Homologs in group_865

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04375 FBDBKF_04375 77.0 Morganella morganii S1 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
EHELCC_05665 EHELCC_05665 77.0 Morganella morganii S2 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
NLDBIP_05985 NLDBIP_05985 77.0 Morganella morganii S4 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
LHKJJB_02865 LHKJJB_02865 77.0 Morganella morganii S3 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
HKOGLL_06340 HKOGLL_06340 77.0 Morganella morganii S5 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
F4V73_RS08820 F4V73_RS08820 76.5 Morganella psychrotolerans rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH

Distribution of the homologs in the orthogroup group_865

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_865

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F119 0.0 638 100 0 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Proteus mirabilis (strain HI4320)
Q7N139 0.0 509 78 1 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DEV1 9.15e-178 496 77 2 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D0H5 7.17e-176 491 76 2 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JJI5 7.64e-176 492 75 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZRU8 1.52e-173 486 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TXH0 1.52e-173 486 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella schwarzengrund (strain CVM19633)
C0Q5H8 1.52e-173 486 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella paratyphi C (strain RKS4594)
B4TJ79 1.52e-173 486 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella heidelberg (strain SL476)
B5RH56 1.52e-173 486 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2L6 1.52e-173 486 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella enteritidis PT4 (strain P125109)
B5FI64 1.52e-173 486 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella dublin (strain CT_02021853)
B5F7V6 1.52e-173 486 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella agona (strain SL483)
B4SU42 1.81e-173 486 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella newport (strain SL254)
A9MZL1 2.77e-173 485 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5BLG4 3.12e-173 485 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella paratyphi A (strain AKU_12601)
Q5PDH4 3.12e-173 485 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A6T4M5 3.45e-173 485 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q32K10 3.72e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella dysenteriae serotype 1 (strain Sd197)
A9MQD1 4.89e-173 484 74 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8ALL4 6.6e-173 484 73 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q326F3 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella boydii serotype 4 (strain Sb227)
B2U287 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWH0 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RGB3 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain UTI89 / UPEC)
B1LG19 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain SMS-3-5 / SECEC)
B6HZ59 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain SE11)
B7N7V5 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P60390 9.75e-173 484 73 1 308 1 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain K12)
B1IR96 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TLQ7 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7C7 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O1:K1 / APEC
A7ZW34 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O9:H4 (strain HS)
B1XC59 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain K12 / DH10B)
C4ZQ04 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain K12 / MC4100 / BW2952)
C6UM45 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain B / REL606)
C5W331 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain B / BL21-DE3)
B7M125 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O8 (strain IAI1)
B5YZB8 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O157:H7 (strain EC4115 / EHEC)
P60391 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O157:H7
B7LFV2 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain 55989 / EAEC)
B7MAK5 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZHH3 9.75e-173 484 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O139:H28 (strain E24377A / ETEC)
B5Y1V5 1.18e-172 483 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Klebsiella pneumoniae (strain 342)
Q3Z5S7 1.53e-172 483 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella sonnei (strain Ss046)
A8G9R9 1.88e-172 483 73 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Serratia proteamaculans (strain 568)
Q57TD8 2.44e-172 483 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella choleraesuis (strain SC-B67)
C6CJW6 3.75e-172 482 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Dickeya chrysanthemi (strain Ech1591)
B7MNU1 3.88e-172 482 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O81 (strain ED1a)
B7NHI8 4.67e-172 482 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O7:K1 (strain IAI39 / ExPEC)
C6C9K0 5.63e-172 482 74 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Musicola paradisiaca (strain Ech703)
A7MIE1 6.71e-172 481 75 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Cronobacter sakazakii (strain ATCC BAA-894)
Q83SN7 8.35e-172 481 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella flexneri
Q0T8B5 9.42e-172 481 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella flexneri serotype 5b (strain 8401)
B7UID2 1.51e-171 481 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8Z9H4 1.8e-171 480 73 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella typhi
B1JK89 8.25e-171 479 73 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EL3 8.25e-171 479 73 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CMN5 8.25e-171 479 73 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pestis bv. Antiqua (strain Nepal516)
A9R132 8.25e-171 479 73 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIF7 8.25e-171 479 73 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pestis
