Homologs in group_934

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04375 FBDBKF_04375 93.0 Morganella morganii S1 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
EHELCC_05665 EHELCC_05665 93.0 Morganella morganii S2 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
NLDBIP_05985 NLDBIP_05985 93.0 Morganella morganii S4 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
LHKJJB_02865 LHKJJB_02865 93.0 Morganella morganii S3 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
HKOGLL_06340 HKOGLL_06340 93.0 Morganella morganii S5 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
PMI_RS10240 PMI_RS10240 76.5 Proteus mirabilis HI4320 rsmH 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH

Distribution of the homologs in the orthogroup group_934

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_934

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F119 5.35e-179 499 76 0 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Proteus mirabilis (strain HI4320)
Q7N139 6.02e-179 499 79 1 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DEV1 4.19e-178 497 78 2 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D0H5 2.58e-176 493 78 2 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6C9K0 1.06e-174 489 76 2 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Musicola paradisiaca (strain Ech703)
C6CJW6 1.15e-173 486 76 2 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Dickeya chrysanthemi (strain Ech1591)
A1JJI5 1.82e-173 486 76 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A9MQD1 9.71e-173 484 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8ZRU8 1.68e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TXH0 1.68e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella schwarzengrund (strain CVM19633)
C0Q5H8 1.68e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella paratyphi C (strain RKS4594)
B4TJ79 1.68e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella heidelberg (strain SL476)
B5RH56 1.68e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2L6 1.68e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella enteritidis PT4 (strain P125109)
B5FI64 1.68e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella dublin (strain CT_02021853)
B5F7V6 1.68e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella agona (strain SL483)
B4SU42 1.74e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella newport (strain SL254)
B5BLG4 2.72e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella paratyphi A (strain AKU_12601)
Q5PDH4 2.72e-172 483 75 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MZL1 3.62e-172 482 74 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5Y1V5 1.97e-171 480 74 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Klebsiella pneumoniae (strain 342)
A8ALL4 7.22e-171 479 73 1 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6T4M5 8.29e-171 479 74 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q57TD8 8.83e-171 479 74 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella choleraesuis (strain SC-B67)
Q8Z9H4 1.81e-170 478 74 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Salmonella typhi
B2VD83 3.12e-170 477 75 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q326F3 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella boydii serotype 4 (strain Sb227)
B2U287 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWH0 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RGB3 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain UTI89 / UPEC)
B1LG19 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain SMS-3-5 / SECEC)
B6HZ59 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain SE11)
B7N7V5 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P60390 1.2e-169 476 73 1 310 1 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain K12)
B1IR96 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TLQ7 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7C7 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O1:K1 / APEC
A7ZW34 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O9:H4 (strain HS)
B1XC59 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain K12 / DH10B)
C4ZQ04 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain K12 / MC4100 / BW2952)
C6UM45 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain B / REL606)
C5W331 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain B / BL21-DE3)
B7M125 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O8 (strain IAI1)
B5YZB8 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O157:H7 (strain EC4115 / EHEC)
P60391 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O157:H7
B7LFV2 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli (strain 55989 / EAEC)
B7MAK5 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZHH3 1.2e-169 476 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O139:H28 (strain E24377A / ETEC)
B1JK89 3.22e-169 475 74 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EL3 3.22e-169 475 74 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CMN5 3.22e-169 475 74 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pestis bv. Antiqua (strain Nepal516)
A9R132 3.22e-169 475 74 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIF7 3.22e-169 475 74 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pestis
B2K4D8 3.22e-169 475 74 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C206 3.22e-169 475 74 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM74 3.22e-169 475 74 1 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7NHI8 4.09e-169 474 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O7:K1 (strain IAI39 / ExPEC)
C5B9E8 5.56e-169 474 77 2 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Edwardsiella ictaluri (strain 93-146)
B7MNU1 6.56e-169 474 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O81 (strain ED1a)
Q3Z5S7 7.73e-169 474 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella sonnei (strain Ss046)
Q83SN7 9.73e-169 474 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella flexneri
Q32K10 1.65e-168 473 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella dysenteriae serotype 1 (strain Sd197)
B7UID2 1.65e-168 473 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0T8B5 2.78e-168 473 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Shigella flexneri serotype 5b (strain 8401)
