Homologs in group_1343

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07815 FBDBKF_07815 53.6 Morganella morganii S1 fixJ DNA-binding response regulator, FixJ family, consists of REC and HTH domains
EHELCC_13645 EHELCC_13645 53.6 Morganella morganii S2 fixJ DNA-binding response regulator, FixJ family, consists of REC and HTH domains
NLDBIP_14090 NLDBIP_14090 53.6 Morganella morganii S4 fixJ DNA-binding response regulator, FixJ family, consists of REC and HTH domains
LHKJJB_08760 LHKJJB_08760 53.6 Morganella morganii S3 fixJ DNA-binding response regulator, FixJ family, consists of REC and HTH domains
HKOGLL_08310 HKOGLL_08310 53.6 Morganella morganii S5 fixJ DNA-binding response regulator, FixJ family, consists of REC and HTH domains
F4V73_RS13230 F4V73_RS13230 55.0 Morganella psychrotolerans - LuxR C-terminal-related transcriptional regulator

Distribution of the homologs in the orthogroup group_1343

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1343

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P26487 1.18e-24 99 29 2 194 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8KR08 5.2e-23 95 29 2 197 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
Q3LWR6 6.94e-22 92 28 2 196 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 6.94e-22 92 28 2 196 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 6.94e-22 92 28 2 196 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P10958 8.71e-22 91 28 4 197 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
P23221 2.5e-21 90 26 2 194 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P37740 9.34e-20 86 25 3 200 3 dctR C4-dicarboxylate transport transcriptional regulatory protein DctR Rhodobacter capsulatus
P15940 6.39e-19 84 29 2 189 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O87940 1.32e-18 84 30 6 192 1 tdiR Transcriptional regulatory protein TdiR Thauera aromatica
Q7CQM8 1.65e-11 64 21 4 201 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AFB8 6.36e-10 61 22 1 129 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 6.36e-10 61 22 1 129 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P41789 7.82e-10 61 22 1 129 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q46791 1.22e-09 58 31 0 102 1 ygeK Uncharacterized response regulatory protein YgeK Escherichia coli (strain K12)
P0AEL8 1.42e-09 58 25 2 162 3 fimZ Fimbriae Z protein Escherichia coli (strain K12)
P0AEL9 1.42e-09 58 25 2 162 3 fimZ Fimbriae Z protein Escherichia coli O157:H7
P03029 2.36e-09 59 21 1 129 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P58664 3.92e-09 57 31 0 98 4 ygeK Uncharacterized response regulatory protein YgeK Escherichia coli O157:H7
Q4L8Q6 1.65e-08 56 44 1 69 3 nreC Oxygen regulatory protein NreC Staphylococcus haemolyticus (strain JCSC1435)
Q7A029 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MW2)
A8Z580 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6T0 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MSSA476)
Q6GE42 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MRSA252)
Q7A3U5 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain N315)
Q99RN8 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJN1 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Newman)
Q5HDG5 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain COL)
Q2YZ42 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IVH2 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH9)
Q2FVM7 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEA6 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300)
A6U4C0 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH1)
A7X623 1.93e-08 55 47 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu3 / ATCC 700698)
P26319 2.55e-08 55 24 4 163 3 fimZ Fimbriae Z protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P27667 5.02e-08 54 30 3 130 3 uhpA Transcriptional regulatory protein UhpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5HLK6 5.15e-08 54 46 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN75 5.8e-08 54 46 1 65 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P0AGA9 6.83e-08 53 30 3 130 3 uhpA Transcriptional regulatory protein UhpA Shigella flexneri
P0AGA6 6.83e-08 53 30 3 130 1 uhpA Transcriptional regulatory protein UhpA Escherichia coli (strain K12)
P0AGA7 6.83e-08 53 30 3 130 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGA8 6.83e-08 53 30 3 130 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O157:H7
Q7WZY4 1.06e-07 53 45 1 68 1 nreC Oxygen regulatory protein NreC Staphylococcus carnosus (strain TM300)
Q1XDE4 1.66e-07 53 29 3 121 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P48359 3.98e-07 52 25 2 126 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P25852 5.03e-07 52 26 3 123 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z333 6.23e-07 52 26 3 123 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P13800 2.97e-06 49 26 4 169 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
P28787 4.76e-06 50 28 0 64 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q1M7A0 4.85e-06 48 23 2 140 3 mctR Transcriptional regulatory protein MctR Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q68WH4 7.73e-06 49 30 1 110 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q1RJS1 8.04e-06 49 28 1 116 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P14375 9.67e-06 48 24 2 125 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q92HC2 9.83e-06 48 28 3 143 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P51343 1.02e-05 48 28 2 123 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q4UL27 1.48e-05 48 29 1 116 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ZCY9 1.69e-05 48 30 1 110 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
P45671 1.76e-05 48 21 1 123 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
O78417 2.02e-05 47 24 5 157 3 ycf29 Probable transcriptional regulator ycf29 Guillardia theta
Q8X613 2.17e-05 47 24 2 122 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P32967 2.31e-05 47 30 3 102 1 gacA Response regulator GacA Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P66797 2.54e-05 47 29 2 103 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 2.54e-05 47 29 2 103 3 uvrY Response regulator UvrY Escherichia coli O157:H7
Q51373 2.58e-05 47 28 1 103 3 gacA Response regulator GacA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AED6 2.68e-05 47 29 2 103 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 2.68e-05 47 29 2 103 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
P59969 3.43e-05 47 36 0 57 4 BQ2027_MB0914C Putative HTH-type transcriptional regulator Mb0914c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG0 3.43e-05 47 36 0 57 4 MT0914 Putative HTH-type transcriptional regulator MT0914 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0ACZ7 3.48e-05 46 24 2 148 1 evgA DNA-binding transcriptional activator EvgA Shigella flexneri
P0ACZ4 3.48e-05 46 24 2 148 1 evgA DNA-binding transcriptional activator EvgA Escherichia coli (strain K12)
P0ACZ5 3.48e-05 46 24 2 148 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACZ6 3.48e-05 46 24 2 148 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O157:H7
P9WMG1 4.33e-05 47 36 0 57 1 Rv0890c Putative HTH-type transcriptional regulator Rv0890c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P56644 4.36e-05 46 27 2 118 3 sgaR Probable transcriptional regulatory protein SgaR Hyphomicrobium methylovorum
Q06065 5.04e-05 47 25 1 84 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P24908 8.51e-05 45 24 3 149 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A4H2 0.000115 45 24 2 150 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 0.000115 45 24 2 150 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 0.000115 45 24 2 150 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q04848 0.000122 45 24 2 117 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q7CQM5 0.000124 45 40 0 52 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9APD9 0.000225 45 27 0 73 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q52376 0.000254 43 28 1 103 3 gacA Response regulator GacA Pseudomonas syringae pv. syringae (strain B728a)
O34723 0.000259 43 29 4 131 1 desR Transcriptional regulatory protein DesR Bacillus subtilis (strain 168)
P95582 0.000262 43 28 1 103 3 gacA Response regulator GacA Pseudomonas viridiflava
O07528 0.00028 43 36 1 71 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
P10576 0.000322 44 23 2 124 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
P31802 0.000691 42 32 2 105 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10800
Feature type CDS
Gene -
Product LuxR C-terminal-related transcriptional regulator
Location 2379289 - 2379924 (strand: 1)
Length 636 (nucleotides) / 211 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1343
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00196 Bacterial regulatory proteins, luxR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4566 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, FixJ family, consists of REC and HTH domains