B2K4D8 8.25e-171 479 73 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C206 8.25e-171 479 73 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM74 8.25e-171 479 73 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4W6I5 4.75e-170 477 71 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Enterobacter sp. (strain 638)
Q8FL68 1.19e-169 476 72 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B2VD83 2.6e-169 475 73 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C5B9E8 6.29e-168 471 76 1 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Edwardsiella ictaluri (strain 93-146)
A4TQ91 2.28e-167 470 73 2 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pestis (strain Pestoides F)
Q7MNV9 7.8e-160 451 70 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio vulnificus (strain YJ016)
Q8DEK2 7.8e-160 451 70 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio vulnificus (strain CMCP6)
Q9AJG9 1.39e-158 448 70 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio proteolyticus
A7MWK7 1.57e-158 448 70 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio campbellii (strain ATCC BAA-1116)
P62475 1.04e-157 446 74 2 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Photobacterium profundum (strain SS9)
Q2NVV9 2.87e-157 444 69 2 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Sodalis glossinidius (strain morsitans)
A0KPY0 9.72e-157 443 71 3 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q5E2P2 8.49e-156 441 69 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9AJH1 1.4e-155 440 69 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A4SI48 1.45e-155 440 71 3 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Aeromonas salmonicida (strain A449)
B5FB43 9.13e-155 438 69 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Aliivibrio fischeri (strain MJ11)
B7VIZ5 2.79e-154 437 69 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio atlanticus (strain LGP32)
C3LQV4 1.2e-153 436 68 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio cholerae serotype O1 (strain M66-2)
Q9KPF9 1.2e-153 436 68 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B6ELI3 1.79e-150 427 67 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Aliivibrio salmonicida (strain LFI1238)
A1SU11 3.28e-149 424 68 3 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C4LA17 5.43e-146 416 66 3 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B3GZK0 5.94e-146 416 63 3 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A9KY21 7.39e-146 416 66 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella baltica (strain OS195)
A6WIC3 7.39e-146 416 66 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella baltica (strain OS185)
A3CZL3 7.39e-146 416 66 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4L2 7.39e-146 416 66 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella baltica (strain OS223)
Q12SD4 2.57e-145 414 64 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8F3A8 3.02e-145 414 65 3 307 3 rsmH Ribosomal RNA small subunit methyltransferase H Glaesserella parasuis serovar 5 (strain SH0165)
B0BRG9 3.86e-145 414 63 3 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3MY82 1.62e-144 412 63 3 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0HZS4 3.19e-144 411 65 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella sp. (strain MR-7)
A0L1Q0 3.19e-144 411 65 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella sp. (strain ANA-3)
Q0HE75 4.62e-144 411 65 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella sp. (strain MR-4)
A3QIM9 4.83e-144 411 64 5 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8E9P0 7.9e-144 410 64 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0TQM9 1.31e-143 410 64 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella halifaxensis (strain HAW-EB4)
A1REY8 1.32e-143 410 65 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella sp. (strain W3-18-1)
A4Y2M8 1.32e-143 410 65 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q07WH7 2.31e-143 409 63 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella frigidimarina (strain NCIMB 400)
Q65RX8 4.12e-143 409 64 4 324 3 rsmH Ribosomal RNA small subunit methyltransferase H Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1S2F1 6.38e-143 408 64 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B0US59 3.87e-142 406 64 3 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Histophilus somni (strain 2336)
B1KKY5 9.41e-142 405 64 5 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella woodyi (strain ATCC 51908 / MS32)
A8FQ92 1.58e-141 405 64 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella sediminis (strain HAW-EB3)
Q9F1N8 1.24e-140 402 63 5 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
B8CM48 1.67e-140 402 64 5 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella piezotolerans (strain WP3 / JCM 13877)
Q0I1E1 1.87e-140 402 64 3 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Histophilus somni (strain 129Pt)
Q7VP62 2.13e-140 402 64 3 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C6AKG2 4.32e-140 401 62 4 324 3 rsmH Ribosomal RNA small subunit methyltransferase H Aggregatibacter aphrophilus (strain NJ8700)
A8H992 1.01e-139 400 63 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q9CPB4 3.29e-139 399 63 2 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Pasteurella multocida (strain Pm70)
A5UCX6 1.85e-138 397 63 3 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Haemophilus influenzae (strain PittEE)
Q4QLG6 1.85e-138 397 63 3 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Haemophilus influenzae (strain 86-028NP)
A6VQP1 2.09e-138 397 63 4 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P45057 3.1e-138 397 63 3 312 1 rsmH Ribosomal RNA small subunit methyltransferase H Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C4K744 5.19e-138 395 62 1 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B4RWY7 1.14e-137 395 63 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q3IFZ6 1.63e-136 392 61 4 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudoalteromonas translucida (strain TAC 125)
