit pseudouridine synthase D Escherichia coli (strain K12)
O66114 1.19e-24 99 36 4 191 3 ZMO0505 Uncharacterized RNA pseudouridine synthase ZMO0505 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8K9J8 1.2e-24 101 32 4 207 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O31613 1.28e-24 101 33 6 215 3 yjbO Uncharacterized RNA pseudouridine synthase YjbO Bacillus subtilis (strain 168)
Q9L7A7 3.76e-24 100 33 6 214 3 rluD Ribosomal large subunit pseudouridine synthase D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8P682 5.6e-24 100 34 5 225 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q87S65 1.03e-23 99 35 7 233 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q45480 1.19e-23 99 32 5 221 3 ylyB Uncharacterized RNA pseudouridine synthase YlyB Bacillus subtilis (strain 168)
Q89AD9 1.46e-23 99 32 5 216 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8ZBV7 1.47e-23 99 35 4 178 3 rluD Ribosomal large subunit pseudouridine synthase D Yersinia pestis
P47451 2.05e-23 98 32 4 210 3 MG209 Uncharacterized RNA pseudouridine synthase MG209 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P57481 2.57e-23 98 31 5 214 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9CNF3 2.7e-23 96 34 8 227 3 truC tRNA pseudouridine synthase C Pasteurella multocida (strain Pm70)
Q89AH2 3.48e-23 97 31 3 197 3 rluC Ribosomal large subunit pseudouridine synthase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8PHN2 5.77e-23 97 34 6 228 3 rluD Ribosomal large subunit pseudouridine synthase D Xanthomonas axonopodis pv. citri (strain 306)
P43930 7.24e-23 95 34 5 204 3 HI_0042 Uncharacterized RNA pseudouridine synthase HI_0042 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O50310 1.05e-22 96 31 6 237 3 Cpar_0723 Uncharacterized RNA pseudouridine synthase Cpar_0723 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q45826 1.28e-22 96 33 4 199 3 Caur_0901 Uncharacterized RNA pseudouridine synthase Caur_0901 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
P72970 1.85e-22 95 34 5 173 3 slr1592 Uncharacterized RNA pseudouridine synthase slr1592 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8K9E9 1.94e-22 95 31 5 184 3 rluD Ribosomal large subunit pseudouridine synthase D Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P65836 3.9e-22 95 35 3 173 1 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65837 3.9e-22 95 35 3 173 3 rluD Ribosomal large subunit pseudouridine synthase D Salmonella typhi
Q8DEV0 4.01e-22 95 33 6 223 3 rluD Ribosomal large subunit pseudouridine synthase D Vibrio vulnificus (strain CMCP6)
Q8DBG5 6.46e-22 93 35 8 224 3 truC tRNA pseudouridine synthase C Vibrio vulnificus (strain CMCP6)
P0A5T3 1.48e-21 93 34 6 214 3 BQ2027_MB1567 Uncharacterized RNA pseudouridine synthase Mb1567 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ3 1.48e-21 93 34 6 214 1 Rv1540 Uncharacterized RNA pseudouridine synthase Rv1540 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHQ2 1.48e-21 93 34 6 214 3 MT1592 Uncharacterized RNA pseudouridine synthase MT1592 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8VCZ8 1.64e-21 93 31 5 208 2 Rpusd1 RNA pseudouridylate synthase domain-containing protein 1 Mus musculus
Q9KTL4 2.27e-21 91 35 10 231 3 truC tRNA pseudouridine synthase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q12069 2.73e-21 94 32 3 182 1 PUS9 tRNA pseudouridine(32) synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8ZH72 3e-21 91 35 10 212 3 truC tRNA pseudouridine synthase C Yersinia pestis