A4W6I5 9.29e-168 471 72 2 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Enterobacter sp. (strain 638)
Q8FL68 1.16e-167 471 73 1 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7MIE1 1.28e-167 471 75 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Cronobacter sakazakii (strain ATCC BAA-894)
A8G9R9 7.1e-166 466 73 1 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Serratia proteamaculans (strain 568)
A4TQ91 1.95e-165 465 74 2 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Yersinia pestis (strain Pestoides F)
Q2NVV9 3.04e-159 449 72 3 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Sodalis glossinidius (strain morsitans)
P62475 7.98e-156 441 72 3 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Photobacterium profundum (strain SS9)
Q9AJG9 2.53e-153 435 68 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio proteolyticus
Q7MNV9 5.75e-153 434 67 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio vulnificus (strain YJ016)
Q8DEK2 5.75e-153 434 67 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio vulnificus (strain CMCP6)
Q9AJH1 5.99e-152 431 66 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWK7 1.35e-151 430 66 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio campbellii (strain ATCC BAA-1116)
A0KPY0 2.11e-151 430 69 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B5FB43 2.27e-151 430 67 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Aliivibrio fischeri (strain MJ11)
A4SI48 8.28e-151 428 69 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Aeromonas salmonicida (strain A449)
Q5E2P2 9.75e-151 428 67 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1SU11 4.26e-150 426 69 3 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B6ELI3 1e-149 426 67 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Aliivibrio salmonicida (strain LFI1238)
C3LQV4 3.31e-149 424 66 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio cholerae serotype O1 (strain M66-2)
Q9KPF9 3.31e-149 424 66 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C4K744 4.63e-149 424 65 1 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B7VIZ5 4.74e-149 424 66 4 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Vibrio atlanticus (strain LGP32)
B8F3A8 9.43e-146 415 66 4 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Glaesserella parasuis serovar 5 (strain SH0165)
B0BRG9 2.06e-145 414 64 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZK0 3.71e-145 414 64 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MY82 5.24e-144 411 64 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q65RX8 5.75e-143 409 64 3 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VP62 3.38e-142 406 64 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A6VQP1 1.92e-141 405 63 3 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C6AKG2 3.61e-140 402 61 3 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Aggregatibacter aphrophilus (strain NJ8700)
C4LA17 5.59e-140 400 64 3 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q8E9P0 7.94e-140 400 65 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q07WH7 8.21e-140 400 64 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella frigidimarina (strain NCIMB 400)
Q12SD4 9.99e-140 400 65 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A8FQ92 1.39e-139 400 64 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella sediminis (strain HAW-EB3)
A9KY21 2.48e-139 399 65 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella baltica (strain OS195)
A6WIC3 2.48e-139 399 65 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella baltica (strain OS185)
A3CZL3 2.48e-139 399 65 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4L2 2.48e-139 399 65 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella baltica (strain OS223)
B0US59 2.6e-139 399 62 3 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Histophilus somni (strain 2336)
Q0HZS4 4.14e-139 399 65 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella sp. (strain MR-7)
A0L1Q0 4.14e-139 399 65 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella sp. (strain ANA-3)
Q0HE75 6.63e-139 398 64 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella sp. (strain MR-4)
A1REY8 1.43e-138 397 65 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella sp. (strain W3-18-1)
A4Y2M8 1.43e-138 397 65 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A3QIM9 2.31e-138 397 64 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B1KKY5 3.17e-138 396 64 5 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella woodyi (strain ATCC 51908 / MS32)
A8H992 5.62e-138 396 64 5 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1S2F1 7.68e-138 395 66 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0I1E1 1.55e-137 395 61 3 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Histophilus somni (strain 129Pt)
Q9CPB4 3.13e-137 394 62 3 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Pasteurella multocida (strain Pm70)
Q9F1N8 1.33e-136 392 63 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
B8CM48 1.73e-136 392 64 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella piezotolerans (strain WP3 / JCM 13877)
B0TQM9 4.08e-136 391 63 5 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Shewanella halifaxensis (strain HAW-EB4)
A5UCX6 1.35e-134 387 60 3 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Haemophilus influenzae (strain PittEE)
Q4QLG6 1.35e-134 387 60 3 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Haemophilus influenzae (strain 86-028NP)
P45057 2.19e-134 387 60 3 312 1 rsmH Ribosomal RNA small subunit methyltransferase H Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q15Q09 6.28e-133 383 62 4 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q1LSW0 9.32e-133 382 62 2 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3IFZ6 1.75e-131 379 61 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudoalteromonas translucida (strain TAC 125)
B4RWY7 2.77e-131 379 60 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q47VQ1 5.68e-127 368 60 3 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5R0L7 1.3e-126 367 59 4 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B3PCM8 1.85e-120 351 56 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Cellvibrio japonicus (strain Ueda107)