Q15Q09 2.72e-131 379 61 5 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5R0L7 1.34e-129 374 58 4 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1LSW0 4.4e-127 368 58 2 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Baumannia cicadellinicola subsp. Homalodisca coagulata
Q47VQ1 6.52e-127 368 60 4 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A5UIQ3 5.23e-123 357 65 1 263 3 rsmH Ribosomal RNA small subunit methyltransferase H Haemophilus influenzae (strain PittGG)
B3PCM8 7.79e-121 352 56 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Cellvibrio japonicus (strain Ueda107)
P59522 6e-119 347 53 2 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q493Q9 1.24e-117 345 52 3 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Blochmanniella pennsylvanica (strain BPEN)
A1U3G6 5.07e-117 343 56 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
O85295 3.67e-116 340 52 1 304 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8GMM1 1.33e-115 339 57 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q31I68 4.24e-115 338 54 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P57319 4.42e-115 337 52 1 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D922 4.42e-115 337 52 1 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D7C6 5.81e-114 335 52 1 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Q7VQJ5 1.84e-113 334 53 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Blochmanniella floridana
Q1QVF9 3.49e-112 331 56 4 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q83F35 6.1e-112 329 53 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NA25 6.1e-112 329 53 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J5L7 6.1e-112 329 53 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Coxiella burnetii (strain CbuK_Q154)
A9KET2 2.36e-111 328 53 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Coxiella burnetii (strain Dugway 5J108-111)
Q13TY4 3.73e-111 328 53 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Paraburkholderia xenovorans (strain LB400)
B2JHG8 1.21e-110 327 53 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B2SYY3 1.79e-110 326 53 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A4XQR6 2.35e-110 325 52 5 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas mendocina (strain ymp)
Q47A96 3.28e-110 325 52 4 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Dechloromonas aromatica (strain RCB)
Q2Y630 3.64e-110 325 53 4 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B6J2R7 3.94e-110 325 53 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Coxiella burnetii (strain CbuG_Q212)
A3NZM3 7.62e-110 324 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia pseudomallei (strain 1106a)
C1D5M5 7.65e-110 324 52 3 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Laribacter hongkongensis (strain HLHK9)
C5BP42 8.68e-110 324 52 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q3SMI1 1.99e-109 323 55 4 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Thiobacillus denitrificans (strain ATCC 25259)
A3NDX2 3.92e-109 322 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia pseudomallei (strain 668)
Q3JND0 3.92e-109 322 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia pseudomallei (strain 1710b)
A1V0S6 3.92e-109 322 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia mallei (strain SAVP1)
Q62GR9 3.92e-109 322 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia mallei (strain ATCC 23344)
A2S5V3 3.92e-109 322 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia mallei (strain NCTC 10229)
A3MR55 3.92e-109 322 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia mallei (strain NCTC 10247)
Q2S9Y4 5.18e-109 322 53 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Hahella chejuensis (strain KCTC 2396)
Q2SZJ1 1.01e-108 321 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QI9 1.13e-108 321 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia pseudomallei (strain K96243)
Q5WXZ4 3.2e-108 320 51 4 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Legionella pneumophila (strain Lens)
Q5ZX19 3.2e-108 320 51 4 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X6J0 3.2e-108 320 51 4 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Legionella pneumophila (strain Paris)
Q48EF0 3.21e-108 320 51 5 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1GYZ3 4.02e-108 320 54 3 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
C1DQ91 4.22e-108 320 51 5 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A5IFZ9 7.75e-108 319 51 4 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Legionella pneumophila (strain Corby)
B1YSR6 8.57e-108 319 52 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia ambifaria (strain MC40-6)
Q21MH7 1.09e-107 319 50 5 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q87WX7 1.15e-107 319 51 5 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B0V8N7 1.18e-107 318 52 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain AYE)
A3M9K5 1.18e-107 318 52 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I0K7 1.18e-107 318 52 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain ACICU)
B7GVN1 1.18e-107 318 52 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain AB307-0294)
Q0BIK9 1.37e-107 318 52 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q4K6I5 1.5e-107 318 52 6 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q7NPZ1 1.59e-107 318 52 5 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q4ZNY2 2.58e-107 318 51 5 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas syringae pv. syringae (strain B728a)
B0KFT4 3.78e-107 317 51 6 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas putida (strain GB-1)
B1J1Y2 4.41e-107 317 50 6 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas putida (strain W619)
A2SCX7 4.51e-107 317 52 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A4JB86 5.02e-107 317 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9AJ24 1.02e-106 316 52 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia multivorans (strain ATCC 17616 / 249)
B7IAX1 1.18e-106 316 52 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain AB0057)
B1JUW4 1.3e-106 316 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia orbicola (strain MC0-3)
A0K478 1.3e-106 316 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia cenocepacia (strain HI2424)