Q17QT4 3.68e-21 92 31 6 222 2 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Bos taurus
Q87MD4 5.37e-21 90 33 8 225 3 truC tRNA pseudouridine synthase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q149F1 9.88e-21 93 32 3 176 1 Rpusd2 Pseudouridylate synthase RPUSD2 Mus musculus
P53294 1.28e-20 92 30 3 188 1 PUS6 tRNA pseudouridine(31) synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q47417 1.55e-20 91 32 8 225 3 truC tRNA pseudouridine synthase C Pectobacterium carotovorum subsp. carotovorum
Q9UJJ7 2.09e-20 90 30 6 222 1 RPUSD1 RNA pseudouridylate synthase domain-containing protein 1 Homo sapiens
P0AA42 3.24e-20 89 34 9 225 3 truC tRNA pseudouridine synthase C Shigella flexneri
P0AA41 3.24e-20 89 34 9 225 1 truC tRNA pseudouridine synthase C Escherichia coli (strain K12)
Q8X6T6 3.24e-20 89 34 9 225 3 truC tRNA pseudouridine synthase C Escherichia coli O157:H7
Q8IZ73 4.42e-20 91 33 4 177 1 RPUSD2 Pseudouridylate synthase RPUSD2 Homo sapiens
Q12362 5.59e-20 90 33 6 185 1 RIB2 Bifunctional protein RIB2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8FEF9 1.41e-19 87 34 9 225 3 truC tRNA pseudouridine synthase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P44197 8.56e-19 84 34 11 216 3 truC tRNA pseudouridine synthase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q09709 8.61e-19 87 29 5 196 3 SPAC18B11.02c Pseudouridylate synthase C18B11.02c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9HZM9 1.62e-18 85 34 6 198 3 rluC Ribosomal large subunit pseudouridine synthase C Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8ZMD5 2.12e-18 84 34 10 226 3 truC tRNA pseudouridine synthase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z439 2.98e-18 83 34 10 226 3 truC tRNA pseudouridine synthase C Salmonella typhi
Q28C59 4.65e-18 84 29 9 263 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Xenopus tropicalis
Q9ZMA1 5.49e-18 83 29 7 217 3 jhp_0321 Uncharacterized RNA pseudouridine synthase jhp_0321 Helicobacter pylori (strain J99 / ATCC 700824)
O25610 3.6e-17 80 30 7 202 3 HP_0956 Uncharacterized RNA pseudouridine synthase HP_0956 Helicobacter pylori (strain ATCC 700392 / 26695)
Q5M721 4.32e-17 82 30 8 219 2 At3g52260 RNA pseudouridine synthase 5 Arabidopsis thaliana
Q9ZKP5 5.06e-17 80 30 7 202 3 jhp_0890 Uncharacterized RNA pseudouridine synthase jhp_0890 Helicobacter pylori (strain J99 / ATCC 700824)
O25114 9.85e-17 80 28 8 213 1 HP_0347 Uncharacterized RNA pseudouridine synthase HP_0347 Helicobacter pylori (strain ATCC 700392 / 26695)
Q3ECD0 1.48e-16 80 26 7 268 2 At1g76050 RNA pseudouridine synthase 2, chloroplastic Arabidopsis thaliana
Q9LT72 2.31e-15 77 32 6 210 2 At3g19440 RNA pseudouridine synthase 4, mitochondrial Arabidopsis thaliana
Q5Z8P2 1.35e-14 75 26 8 278 2 Os06g0717400 RNA pseudouridine synthase 2, chloroplastic Oryza sativa subsp. japonica
O16686 4.78e-14 73 30 4 177 3 K07E8.7 Uncharacterized protein K07E8.7 Caenorhabditis elegans
Q0DST9 5.09e-14 73 30 7 209 2 Os03g0288500 RNA pseudouridine synthase 5 Oryza sativa subsp. japonica
Q96CM3 7.99e-14 72 31 4 192 1 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Homo sapiens
Q5E9Z1 4.16e-13 70 32 9 194 2 RPUSD4 Pseudouridylate synthase RPUSD4, mitochondrial Bos taurus
Q4QQT0 4.62e-13 70 31 7 195 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Rattus norvegicus
P47610 2.19e-12 68 26 8 215 3 MG370 Uncharacterized RNA pseudouridine synthase MG370 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
O25441 2.99e-12 67 28 6 224 3 HP_0745 Uncharacterized RNA pseudouridine synthase HP_0745 Helicobacter pylori (strain ATCC 700392 / 26695)