C1DQ91 2.56e-119 348 56 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A5UIQ3 6e-119 347 63 1 264 3 rsmH Ribosomal RNA small subunit methyltransferase H Haemophilus influenzae (strain PittGG)
A4XQR6 6.09e-118 345 55 5 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas mendocina (strain ymp)
B2JHG8 1.72e-117 344 55 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A3NZM3 6.16e-117 342 55 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia pseudomallei (strain 1106a)
A1U3G6 1.21e-116 342 56 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A3NDX2 1.59e-116 341 55 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia pseudomallei (strain 668)
Q3JND0 1.59e-116 341 55 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia pseudomallei (strain 1710b)
A1V0S6 1.59e-116 341 55 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia mallei (strain SAVP1)
Q62GR9 1.59e-116 341 55 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia mallei (strain ATCC 23344)
A2S5V3 1.59e-116 341 55 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia mallei (strain NCTC 10229)
A3MR55 1.59e-116 341 55 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia mallei (strain NCTC 10247)
Q4K6I5 2.55e-116 341 57 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q2SZJ1 3.06e-116 340 54 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QI9 3.89e-116 340 55 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia pseudomallei (strain K96243)
Q13TY4 4.04e-116 340 55 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Paraburkholderia xenovorans (strain LB400)
P57319 5.11e-116 340 53 1 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D922 5.11e-116 340 53 1 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q31I68 5.65e-116 340 57 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B8D7C6 9.02e-116 339 53 1 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Q2S9Y4 9.18e-116 339 55 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Hahella chejuensis (strain KCTC 2396)
B0KFT4 1.1e-115 339 56 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas putida (strain GB-1)
C3KCS2 1.38e-115 339 56 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas fluorescens (strain SBW25)
B2SYY3 2.1e-115 338 54 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A5W8Q8 3.01e-115 338 56 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88N84 4.17e-115 338 55 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q493Q9 5.49e-115 338 52 3 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Blochmanniella pennsylvanica (strain BPEN)
Q1QVF9 9.7e-115 337 57 4 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B1J1Y2 1.01e-114 337 55 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas putida (strain W619)
B7UZJ8 2.75e-114 335 56 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas aeruginosa (strain LESB58)
Q9HVZ5 3.57e-114 335 55 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q83F35 5.14e-114 335 54 4 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NA25 5.14e-114 335 54 4 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J5L7 5.14e-114 335 54 4 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Coxiella burnetii (strain CbuK_Q154)
Q1I5B0 5.3e-114 335 55 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas entomophila (strain L48)
Q87WX7 6.51e-114 335 55 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B8GMM1 7.03e-114 335 59 4 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q02H20 9.64e-114 334 55 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas aeruginosa (strain UCBPP-PA14)
A6VB93 9.64e-114 334 55 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas aeruginosa (strain PA7)
A4G8U6 1.42e-113 334 54 4 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Herminiimonas arsenicoxydans
Q48EF0 1.8e-113 333 55 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A9KET2 2.4e-113 333 54 4 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Coxiella burnetii (strain Dugway 5J108-111)
A6T2G6 2.54e-113 333 55 4 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Janthinobacterium sp. (strain Marseille)
O85295 2.54e-113 333 52 1 305 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C1D5M5 4.81e-113 332 55 3 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Laribacter hongkongensis (strain HLHK9)
Q4ZNY2 5.23e-113 332 55 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas syringae pv. syringae (strain B728a)
A4VIH0 5.36e-113 332 54 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Stutzerimonas stutzeri (strain A1501)
Q3K736 9.45e-113 332 54 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Pseudomonas fluorescens (strain Pf0-1)
P59522 9.87e-113 332 51 2 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
C6BEJ1 1.22e-112 332 55 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Ralstonia pickettii (strain 12D)
B1YSR6 1.74e-112 331 54 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia ambifaria (strain MC40-6)
Q0BIK9 2.9e-112 330 54 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B6J2R7 2.95e-112 330 54 4 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Coxiella burnetii (strain CbuG_Q212)
B2UCY5 3.29e-112 330 55 5 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Ralstonia pickettii (strain 12J)
A9AJ24 5.41e-112 330 54 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia multivorans (strain ATCC 17616 / 249)
A4JB86 8.74e-112 329 54 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q9JSY9 1.98e-111 329 54 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q39JX8 4.07e-111 327 54 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q47A96 4.09e-111 327 54 5 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Dechloromonas aromatica (strain RCB)
Q8XVH9 6.33e-111 327 54 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B1JUW4 8.73e-111 327 53 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia orbicola (strain MC0-3)
A0K478 8.73e-111 327 53 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia cenocepacia (strain HI2424)
A9M2I4 1.54e-110 327 53 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria meningitidis serogroup C (strain 053442)
Q9K0Z0 7.48e-110 325 53 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q1BZH1 1.36e-109 323 53 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia orbicola (strain AU 1054)