Q88N84 1.7e-106 316 51 6 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q39JX8 1.72e-106 316 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
C3KCS2 2.34e-106 315 51 6 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas fluorescens (strain SBW25)
A5W8Q8 2.58e-106 315 51 6 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4VIH0 8.93e-106 314 49 5 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Stutzerimonas stutzeri (strain A1501)
B9MFS0 1.11e-105 313 53 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Acidovorax ebreus (strain TPSY)
Q6F7D1 1.5e-105 313 52 6 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0VPF9 1.66e-105 313 52 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain SDF)
A1WC14 2.13e-105 313 53 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Acidovorax sp. (strain JS42)
Q1BZH1 2.23e-105 313 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia orbicola (strain AU 1054)
A6T2G6 3.14e-105 313 51 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Janthinobacterium sp. (strain Marseille)
B4E6K0 3.41e-105 312 51 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1I5B0 3.73e-105 312 50 6 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas entomophila (strain L48)
Q02H20 6.71e-105 311 50 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9HVZ5 9.4e-105 311 50 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UZJ8 1.85e-104 310 50 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas aeruginosa (strain LESB58)
Q9K0Z0 1.92e-104 311 50 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A6VYK6 3.22e-104 310 49 7 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Marinomonas sp. (strain MWYL1)
A4G8U6 3.64e-104 310 50 4 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Herminiimonas arsenicoxydans
A1KVM4 6.5e-104 310 49 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q3K736 6.62e-104 309 50 5 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas fluorescens (strain Pf0-1)
A6VB93 8.5e-104 309 50 5 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas aeruginosa (strain PA7)
B4RQD7 1.16e-103 309 50 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria gonorrhoeae (strain NCCP11945)
Q9JSY9 1.41e-103 309 50 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F6K7 1.91e-103 308 49 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9M2I4 8.32e-103 307 50 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria meningitidis serogroup C (strain 053442)
C6BEJ1 9.07e-103 306 51 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Ralstonia pickettii (strain 12D)
Q0AJD3 1.69e-102 306 49 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8D2Y8 2.26e-102 305 47 1 307 3 rsmH Ribosomal RNA small subunit methyltransferase H Wigglesworthia glossinidia brevipalpis
Q82VT1 3.07e-102 305 50 4 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1VSU4 3.49e-102 305 50 4 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Polaromonas naphthalenivorans (strain CJ2)
Q8XVH9 3.58e-102 305 50 5 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1WRK3 4.7e-102 305 50 4 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Verminephrobacter eiseniae (strain EF01-2)
Q0VS10 7.41e-102 304 51 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5P6Y9 8.54e-102 304 54 4 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B2UCY5 1.35e-101 303 50 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Ralstonia pickettii (strain 12J)
Q5GW34 4.01e-101 303 51 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SNY6 8.33e-101 302 51 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZB1 8.33e-101 302 51 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3J781 3.83e-100 300 52 4 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q12EM3 9.64e-100 298 49 3 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q0A6J4 9.77e-100 299 52 6 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1WYV1 1.23e-99 299 49 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Halorhodospira halophila (strain DSM 244 / SL1)
Q1LIL8 1.63e-99 298 50 4 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A1K3T8 1.84e-99 298 52 4 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Azoarcus sp. (strain BH72)
B1XY20 3.65e-99 298 51 4 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q46WY6 4.06e-99 298 50 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B3R6W7 6.64e-99 297 50 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q8PPB5 1.16e-98 297 51 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas axonopodis pv. citri (strain 306)
Q3BXF9 1.55e-98 296 51 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
C5CNE6 2.04e-98 295 49 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Variovorax paradoxus (strain S110)
Q604V0 3.79e-98 294 50 4 305 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1AVX1 4.05e-98 294 48 4 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Ruthia magnifica subsp. Calyptogena magnifica
Q0K6L6 4.75e-98 295 50 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A5CX97 1.07e-97 293 48 4 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B1XT01 2.39e-97 293 48 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q8PCK7 1.62e-96 291 51 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVB2 1.62e-96 291 51 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas campestris pv. campestris (strain B100)
B2FNN0 2.3e-96 290 51 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Stenotrophomonas maltophilia (strain K279a)
B4SJW8 2.7e-96 290 51 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Stenotrophomonas maltophilia (strain R551-3)
B0U504 1.24e-95 288 50 7 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Xylella fastidiosa (strain M12)
Q4UQW3 2.05e-95 288 50 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas campestris pv. campestris (strain 8004)
Q21SW1 5.41e-95 286 49 6 323 3 rsmH Ribosomal RNA small subunit methyltransferase H Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q7VUP6 1.03e-94 288 51 4 292 3 rsmH Ribosomal RNA small subunit methyltransferase H Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4A7 1.03e-94 288 51 4 292 3 rsmH Ribosomal RNA small subunit methyltransferase H Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFR5 1.03e-94 288 51 4 292 3 rsmH Ribosomal RNA small subunit methyltransferase H Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q87AF2 1.08e-94 286 50 8 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9C0 1.08e-94 286 50 8 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Xylella fastidiosa (strain M23)