Q6DBR0 9.64e-12 66 27 6 195 2 rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Danio rerio
Q9LU60 2.16e-11 65 27 5 179 2 At5g51140 RNA pseudouridine synthase 7 Arabidopsis thaliana
Q5XET6 2.98e-11 65 32 7 194 2 At1g78910 RNA pseudouridine synthase 3, mitochondrial Arabidopsis thaliana
Q9CWX4 3.4e-11 65 32 6 193 2 Rpusd4 Pseudouridylate synthase RPUSD4, mitochondrial Mus musculus
Q6FS81 6.1e-11 63 26 5 192 3 PUS5 21S rRNA pseudouridine(2819) synthase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q9ZL98 2.46e-10 62 25 4 219 3 jhp_0682 Uncharacterized RNA pseudouridine synthase jhp_0682 Helicobacter pylori (strain J99 / ATCC 700824)
Q0E0Y3 7.95e-10 61 26 6 181 2 Os02g0512300 RNA pseudouridine synthase 7 Oryza sativa subsp. japonica
Q69K07 1.19e-09 60 30 6 176 2 Os09g0103500 RNA pseudouridine synthase 4, mitochondrial Oryza sativa subsp. japonica
Q0J4D4 1.12e-08 57 29 10 196 2 Os08g0520100 RNA pseudouridine synthase 3, mitochondrial Oryza sativa subsp. japonica
P75230 5.54e-08 55 26 6 187 3 MPN_548 Uncharacterized RNA pseudouridine synthase MG370 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q2QNM3 5.8e-08 55 26 9 257 2 Os12g0560500 RNA pseudouridine synthase 1 Oryza sativa subsp. japonica
Q06244 6.02e-07 52 25 6 178 1 PUS5 21S rRNA pseudouridine(2819) synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P45614 1.5e-06 51 26 8 188 3 MCAP_0714 Uncharacterized RNA pseudouridine synthase MCAP_0714 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8I3Z1 2.73e-05 48 27 2 90 1 PFE0570w MATH and LRR domain-containing protein PFE0570w Plasmodium falciparum (isolate 3D7)
Q8I3Z1 0.000234 45 34 1 70 1 PFE0570w MATH and LRR domain-containing protein PFE0570w Plasmodium falciparum (isolate 3D7)
Q14AI6 3.36e-05 47 26 4 183 2 Rpusd3 Mitochondrial mRNA pseudouridine synthase Rpusd3 Mus musculus
Q7XA65 0.000206 45 29 2 92 2 At1g56345 RNA pseudouridine synthase 1 Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11520
Feature type CDS
Gene rluA
Product bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA
Location 2540379 - 2541032 (strand: 1)
Length 654 (nucleotides) / 217 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1159
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00849 RNA pseudouridylate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0564 Translation, ribosomal structure and biogenesis (J) J Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06177 tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29] - -

Protein Sequence

MMEVYNPPTDPWLHVLYQDEHIIVVNKPSGLLSVPGKALEHHDSIMSRIKADFPDAESVHRLDMATSGVMVVALNKAAERELKRQFREREPKKTYIARVWGKLEKPQGLVDLPLICDWPNRPKQKVCYETGKSAQTFYEVLEYEENATRVKLSPITGRSHQLRVHMLALGHPILGDRFYAHPQARALAPRLQLHAQELFITHPAFHSPIHFECLADF

Flanking regions ( +/- flanking 50bp)

AAAACGGGGGAAAGCTTTATCTCCCCCGTTATTTTGCTGAGATATCCACTATGATGGAAGTTTATAACCCCCCCACTGATCCTTGGTTACACGTTTTATATCAAGATGAGCATATTATTGTTGTTAATAAACCCAGTGGATTGCTATCTGTACCCGGCAAAGCGCTAGAACATCACGACAGCATTATGTCGCGTATAAAAGCCGATTTTCCTGATGCGGAATCTGTTCATCGCCTTGATATGGCCACGAGTGGTGTGATGGTTGTTGCGCTTAATAAAGCCGCCGAGCGTGAATTAAAACGCCAATTTCGTGAACGAGAGCCGAAAAAAACCTATATTGCCCGTGTCTGGGGAAAGCTTGAAAAACCACAAGGATTAGTTGATCTGCCGTTGATCTGCGATTGGCCTAATCGACCTAAGCAAAAAGTATGTTATGAAACAGGAAAGTCTGCACAAACTTTTTATGAAGTGTTGGAATATGAAGAAAATGCAACGCGGGTAAAACTATCACCAATAACCGGACGCTCCCATCAGCTACGGGTTCATATGCTAGCATTAGGTCATCCTATTTTAGGGGATCGTTTTTATGCCCATCCGCAGGCAAGAGCACTCGCACCTCGCCTGCAGTTACATGCTCAGGAATTATTTATTACGCATCCGGCCTTTCATTCACCGATACATTTTGAATGCCTGGCAGATTTTTAACCTGTCTTACGACACTAAAACGGTCACCGAACTTAGTGAAGCAAGGAGCA