B4E6K0 2e-109 323 53 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A1KVM4 2.33e-109 323 53 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q5WXZ4 3.08e-109 323 53 3 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Legionella pneumophila (strain Lens)
Q5ZX19 3.08e-109 323 53 3 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X6J0 3.08e-109 323 53 3 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Legionella pneumophila (strain Paris)
B4RQD7 4.55e-109 322 53 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria gonorrhoeae (strain NCCP11945)
Q5F6K7 5.47e-109 322 53 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q3SMI1 6.92e-109 322 56 4 307 3 rsmH Ribosomal RNA small subunit methyltransferase H Thiobacillus denitrificans (strain ATCC 25259)
Q21MH7 1.38e-108 321 52 6 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B3R6W7 1.67e-108 322 53 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0AJD3 2.44e-108 320 51 4 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q7VQJ5 2.97e-108 320 53 4 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Blochmanniella floridana
A6VYK6 4.99e-108 320 50 5 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Marinomonas sp. (strain MWYL1)
A5IFZ9 8.3e-108 319 53 4 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Legionella pneumophila (strain Corby)
C5BP42 2.06e-107 318 52 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q0K6L6 3.08e-107 318 53 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q82VT1 4.06e-107 317 52 4 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A2SCX7 4.83e-107 317 52 5 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q1GYZ3 5.23e-107 317 53 3 307 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q46WY6 3.03e-106 316 53 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LIL8 2.13e-105 313 51 4 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2Y630 2.29e-105 313 51 4 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q5GW34 3.72e-105 313 54 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SNY6 4.53e-105 313 54 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZB1 4.53e-105 313 54 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q604V0 5.61e-105 311 53 4 305 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8D2Y8 9.52e-105 311 48 1 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Wigglesworthia glossinidia brevipalpis
Q0VS10 1.05e-104 311 55 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7NPZ1 2.19e-104 311 52 5 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B0V8N7 2.86e-104 310 50 6 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain AYE)
A3M9K5 2.86e-104 310 50 6 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I0K7 2.86e-104 310 50 6 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain ACICU)
B7GVN1 2.86e-104 310 50 6 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain AB307-0294)
Q3BXF9 6.46e-104 310 54 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5P6Y9 3.22e-103 307 53 4 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B7IAX1 3.36e-103 307 50 6 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain AB0057)
A1K3T8 5.56e-103 307 52 4 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Azoarcus sp. (strain BH72)
B9MFS0 1.14e-102 306 53 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Acidovorax ebreus (strain TPSY)
A1VSU4 1.54e-102 305 51 2 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Polaromonas naphthalenivorans (strain CJ2)
Q12EM3 1.6e-102 305 52 3 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q8PPB5 1.89e-102 306 53 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas axonopodis pv. citri (strain 306)
B0VPF9 2.34e-102 305 50 6 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baumannii (strain SDF)
A1WC14 4.91e-102 304 52 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Acidovorax sp. (strain JS42)
Q8PCK7 5.79e-102 305 53 6 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVB2 5.79e-102 305 53 6 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas campestris pv. campestris (strain B100)
A1WRK3 7.96e-102 305 52 5 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Verminephrobacter eiseniae (strain EF01-2)
Q3J781 1.45e-101 303 55 4 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B1XY20 4.7e-101 302 53 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B0U504 8.36e-101 301 53 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Xylella fastidiosa (strain M12)
Q87AF2 1.1e-100 301 54 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9C0 1.1e-100 301 54 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Xylella fastidiosa (strain M23)
Q9PF88 3.12e-100 300 53 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Xylella fastidiosa (strain 9a5c)
B2FNN0 3.93e-100 300 52 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Stenotrophomonas maltophilia (strain K279a)
B4SJW8 9.18e-100 299 51 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Stenotrophomonas maltophilia (strain R551-3)
A1AVX1 1.6e-99 298 49 4 307 3 rsmH Ribosomal RNA small subunit methyltransferase H Ruthia magnifica subsp. Calyptogena magnifica
Q4UQW3 1.61e-99 299 52 6 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthomonas campestris pv. campestris (strain 8004)
Q6F7D1 6.44e-99 296 50 6 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0A6J4 1.74e-98 295 50 4 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C5CNE6 4.89e-98 294 50 4 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Variovorax paradoxus (strain S110)
A5CX97 7.12e-97 291 48 5 307 3 rsmH Ribosomal RNA small subunit methyltransferase H Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B1XT01 9.04e-95 286 48 5 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q21SW1 1.59e-94 285 50 5 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q7VUP6 1.05e-93 285 46 5 332 3 rsmH Ribosomal RNA small subunit methyltransferase H Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4A7 1.05e-93 285 46 5 332 3 rsmH Ribosomal RNA small subunit methyltransferase H Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFR5 1.05e-93 285 46 5 332 3 rsmH Ribosomal RNA small subunit methyltransferase H Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1WYV1 1.89e-93 283 49 3 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Halorhodospira halophila (strain DSM 244 / SL1)