Q9PF88 7.69e-94 283 50 7 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Xylella fastidiosa (strain 9a5c)
A4SV66 9.73e-92 278 47 6 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A9BUJ8 1.97e-90 275 51 7 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Delftia acidovorans (strain DSM 14801 / SPH-1)
C0ZGB3 2.84e-90 275 47 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A1TKC3 9.71e-90 273 50 4 305 3 rsmH Ribosomal RNA small subunit methyltransferase H Paracidovorax citrulli (strain AAC00-1)
Q057T6 1.44e-89 272 47 1 305 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A9I4S5 7.19e-89 273 51 4 292 3 rsmH Ribosomal RNA small subunit methyltransferase H Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A5WBQ1 2.49e-87 268 44 6 325 3 rsmH Ribosomal RNA small subunit methyltransferase H Psychrobacter sp. (strain PRwf-1)
Q2KVE4 3.4e-87 268 47 5 304 3 rsmH Ribosomal RNA small subunit methyltransferase H Bordetella avium (strain 197N)
Q4FQ05 8.1e-87 266 42 7 335 3 rsmH Ribosomal RNA small subunit methyltransferase H Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q9K9S0 1.48e-86 265 46 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A5EY11 7.97e-86 263 48 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Dichelobacter nodosus (strain VCS1703A)
Q5NGY1 3.47e-85 261 45 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14ID3 3.47e-85 261 45 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. tularensis (strain FSC 198)
Q07876 3.6e-85 261 46 6 313 2 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus subtilis (strain 168)
A0Q5I5 5.47e-85 261 44 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. novicida (strain U112)
B2SDL2 5.59e-85 261 45 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. mediasiatica (strain FSC147)
A0L5N9 6.9e-85 261 45 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A8MH28 8.77e-85 260 46 5 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Alkaliphilus oremlandii (strain OhILAs)
Q1Q846 1.1e-84 261 42 6 329 3 rsmH Ribosomal RNA small subunit methyltransferase H Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A6LTS0 1.82e-84 259 45 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q03EX7 2.02e-84 259 44 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B0TZ13 5.64e-84 258 44 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0BKT7 8.64e-84 258 44 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. holarctica (strain OSU18)
Q2A265 8.64e-84 258 44 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. holarctica (strain LVS)
A7NDP7 8.64e-84 258 44 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q65JY8 1.31e-83 257 44 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A4XHZ6 2.39e-83 256 44 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q49WW1 2.8e-83 256 45 7 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B1IKR0 4.68e-83 256 44 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Okra / Type B1)
A0Q055 6.41e-83 256 43 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium novyi (strain NT)
A5I1T3 6.92e-83 255 44 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FTX8 6.92e-83 255 44 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain ATCC 19397 / Type A)
A7GRP4 7.96e-83 255 44 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
C1FME6 2.12e-82 254 44 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Kyoto / Type A2)
A7GDE2 2.16e-82 254 44 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q97H81 2.33e-82 254 44 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A4IZB0 2.6e-82 254 44 5 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. tularensis (strain WY96-3418)
C3KV90 3.49e-82 254 44 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain 657 / Type Ba4)
B5ELD1 9.42e-82 253 48 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J3W0 9.42e-82 253 48 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A7Z4D7 1.08e-81 253 44 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B1L164 1.4e-81 252 43 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Loch Maree / Type A3)
Q6HEP6 3.63e-81 251 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus thuringiensis subsp. konkukian (strain 97-27)
A9B518 6.24e-81 251 44 6 327 3 rsmH Ribosomal RNA small subunit methyltransferase H Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q182Z2 6.31e-81 251 42 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridioides difficile (strain 630)
B2V4W0 8.03e-81 250 44 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Alaska E43 / Type E3)
A6QG79 8.1e-81 250 43 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain Newman)
Q5HGQ2 8.1e-81 250 43 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain COL)
B2TS30 8.85e-81 250 44 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Eklund 17B / Type B)
A6TS69 9.43e-81 250 42 5 314 3 rsmH1 Ribosomal RNA small subunit methyltransferase H 1 Alkaliphilus metalliredigens (strain QYMF)
Q636A8 9.44e-81 250 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain ZK / E33L)
C1EPT2 9.44e-81 250 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain 03BB102)
B7JK06 9.44e-81 250 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain AH820)
Q81WC3 9.44e-81 250 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus anthracis
A0RHT9 9.44e-81 250 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus thuringiensis (strain Al Hakam)
C3L6F3 9.44e-81 250 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P688 9.44e-81 250 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus anthracis (strain A0248)
B9IVZ5 9.55e-81 250 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain Q1)
P62468 9.55e-81 250 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain ATCC 10987 / NRS 248)
B7HM39 9.65e-81 250 44 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain AH187)
