Homologs in group_1667

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11590 FBDBKF_11590 89.9 Morganella morganii S1 crr PTS glucose transporter subunit IIA
EHELCC_17510 EHELCC_17510 89.9 Morganella morganii S2 crr PTS glucose transporter subunit IIA
NLDBIP_18720 NLDBIP_18720 89.9 Morganella morganii S4 crr PTS glucose transporter subunit IIA
LHKJJB_17950 LHKJJB_17950 89.9 Morganella morganii S3 crr PTS glucose transporter subunit IIA
HKOGLL_18700 HKOGLL_18700 89.9 Morganella morganii S5 crr PTS glucose transporter subunit IIA
F4V73_RS08090 F4V73_RS08090 87.6 Morganella psychrotolerans crr PTS glucose transporter subunit IIA

Distribution of the homologs in the orthogroup group_1667

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1667

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P69785 3.78e-98 283 85 0 169 3 crr PTS system glucose-specific EIIA component Shigella flexneri
P69783 3.78e-98 283 85 0 169 1 crr PTS system glucose-specific EIIA component Escherichia coli (strain K12)
P69784 3.78e-98 283 85 0 169 3 crr PTS system glucose-specific EIIA component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A283 1.2e-97 282 85 0 169 1 crr PTS system glucose-specific EIIA component Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A284 1.2e-97 282 85 0 169 1 crr PTS system glucose-specific EIIA component Salmonella typhi
P45338 6.45e-80 237 72 2 169 1 crr PTS system glucose-specific EIIA component Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8KA51 3.31e-66 202 63 0 147 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9WXI7 1.44e-60 187 58 0 151 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89B05 5.21e-58 181 59 0 149 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q44840 1.16e-51 166 55 0 135 3 crr PTS system glucose-specific EIIA component Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8CZD5 2.42e-44 147 42 1 162 3 crr PTS system glucose-specific EIIA component Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P45604 1.19e-43 155 50 1 148 3 nagE PTS system N-acetylglucosamine-specific EIICBA component Klebsiella pneumoniae
P09323 3.9e-43 154 49 1 149 1 nagE PTS system N-acetylglucosamine-specific EIICBA component Escherichia coli (strain K12)
Q814U8 1.44e-42 142 45 2 166 3 crr PTS system glucose-specific EIIA component Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81JY0 1.81e-42 142 45 2 166 3 crr PTS system glucose-specific EIIA component Bacillus anthracis
Q9KCQ4 1.36e-40 137 44 2 170 3 crr PTS system glucose-specific EIIA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8CP79 2.91e-40 136 40 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB5 2.91e-40 136 40 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q93P61 1.55e-39 134 41 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus
Q6GGY5 1.55e-39 134 41 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MRSA252)
Q5HFZ9 1.55e-39 134 41 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain COL)
P60857 2.11e-39 134 41 1 162 1 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain N315)
P60856 2.11e-39 134 41 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8NWR1 7.27e-39 133 43 0 140 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MW2)
Q6G9D9 7.27e-39 133 43 0 140 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MSSA476)
Q7A807 4.59e-35 132 46 2 147 1 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain N315)
Q99X32 4.59e-35 132 46 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IP58 4.59e-35 132 46 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain JH9)
A6TXX3 4.59e-35 132 46 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain JH1)
A7WXI2 4.59e-35 132 46 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YUZ1 7.22e-35 131 45 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GKB7 8.53e-35 131 45 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MRSA252)
Q8NYM1 8.62e-35 131 45 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MW2)
A8Z0F5 8.62e-35 131 45 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain USA300 / TCH1516)
Q6GCT7 8.62e-35 131 45 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MSSA476)
A6QDH3 8.62e-35 131 45 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Newman)
Q5HJI3 8.62e-35 131 45 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain COL)
Q2G1G8 8.62e-35 131 45 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK73 8.62e-35 131 45 2 147 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain USA300)
P42015 9.91e-35 126 42 1 147 3 ptsG PTS system glucose-specific EIICBA component (Fragment) Geobacillus stearothermophilus
P50829 2.88e-33 119 44 0 121 4 ptsA Phosphotransferase enzyme IIA component PtsA Bacillus subtilis (strain 168)
Q4A0C4 5.57e-33 126 45 0 128 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q57071 1.4e-32 125 45 0 123 1 ptsG PTS system glucose-specific EIICBA component Staphylococcus carnosus (strain TM300)
Q4L945 2.87e-32 124 50 0 122 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus haemolyticus (strain JCSC1435)
Q7CCJ4 5.22e-32 123 47 0 125 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HL73 5.22e-32 123 47 0 125 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8VRH0 5.22e-32 123 47 0 125 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis
Q53922 5.28e-32 123 42 0 143 1 glcB PTS system glucoside-specific EIICBA component Staphylococcus carnosus (strain TM300)
A5IVW5 3.55e-31 121 45 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain JH9)
A6U4R9 3.55e-31 121 45 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain JH1)
P20166 5.44e-31 120 43 1 148 1 ptsG PTS system glucose-specific EIICBA component Bacillus subtilis (strain 168)
Q6GDR0 6.08e-31 120 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MRSA252)
Q8NUS2 7.39e-31 120 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MW2)
A8Z3D6 7.39e-31 120 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6D6 7.39e-31 120 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MSSA476)
A6QK27 7.39e-31 120 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Newman)
Q5HD13 7.39e-31 120 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain COL)
Q2FV87 7.39e-31 120 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDW8 7.39e-31 120 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain USA300)
P39816 1.1e-30 119 47 0 124 2 gamP PTS system glucosamine-specific EIICBA component Bacillus subtilis (strain 168)
Q2YWC1 1.26e-30 119 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A3G4 1.72e-30 119 44 0 128 1 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain N315)
Q99R97 1.72e-30 119 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X6P1 1.72e-30 119 44 0 128 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q46072 1.31e-29 116 43 1 133 4 ptsM PTS system mannose-specific EIIBCA component Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q45298 6.59e-29 114 42 0 127 3 ptsG PTS system glucose-specific EIIBCA component Corynebacterium glutamicum
P12655 6.22e-28 112 38 2 149 1 scrA PTS system sucrose-specific EIIBCA component Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P26207 6.88e-28 111 36 2 156 3 arbF PTS system beta-glucoside-specific EIIBCA component Dickeya chrysanthemi
P45618 1.31e-27 103 37 0 124 1 crr PTS system glucose-specific EIIA component Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
P08722 1.11e-26 108 39 1 147 1 bglF PTS system beta-glucoside-specific EIIBCA component Escherichia coli (strain K12)
P35595 6.15e-26 106 44 0 120 3 exp5 PTS system glucose-specific EIICBA component Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P43466 3.42e-25 104 42 1 120 3 rafP Raffinose carrier protein Pediococcus pentosaceus
P40739 1.19e-24 102 39 0 124 3 bglP PTS system beta-glucoside-specific EIIBCA component Bacillus subtilis (strain 168)
Q9KF90 1.17e-23 99 35 0 125 3 bglP PTS system beta-glucoside-specific EIIBCA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P23936 4.57e-22 95 35 0 139 3 lacS Lactose permease Streptococcus thermophilus
P22733 1.92e-21 93 36 1 125 3 lacY Lactose permease Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q7WTB2 6.4e-21 92 42 3 128 2 lacS Lactose permease Lactobacillus helveticus
P43470 2.74e-19 87 32 0 131 3 scrA PTS system sucrose-specific EIIBCA component Pediococcus pentosaceus
Q48624 2.15e-11 64 33 1 103 3 lacS Lactose permease Leuconostoc lactis
P47315 2.44e-10 61 30 7 163 3 ptsG PTS system glucose-specific EIICBA component Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75569 7.22e-09 57 31 5 132 3 ptsG PTS system glucose-specific EIICBA component Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O32292 4.54e-08 51 41 0 63 3 yyzE Putative phosphotransferase enzyme IIA component YyzE Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09030
Feature type CDS
Gene crr
Product PTS glucose transporter subunit IIA
Location 1967937 - 1968446 (strand: 1)
Length 510 (nucleotides) / 169 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1667
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00358 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2190 Carbohydrate transport and metabolism (G) G Phosphotransferase system IIA component