A4SV66 3.23e-91 277 48 4 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A9BUJ8 1.67e-90 275 50 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Delftia acidovorans (strain DSM 14801 / SPH-1)
Q2KVE4 6.93e-90 275 49 5 304 3 rsmH Ribosomal RNA small subunit methyltransferase H Bordetella avium (strain 197N)
A5WBQ1 7.98e-90 274 46 7 326 3 rsmH Ribosomal RNA small subunit methyltransferase H Psychrobacter sp. (strain PRwf-1)
Q057T6 5.87e-89 271 46 1 304 3 rsmH Ribosomal RNA small subunit methyltransferase H Buchnera aphidicola subsp. Cinara cedri (strain Cc)
C0ZGB3 1.83e-88 270 48 6 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A9I4S5 7.84e-88 270 47 6 333 3 rsmH Ribosomal RNA small subunit methyltransferase H Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q5NGY1 8.18e-87 265 46 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14ID3 8.18e-87 265 46 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. tularensis (strain FSC 198)
B2SDL2 3.58e-86 264 46 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. mediasiatica (strain FSC147)
A0Q5I5 3.62e-86 264 46 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. novicida (strain U112)
Q4FQ05 3.79e-86 265 44 7 334 3 rsmH Ribosomal RNA small subunit methyltransferase H Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1TKC3 4.15e-86 264 51 5 305 3 rsmH Ribosomal RNA small subunit methyltransferase H Paracidovorax citrulli (strain AAC00-1)
Q0BKT7 8.55e-86 263 46 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. holarctica (strain OSU18)
Q2A265 8.55e-86 263 46 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. holarctica (strain LVS)
A7NDP7 8.55e-86 263 46 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q65JY8 9.37e-86 263 45 7 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A0L5N9 4.93e-85 261 48 8 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q1Q846 5.71e-85 262 44 7 332 3 rsmH Ribosomal RNA small subunit methyltransferase H Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A9B518 2.87e-84 260 46 6 328 3 rsmH Ribosomal RNA small subunit methyltransferase H Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
B9MQ93 3.43e-84 259 45 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A8MH28 5e-84 258 45 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Alkaliphilus oremlandii (strain OhILAs)
Q07876 6.08e-84 258 45 7 314 2 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus subtilis (strain 168)
C5D8L5 6.29e-84 258 46 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacillus sp. (strain WCH70)
A4IZB0 1.29e-83 257 46 5 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella tularensis subsp. tularensis (strain WY96-3418)
Q03EX7 2.09e-83 257 44 6 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A4XHZ6 3.29e-83 256 43 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B0TZ13 4.9e-83 256 45 5 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0SRV9 8.8e-83 255 43 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium perfringens (strain SM101 / Type A)
Q0TP92 8.8e-83 255 43 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B3QFN9 1.45e-82 255 48 8 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodopseudomonas palustris (strain TIE-1)
Q8XJ96 1.51e-82 254 43 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium perfringens (strain 13 / Type A)
C3KV90 2.91e-82 254 42 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain 657 / Type Ba4)
C1FME6 5.28e-82 253 42 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Kyoto / Type A2)
A0Q055 5.76e-82 253 43 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium novyi (strain NT)
A8HZ68 7.83e-82 254 47 8 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A7GDE2 8.99e-82 253 42 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IKR0 9.59e-82 253 42 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Okra / Type B1)
P60398 1.04e-81 253 48 8 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q49WW1 1.2e-81 252 44 7 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A5I1T3 1.37e-81 252 42 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FTX8 1.37e-81 252 42 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain ATCC 19397 / Type A)
B8G5X3 1.67e-81 252 46 6 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Chloroflexus aggregans (strain MD-66 / DSM 9485)
B9DPQ9 3.37e-81 251 44 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus carnosus (strain TM300)
B1L164 5.05e-81 251 42 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Loch Maree / Type A3)
Q929X6 8.19e-81 250 43 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9K9S0 9.67e-81 250 44 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B8DH88 1.06e-80 250 43 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria monocytogenes serotype 4a (strain HCC23)
A0AKE1 1.2e-80 250 43 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q97H81 1.25e-80 250 42 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A7Z4D7 2.13e-80 249 44 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8Y5L7 2.3e-80 249 43 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71XX2 2.35e-80 249 43 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria monocytogenes serotype 4b (strain F2365)
A6LTS0 3.59e-80 249 42 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
C6DZJ8 7.49e-80 248 45 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacter sp. (strain M21)
Q5L0Y4 7.93e-80 248 47 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacillus kaustophilus (strain HTA426)
B1HPY0 8.57e-80 248 43 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Lysinibacillus sphaericus (strain C3-41)
B2V4W0 1.12e-79 247 42 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Alaska E43 / Type E3)
B7GGJ0 1.23e-79 247 44 7 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B2TS30 1.46e-79 247 42 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium botulinum (strain Eklund 17B / Type B)
Q04B77 1.54e-79 247 44 9 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GAU0 1.54e-79 247 44 9 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
C1KWZ4 1.65e-79 247 43 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Listeria monocytogenes serotype 4b (strain CLIP80459)
A4J2A3 1.86e-79 247 43 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q8GE08 6.56e-79 245 47 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H (Fragment) Heliobacterium mobile