A5D113 1.16e-80 250 43 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B7H6Q4 1.81e-80 249 43 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain B4264)
Q5HQ13 2.11e-80 249 43 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P60394 2.5e-80 249 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain MW2)
A8Z3M0 2.5e-80 249 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain USA300 / TCH1516)
Q6GA33 2.5e-80 249 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain MSSA476)
Q6GHQ6 2.5e-80 249 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain MRSA252)
P60392 2.5e-80 249 42 6 313 1 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain N315)
P60485 2.5e-80 249 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IS65 2.5e-80 249 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain JH9)
P60393 2.5e-80 249 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHQ8 2.5e-80 249 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain USA300)
A6U0Z9 2.5e-80 249 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain JH1)
A7X1B8 2.5e-80 249 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8R9F9 3.8e-80 248 45 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8CSX7 5.18e-80 248 43 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q2YXE3 5.18e-80 248 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain bovine RF122 / ET3-1)
A9VU80 5.24e-80 248 43 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus mycoides (strain KBAB4)
C6DZJ8 5.52e-80 248 45 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacter sp. (strain M21)
A4J2A3 8.6e-80 248 43 7 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
P60398 9.17e-80 248 46 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3AAD7 9.51e-80 248 45 7 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B9MQ93 1.11e-79 247 43 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q819P8 1.16e-79 247 43 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7IVF3 1.16e-79 247 43 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain G9842)
Q929X6 1.29e-79 247 43 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A8HZ68 1.33e-79 248 46 6 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B9DPQ9 2.15e-79 246 44 7 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus carnosus (strain TM300)
C5D8L5 2.22e-79 246 43 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacillus sp. (strain WCH70)
O07104 3.81e-79 246 42 5 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Enterococcus faecalis (strain ATCC 700802 / V583)
B3QFN9 4.09e-79 246 46 7 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodopseudomonas palustris (strain TIE-1)
B8G5X3 1.03e-78 244 45 7 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q1WT95 1.57e-78 244 43 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Ligilactobacillus salivarius (strain UCC118)
Q88V76 2e-78 244 41 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B8DH88 2.09e-78 244 42 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria monocytogenes serotype 4a (strain HCC23)
A0AKE1 4.27e-78 243 42 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q0SRV9 5.27e-78 243 42 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium perfringens (strain SM101 / Type A)
Q0TP92 5.27e-78 243 42 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q71XX2 5.54e-78 243 42 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria monocytogenes serotype 4b (strain F2365)
Q8Y5L7 6.05e-78 243 41 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q894B4 7.14e-78 243 42 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium tetani (strain Massachusetts / E88)
Q2LR39 9.08e-78 243 44 7 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Syntrophus aciditrophicus (strain SB)
C1KWZ4 9.95e-78 242 42 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8XJ96 1.01e-77 242 42 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium perfringens (strain 13 / Type A)
B8CWI8 1.14e-77 242 42 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
P60396 1.23e-77 242 44 5 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A9KM86 1.32e-77 242 42 7 319 3 rsmH2 Ribosomal RNA small subunit methyltransferase H 2 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B1HPY0 1.46e-77 242 43 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Lysinibacillus sphaericus (strain C3-41)
Q4L5N0 1.47e-77 242 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus haemolyticus (strain JCSC1435)
A8FCX3 3.26e-77 241 44 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus pumilus (strain SAFR-032)
B7GGJ0 8.05e-77 240 42 6 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q8GE08 1.01e-76 240 46 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H (Fragment) Heliobacterium mobile
A4VX71 1.53e-76 239 42 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus suis (strain 05ZYH33)
C6GPU1 1.53e-76 239 42 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus suis (strain SC84)
C5VZR6 1.53e-76 239 42 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus suis (strain P1/7)
C6GW75 1.53e-76 239 42 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus suis (strain BM407)
A4W3H4 1.53e-76 239 42 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus suis (strain 98HAH33)
Q1J5F8 4.34e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M4 (strain MGAS10750)
P0DC37 6.14e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48RZ0 6.14e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RD40 6.14e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JFK8 6.14e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JKL7 6.14e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAG5 6.14e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65433 6.14e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DC36 6.14e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P65431 6.14e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M1
B4U4K4 6.2e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
B5XML3 7.87e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M49 (strain NZ131)
C0M7A8 8.4e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus equi subsp. equi (strain 4047)
C0MGV8 9.07e-76 238 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus equi subsp. zooepidemicus (strain H70)