Protein Sequence

MESIIHLITFEDDSTKVQLKAVLSSLAANVKTYSNEQAFLKYYFSSTKGAHKECIIINTKSSASPSIALVKELNKLKNIIPVIIISGDASIESCRNAFKAGAFEYLTRPLNVNELLNIVSESFLHYESEVEQFRTYISLKDKFSKLSNREKEVMEMILDGNTSKEAAEKLSLSPRTVEVHRSNMYTKLKIRSLPQLVQEYDFFKKYDLRAN

Flanking regions ( +/- flanking 50bp)

CGTTACTCATTTACTCTTGATTAAGAGAGGAATAAAATTGGGAGCAACATATGGAATCGATAATCCATCTGATCACTTTCGAAGATGACAGCACAAAAGTTCAACTTAAAGCAGTGCTTTCTTCTTTAGCGGCAAATGTGAAAACCTATTCAAATGAACAGGCATTTTTAAAGTACTATTTTTCATCAACTAAAGGGGCTCATAAAGAGTGCATCATAATTAACACTAAAAGTAGTGCATCGCCATCAATTGCGTTGGTAAAAGAGTTAAACAAATTAAAGAATATCATTCCTGTTATAATTATTTCGGGAGATGCATCGATAGAAAGTTGCCGTAACGCATTTAAAGCGGGGGCTTTCGAATATTTAACTCGCCCTTTAAACGTCAATGAGCTTCTTAATATTGTGTCAGAATCTTTTTTACACTATGAAAGTGAGGTTGAGCAATTCAGAACCTATATTTCTTTAAAAGATAAGTTTAGTAAACTATCAAATAGAGAAAAAGAGGTAATGGAGATGATCCTTGACGGTAACACCAGTAAAGAAGCAGCCGAAAAGCTCTCTTTATCACCAAGAACAGTGGAAGTTCATCGTTCGAATATGTATACAAAACTAAAAATAAGATCACTACCACAACTAGTACAAGAATATGATTTCTTTAAAAAATATGACTTAAGAGCCAATTAAATTTAGCCCGTATATCTTCTTTATCATTAGATGATATCCAGCGCTTGTAT