Q5HQ13 7.98e-79 245 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A5EY11 1.77e-78 244 47 7 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Dichelobacter nodosus (strain VCS1703A)
Q6HEP6 1.8e-78 244 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus thuringiensis subsp. konkukian (strain 97-27)
A8FCX3 2.24e-78 244 45 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus pumilus (strain SAFR-032)
Q8CSX7 3.06e-78 244 42 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A9KM86 3.2e-78 244 42 6 318 3 rsmH2 Ribosomal RNA small subunit methyltransferase H 2 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q3AAD7 3.53e-78 243 45 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A6QG79 3.97e-78 243 42 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain Newman)
Q5HGQ2 3.97e-78 243 42 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain COL)
A5D113 4.15e-78 243 44 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A7GRP4 4.44e-78 243 44 7 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7H6Q4 4.78e-78 243 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain B4264)
B3WDX7 5.42e-78 243 44 8 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Lacticaseibacillus casei (strain BL23)
Q636A8 5.57e-78 243 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain ZK / E33L)
C1EPT2 5.57e-78 243 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain 03BB102)
B7JK06 5.57e-78 243 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain AH820)
Q81WC3 5.57e-78 243 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus anthracis
A0RHT9 5.57e-78 243 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus thuringiensis (strain Al Hakam)
C3L6F3 5.57e-78 243 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P688 5.57e-78 243 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus anthracis (strain A0248)
B0TGB2 6.24e-78 243 47 7 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q819P8 7.63e-78 243 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7IVF3 7.63e-78 243 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain G9842)
Q2IYL6 8.23e-78 243 46 9 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodopseudomonas palustris (strain HaA2)
P60394 1.41e-77 242 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain MW2)
A8Z3M0 1.41e-77 242 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain USA300 / TCH1516)
Q6GA33 1.41e-77 242 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain MSSA476)
Q6GHQ6 1.41e-77 242 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain MRSA252)
P60392 1.41e-77 242 41 7 313 1 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain N315)
P60485 1.41e-77 242 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IS65 1.41e-77 242 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain JH9)
P60393 1.41e-77 242 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHQ8 1.41e-77 242 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain USA300)
A6U0Z9 1.41e-77 242 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain JH1)
A7X1B8 1.41e-77 242 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain Mu3 / ATCC 700698)
O07104 1.54e-77 242 41 7 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Enterococcus faecalis (strain ATCC 700802 / V583)
Q2YXE3 2.77e-77 241 41 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus aureus (strain bovine RF122 / ET3-1)
A6TS69 3.15e-77 241 42 7 315 3 rsmH1 Ribosomal RNA small subunit methyltransferase H 1 Alkaliphilus metalliredigens (strain QYMF)
Q4L5N0 4.27e-77 241 42 8 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Staphylococcus haemolyticus (strain JCSC1435)
Q133W3 4.56e-77 241 46 9 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodopseudomonas palustris (strain BisB5)
B9E0V5 4.77e-77 241 40 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium kluyveri (strain NBRC 12016)
B9IVZ5 9.23e-77 240 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain Q1)
P62468 9.23e-77 240 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain ATCC 10987 / NRS 248)
B5ELD1 9.97e-77 240 46 9 324 3 rsmH Ribosomal RNA small subunit methyltransferase H Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J3W0 9.97e-77 240 46 9 324 3 rsmH Ribosomal RNA small subunit methyltransferase H Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
P0DC37 1.01e-76 240 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48RZ0 1.01e-76 240 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RD40 1.01e-76 240 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JFK8 1.01e-76 240 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JKL7 1.01e-76 240 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAG5 1.01e-76 240 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65433 1.01e-76 240 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DC36 1.01e-76 240 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P65431 1.01e-76 240 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M1
O07665 1.04e-76 240 43 7 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Enterococcus hirae
B7HM39 1.11e-76 239 45 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus cereus (strain AH187)
B5XML3 1.31e-76 239 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M49 (strain NZ131)
A9VU80 1.39e-76 239 44 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Bacillus mycoides (strain KBAB4)
A4IM00 1.64e-76 239 44 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacillus thermodenitrificans (strain NG80-2)
Q5XAL3 1.69e-76 239 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q039S2 2.14e-76 239 43 8 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A5EPL2 2.24e-76 239 48 9 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q182Z2 2.44e-76 239 41 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridioides difficile (strain 630)
C6D563 2.47e-76 239 43 7 324 3 rsmH Ribosomal RNA small subunit methyltransferase H Paenibacillus sp. (strain JDR-2)
Q1J5F8 3.01e-76 239 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q894B4 3.66e-76 238 40 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Clostridium tetani (strain Massachusetts / E88)