Q5XAL3 1.02e-75 237 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q03QH0 1.13e-75 237 43 8 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q24TD8 1.24e-75 237 42 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Desulfitobacterium hafniense (strain Y51)
B8FT64 1.24e-75 237 42 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
C6D563 1.34e-75 237 43 6 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Paenibacillus sp. (strain JDR-2)
B9E0V5 1.55e-75 237 41 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium kluyveri (strain NBRC 12016)
Q5L0Y4 1.63e-75 237 43 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacillus kaustophilus (strain HTA426)
A5G8K8 2.37e-75 236 44 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Geotalea uraniireducens (strain Rf4)
C6BYH4 2.87e-75 236 44 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B9LKK0 3.07e-75 236 44 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WG80 3.07e-75 236 44 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q5M2U6 3.08e-75 236 41 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q67Q57 4.16e-75 236 42 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A8ZXX1 5.17e-75 235 41 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q1GRX1 7.26e-75 236 46 9 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
P62471 7.93e-75 235 40 6 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q04B77 9.76e-75 235 41 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GAU0 9.76e-75 235 41 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q03J09 1.17e-74 234 41 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LY91 1.17e-74 234 41 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus thermophilus (strain CNRZ 1066)
B9M164 1.48e-74 234 44 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
C5WIJ4 1.62e-74 234 42 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus dysgalactiae subsp. equisimilis (strain GGS_124)
B0TGB2 1.66e-74 234 45 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q8E782 2.5e-74 234 41 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus agalactiae serotype III (strain NEM316)
Q1MPC6 2.6e-74 234 41 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Lawsonia intracellularis (strain PHE/MN1-00)
Q39YM7 3.66e-74 233 41 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
O07665 3.78e-74 233 42 5 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Enterococcus hirae
B8I6G6 6.65e-74 233 41 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A8YUN6 6.69e-74 233 40 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus helveticus (strain DPC 4571)
A5VDD4 7.66e-74 233 45 9 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q2IYL6 8.67e-74 233 44 6 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodopseudomonas palustris (strain HaA2)
B0K3H8 1.19e-73 232 42 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Thermoanaerobacter sp. (strain X514)
C4L5T9 1.31e-73 232 42 6 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A3CPZ9 1.33e-73 232 40 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus sanguinis (strain SK36)
B0K8J9 1.46e-73 231 42 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q5WFG1 2.35e-73 231 43 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Shouchella clausii (strain KSM-K16)
Q042P4 2.4e-73 231 39 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q04ES5 2.43e-73 231 40 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8E1R8 3.43e-73 231 41 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K394 3.43e-73 231 41 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B3E3Z0 3.97e-73 231 44 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B2GB73 4.09e-73 231 42 8 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A8AVS9 4.2e-73 231 40 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B1YIU3 5.27e-73 230 41 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
C4ZD30 5.3e-73 230 41 7 314 3 rsmH2 Ribosomal RNA small subunit methyltransferase H 2 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q3A2F8 5.78e-73 230 41 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B9DV78 8.14e-73 230 40 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A4YZL1 8.54e-73 230 45 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Bradyrhizobium sp. (strain ORS 278)
B5EBP3 1.11e-72 229 44 5 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A7IGF4 1.22e-72 230 45 6 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A4IM00 1.33e-72 229 41 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacillus thermodenitrificans (strain NG80-2)
C0Q8N5 1.34e-72 229 43 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B6IRH0 1.79e-72 229 42 6 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodospirillum centenum (strain ATCC 51521 / SW)
C1CBB2 2e-72 229 40 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain 70585)
B1I953 2.48e-72 229 39 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain Hungary19A-6)
B3WDX7 2.52e-72 229 42 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Lacticaseibacillus casei (strain BL23)
C1CPL0 3.25e-72 228 39 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain Taiwan19F-14)
Q133W3 4.13e-72 229 43 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodopseudomonas palustris (strain BisB5)
P0CB58 4.31e-72 228 39 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q313R1 8.59e-72 228 42 8 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B2ISQ2 8.7e-72 227 39 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain CGSP14)
B8ZL51 8.7e-72 227 39 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q8DVM7 1.01e-71 227 41 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
C1CIJ8 1.15e-71 227 39 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain P1031)
B5E6Z2 1.15e-71 227 39 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae serotype 19F (strain G54)
B8DP86 2.51e-71 228 43 8 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q9REQ9 3.51e-71 226 44 10 328 3 rsmH Ribosomal RNA small subunit methyltransferase H Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
C1CCA8 5.96e-71 225 39 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain JJA)