B9LKK0 6.74e-76 237 46 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WG80 6.74e-76 237 46 6 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A7IGF4 7.12e-76 239 46 8 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B2IGF2 8.59e-76 239 48 8 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B8CWI8 9.16e-76 237 40 6 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q8R9F9 9.32e-76 237 43 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q24TD8 1.2e-75 237 43 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Desulfitobacterium hafniense (strain Y51)
B8FT64 1.2e-75 237 43 6 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
C5WIJ4 1.43e-75 237 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus dysgalactiae subsp. equisimilis (strain GGS_124)
Q1MPC6 3.15e-75 236 43 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Lawsonia intracellularis (strain PHE/MN1-00)
Q3A2F8 3.73e-75 236 44 6 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A5G8K8 3.86e-75 236 44 7 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Geotalea uraniireducens (strain Rf4)
A4YZL1 5.53e-75 236 48 9 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Bradyrhizobium sp. (strain ORS 278)
Q67Q57 7.23e-75 235 44 5 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q88V76 8.22e-75 235 40 6 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C4ZD30 1.1e-74 234 41 7 317 3 rsmH2 Ribosomal RNA small subunit methyltransferase H 2 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q2W0I1 1.78e-74 234 45 8 302 3 rsmH Ribosomal RNA small subunit methyltransferase H Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B6IRH0 1.89e-74 234 44 6 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodospirillum centenum (strain ATCC 51521 / SW)
A5VDD4 2.03e-74 234 47 12 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q2LR39 2.34e-74 234 41 7 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Syntrophus aciditrophicus (strain SB)
Q1WT95 2.43e-74 234 41 7 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Ligilactobacillus salivarius (strain UCC118)
Q5FKV7 2.88e-74 234 40 8 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
P60396 3.2e-74 233 44 8 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B2GB73 3.47e-74 233 41 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q0BV17 3.76e-74 234 45 8 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B4U4K4 3.93e-74 233 42 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
B9DV78 4.73e-74 233 40 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C0M7A8 5.1e-74 233 42 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus equi subsp. equi (strain 4047)
Q5M2U6 5.93e-74 233 41 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q03QH0 7.9e-74 233 42 7 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B9M164 8.37e-74 232 44 7 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
C0MGV8 1.27e-73 232 42 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus equi subsp. zooepidemicus (strain H70)
Q8E782 1.27e-73 232 40 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus agalactiae serotype III (strain NEM316)
Q39YM7 1.5e-73 232 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A8YUN6 1.76e-73 232 40 7 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus helveticus (strain DPC 4571)
Q03J09 1.79e-73 232 41 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LY91 1.79e-73 232 41 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus thermophilus (strain CNRZ 1066)
B8I6G6 3.97e-73 231 40 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A8AVS9 4.44e-73 231 41 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B5EBP3 5.51e-73 230 45 6 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A4VX71 5.76e-73 230 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus suis (strain 05ZYH33)
C6GPU1 5.76e-73 230 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus suis (strain SC84)
C5VZR6 5.76e-73 230 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus suis (strain P1/7)
C6GW75 5.76e-73 230 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus suis (strain BM407)
A4W3H4 5.76e-73 230 42 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus suis (strain 98HAH33)
P62471 6.57e-73 230 40 8 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A3CPZ9 7.47e-73 230 40 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus sanguinis (strain SK36)
Q042P4 1.26e-72 229 40 8 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B0T839 1.45e-72 229 47 9 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Caulobacter sp. (strain K31)
Q2RVT6 2.08e-72 229 45 8 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8E1R8 2.23e-72 229 40 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K394 2.23e-72 229 40 7 319 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A5VRI5 3.87e-72 229 43 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
C1CIJ8 4.04e-72 228 40 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain P1031)
B5E6Z2 4.04e-72 228 40 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae serotype 19F (strain G54)
C1CBB2 4.5e-72 228 40 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain 70585)
B3E3Z0 4.78e-72 228 46 8 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B6JCF0 4.84e-72 229 46 8 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
P65428 5.53e-72 229 43 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella suis biovar 1 (strain 1330)
P65427 5.53e-72 229 43 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RE78 5.53e-72 229 43 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella melitensis biotype 2 (strain ATCC 23457)
A9M698 5.53e-72 229 43 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57C70 5.53e-72 229 43 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella abortus biovar 1 (strain 9-941)
Q2YM63 5.53e-72 229 43 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella abortus (strain 2308)
B2S6R2 5.53e-72 229 43 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella abortus (strain S19)
C1CPL0 6.5e-72 228 39 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain Taiwan19F-14)
Q1GRX1 7.63e-72 228 47 9 311 3 rsmH Ribosomal RNA small subunit methyltransferase H Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
P0CB58 9.91e-72 227 39 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A6WZP8 1.19e-71 228 42 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B1I953 1.2e-71 227 39 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain Hungary19A-6)