P59658 5.96e-71 225 39 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04MC7 5.96e-71 225 39 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A5EPL2 7.66e-71 225 45 7 327 3 rsmH Ribosomal RNA small subunit methyltransferase H Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B0T839 8.3e-71 225 45 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Caulobacter sp. (strain K31)
Q5SJD8 8.45e-71 224 41 7 307 1 rsmH Ribosomal RNA small subunit methyltransferase H Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
B8FBS6 9.44e-71 225 41 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Desulfatibacillum aliphaticivorans
Q0BV17 9.63e-71 225 42 5 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q039S2 1.02e-70 224 41 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q38XN3 1.19e-70 224 40 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Latilactobacillus sakei subsp. sakei (strain 23K)
P62476 2.1e-70 223 41 7 307 3 rsmH Ribosomal RNA small subunit methyltransferase H Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A1AU69 2.2e-70 224 41 7 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q5FKV7 3.97e-70 223 37 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B0S0Y9 4.31e-70 223 39 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A5UZS9 4.4e-70 223 43 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Roseiflexus sp. (strain RS-1)
B9EB47 5.04e-70 223 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Macrococcus caseolyticus (strain JCSC5402)
Q2G9A3 6e-70 223 43 10 326 3 rsmH Ribosomal RNA small subunit methyltransferase H Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B3PTW8 6.72e-70 223 43 8 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhizobium etli (strain CIAT 652)
A7NIA2 8.43e-70 222 41 4 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A5VRI5 8.83e-70 223 42 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q2W0I1 1.31e-69 222 42 7 301 3 rsmH Ribosomal RNA small subunit methyltransferase H Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q1AVW6 1.43e-69 221 42 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
A1AZK1 1.47e-69 222 45 11 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Paracoccus denitrificans (strain Pd 1222)
P65428 1.62e-69 223 42 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella suis biovar 1 (strain 1330)
P65427 1.62e-69 223 42 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RE78 1.62e-69 223 42 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella melitensis biotype 2 (strain ATCC 23457)
A9M698 1.62e-69 223 42 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57C70 1.62e-69 223 42 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella abortus biovar 1 (strain 9-941)
Q2YM63 1.62e-69 223 42 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella abortus (strain 2308)
B2S6R2 1.62e-69 223 42 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella abortus (strain S19)
B0CHM8 1.67e-69 223 42 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella suis (strain ATCC 23445 / NCTC 10510)
P62473 1.82e-69 221 41 9 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q2K6B3 3.01e-69 221 43 8 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q03W30 6.94e-69 220 42 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q02ZY9 7.63e-69 220 41 9 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactococcus lactis subsp. cremoris (strain SK11)
A2RLT4 7.63e-69 220 41 9 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactococcus lactis subsp. cremoris (strain MG1363)
Q2RVT6 8.63e-69 220 43 9 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A6WZP8 9.65e-69 221 42 7 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B2G6K1 1.01e-68 219 42 9 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJ28 1.01e-68 219 42 9 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Limosilactobacillus reuteri (strain DSM 20016)
Q2NCZ8 1.4e-68 219 43 10 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Erythrobacter litoralis (strain HTCC2594)
B1MXV5 1.41e-68 219 41 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Leuconostoc citreum (strain KM20)
Q11RG6 1.71e-68 218 42 6 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10240
Feature type CDS
Gene rsmH
Product 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
Location 2242905 - 2243852 (strand: -1)
Length 948 (nucleotides) / 315 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_865
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01795 MraW methylase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0275 Translation, ribosomal structure and biogenesis (J) J 16S rRNA C1402 N4-methylase RsmH

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03438 16S rRNA (cytosine1402-N4)-methyltransferase [EC:2.1.1.199] - -

Protein Sequence

MTTNNFSHTSVLLDEAVNGLNIKPSGIYIDGTFGRGGHSRLILSQLGEQGRLIAIDRDPQAIAVANEIDDPRFSIIHGPFSNIEHYINELGLSGKVDGVLLDLGVSSPQLDDPERGFSFMRDGPLDMRMDPTTGQSAAQWLMNAEEDDITWVLKTFGEERFAKRIARAIVARNKTEEPLTRTKQLADLISEASPVKERHKHPATRSFQAIRIYINSELDEIEKALKGAVSILAPAGRLSVISFHSLEDRLVKRFIRDESKGPVVPAGIPLTEEQIKALGSARLSSIHKMKPTGVEVEENPRARSSVLRVAQRIEE

Flanking regions ( +/- flanking 50bp)

CCTCACAGGAACCGTTATCGACACGACTATTGGATTTATCACTTTAAATAATGACAACGAATAATTTTAGCCATACCAGTGTATTACTGGATGAAGCAGTAAACGGCCTGAATATTAAACCTTCAGGTATTTATATTGACGGTACTTTTGGCCGTGGCGGGCACTCTCGTCTGATTTTATCGCAATTAGGTGAACAAGGCCGTCTCATTGCGATTGATAGAGATCCACAAGCTATCGCAGTGGCAAATGAAATTGATGATCCACGATTCTCTATTATTCATGGGCCTTTTTCAAATATTGAACACTATATCAATGAGTTAGGTTTAAGTGGCAAAGTTGATGGCGTATTATTAGATTTAGGCGTTTCTTCACCGCAATTAGATGATCCTGAACGAGGATTCTCTTTTATGCGTGATGGGCCACTCGATATGCGTATGGACCCAACCACAGGACAATCAGCTGCACAGTGGTTAATGAATGCCGAAGAAGATGATATTACTTGGGTGCTAAAAACCTTCGGTGAAGAGCGTTTCGCGAAACGCATTGCCCGTGCCATTGTGGCGCGTAATAAAACTGAAGAGCCATTAACACGTACTAAACAGTTAGCGGATTTGATTAGTGAAGCAAGTCCAGTAAAAGAGCGACATAAGCACCCTGCAACACGTAGCTTTCAAGCGATCCGTATCTATATCAATAGTGAGTTAGATGAGATTGAAAAAGCATTAAAAGGCGCCGTGTCTATTTTAGCGCCAGCAGGACGTTTATCGGTGATTAGTTTCCACTCTTTAGAAGACCGATTAGTTAAACGCTTTATAAGAGATGAAAGTAAAGGGCCTGTTGTTCCAGCGGGGATCCCATTAACAGAAGAACAAATTAAAGCACTAGGAAGTGCTCGCCTGAGTAGTATTCATAAAATGAAACCTACCGGTGTTGAAGTTGAGGAGAATCCACGAGCGCGAAGTTCTGTTTTACGTGTCGCACAGCGTATTGAGGAATAAATGTCTACTGAACGCCATTCATTACCGGGAGTGATAGGACAAGATTTACT