B7KU77 1.21e-71 228 45 8 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B2ISQ2 1.3e-71 227 39 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain CGSP14)
B8ZL51 1.3e-71 227 39 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q8DVM7 2.02e-71 226 40 7 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
C4L5T9 4.29e-71 225 43 8 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q1ME25 4.62e-71 226 46 9 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
C1CCA8 6.94e-71 225 39 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain JJA)
P59658 6.94e-71 225 39 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04MC7 6.94e-71 225 39 7 318 3 rsmH Ribosomal RNA small subunit methyltransferase H Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
C5ATZ5 6.95e-71 226 45 8 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
B1YIU3 7.17e-71 225 42 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
P58745 7.35e-71 226 45 8 309 3 rsmH Ribosomal RNA small subunit methyltransferase H Agrobacterium fabrum (strain C58 / ATCC 33970)
B0CHM8 8.41e-71 226 42 8 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Brucella suis (strain ATCC 23445 / NCTC 10510)
A9VW37 9e-71 226 45 8 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylorubrum extorquens (strain PA1)
B3PTW8 1.13e-70 225 45 8 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhizobium etli (strain CIAT 652)
Q5N4L0 1.24e-70 224 44 8 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31PL4 1.24e-70 224 44 8 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5WFG1 1.52e-70 224 41 7 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Shouchella clausii (strain KSM-K16)
Q2K6B3 1.67e-70 225 45 8 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A5UZS9 2.15e-70 224 45 5 312 3 rsmH Ribosomal RNA small subunit methyltransferase H Roseiflexus sp. (strain RS-1)
A8ZXX1 2.3e-70 224 41 6 314 3 rsmH Ribosomal RNA small subunit methyltransferase H Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q1AVW6 2.43e-70 223 42 5 307 3 rsmH Ribosomal RNA small subunit methyltransferase H Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B9EB47 2.72e-70 223 41 7 313 3 rsmH Ribosomal RNA small subunit methyltransferase H Macrococcus caseolyticus (strain JCSC5402)
Q38XN3 2.97e-70 223 41 8 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Latilactobacillus sakei subsp. sakei (strain 23K)
A1AU69 3.05e-70 223 42 9 320 3 rsmH Ribosomal RNA small subunit methyltransferase H Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B1ZU25 3.64e-70 223 44 9 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q2G9A3 3.73e-70 224 45 9 322 3 rsmH Ribosomal RNA small subunit methyltransferase H Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B8ETL4 5.86e-70 224 47 8 308 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A7NIA2 6.44e-70 223 44 4 310 3 rsmH Ribosomal RNA small subunit methyltransferase H Roseiflexus castenholzii (strain DSM 13941 / HLO8)
B0K3H8 1.14e-69 222 40 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Thermoanaerobacter sp. (strain X514)
A4WQC5 1.37e-69 222 47 8 294 3 rsmH Ribosomal RNA small subunit methyltransferase H Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q9REQ9 1.68e-69 222 45 10 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B0K8J9 1.98e-69 221 40 7 315 3 rsmH Ribosomal RNA small subunit methyltransferase H Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q2NCZ8 3.49e-69 221 44 10 317 3 rsmH Ribosomal RNA small subunit methyltransferase H Erythrobacter litoralis (strain HTCC2594)
Q92NL4 3.94e-69 221 46 8 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Rhizobium meliloti (strain 1021)
B2G6K1 4.15e-69 221 40 9 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJ28 4.15e-69 221 40 9 321 3 rsmH Ribosomal RNA small subunit methyltransferase H Limosilactobacillus reuteri (strain DSM 20016)
Q8ER53 9.05e-69 220 42 8 316 3 rsmH Ribosomal RNA small subunit methyltransferase H Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C3MEN7 9.15e-69 220 45 8 306 3 rsmH Ribosomal RNA small subunit methyltransferase H Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B1Z8U3 1.23e-68 220 48 9 297 3 rsmH Ribosomal RNA small subunit methyltransferase H Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08820
Feature type CDS
Gene rsmH
Product 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
Location 1826284 - 1827234 (strand: -1)
Length 951 (nucleotides) / 316 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_934
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01795 MraW methylase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0275 Translation, ribosomal structure and biogenesis (J) J 16S rRNA C1402 N4-methylase RsmH

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03438 16S rRNA (cytosine1402-N4)-methyltransferase [EC:2.1.1.199] - -

Protein Sequence

MTESQFQHTSVLLDEAVNGLTIRKDGIYIDGTFGRGGHSRLILSQLGEQGRLIAIDRDPQAIAAAALIDDPRFSIVHGPFSGIAGYVNDLGLNGQIDGVLLDLGVSSPQLDDPERGFSFMRDGPLDMRMDPTRGISAAQWLTEAKEEDIAWVLKNFGEERFSKRIARAIVERNQTEEPLTRTKHLASLIAAVSPVTEKHKHPATRSFQAIRIYVNSELDEIRQALTGALSILAPGGRLSVISFHSLEDRIVKQFMRNESRGPQVPRGLPLTEAQLKAHGTPSLKLAGKMKPSEQEISVNPRARSSVLRFAEKVDNE

Flanking regions ( +/- flanking 50bp)

AGACGGCATCTGAACCTTTATCAGCCCGGTTACAGGATTTATCACTTTAAATGACAGAGAGTCAGTTTCAGCATACCAGTGTCTTACTGGACGAGGCCGTCAACGGATTAACTATCCGTAAAGACGGAATTTATATCGACGGTACATTTGGCCGTGGCGGGCATTCCCGTCTGATTTTATCGCAGCTTGGTGAACAGGGCCGTCTGATAGCAATAGACCGTGATCCGCAGGCGATTGCTGCCGCAGCACTGATTGACGATCCGCGTTTTTCCATCGTTCACGGTCCGTTTTCCGGTATTGCCGGATACGTCAATGACCTGGGACTGAATGGTCAGATTGACGGCGTGTTGCTGGATTTGGGTGTGTCTTCCCCGCAACTGGATGACCCGGAGCGCGGATTTTCGTTTATGCGTGACGGACCACTGGATATGCGGATGGACCCGACCCGGGGTATTTCTGCGGCGCAGTGGCTGACAGAAGCGAAAGAAGAAGATATTGCGTGGGTACTGAAAAATTTTGGTGAAGAGCGTTTTTCCAAACGTATTGCCCGCGCCATTGTTGAGCGTAATCAGACTGAAGAGCCGCTGACAAGAACAAAACACCTTGCGTCACTGATAGCAGCGGTTTCTCCGGTGACAGAAAAACATAAACATCCGGCAACACGCAGCTTCCAGGCTATCCGTATTTATGTGAACAGTGAACTGGATGAAATCCGCCAGGCGCTGACAGGTGCATTAAGCATTCTGGCACCCGGCGGGCGTTTATCGGTAATCAGCTTCCATTCACTGGAAGACCGGATTGTTAAGCAGTTTATGCGTAATGAGAGCCGTGGTCCGCAGGTTCCGCGCGGATTACCGCTGACAGAAGCTCAGTTGAAAGCGCACGGTACACCATCACTGAAACTGGCGGGAAAAATGAAACCGTCTGAGCAGGAAATCAGTGTTAATCCGCGCGCGCGCAGTTCTGTTCTGCGTTTTGCTGAGAAAGTAGATAACGAATGACAACGGAACGGCACAATTTAGCCCGCGTTATCTGCCGTGATATGTTACGC