Kegg Ortholog Annotation(s)

Protein Sequence

MGLFDKLKSLVSEEKKGSGTIDIVAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPAGHKIVAPVDGTIGKIFETNHAFSIESDNGIELFVHFGIDTVELKGEGFKRIAEEGQQVKVGDTVLEFDLAVLEEKAKSVLTPVVISNMDEIQGLTKMTGPVTVGETVVMQIKK

Flanking regions ( +/- flanking 50bp)

ATAACGTTAGCCAGAGCCCGGTCCCAACTAAAATAATTAGGAGAAGATTCATGGGTCTGTTTGATAAATTAAAATCACTGGTTTCAGAGGAAAAGAAAGGCAGTGGCACGATTGATATTGTTGCACCACTTTCTGGTGAAATCGTCAATATCGAAGATGTTCCTGATGTTGTTTTCGCTGAAAAAATTGTAGGTGACGGTATTGCTATCAAACCTGCTGGTCATAAAATTGTTGCACCAGTTGATGGTACTATCGGTAAAATTTTCGAGACTAACCATGCTTTCTCTATTGAGTCTGACAACGGTATCGAATTATTTGTCCACTTCGGTATCGACACAGTTGAACTAAAAGGTGAAGGATTTAAACGTATCGCTGAAGAAGGTCAACAAGTTAAAGTCGGTGATACTGTTTTAGAATTTGATTTAGCTGTTTTAGAAGAAAAAGCAAAATCGGTATTAACACCGGTTGTAATTTCTAATATGGATGAAATCCAAGGTTTAACTAAAATGACAGGCCCAGTAACTGTTGGTGAAACCGTTGTAATGCAGATCAAAAAATAATTTTTAATCTGTTCTCACTTTTAAACCGCCACATTTCCTCTGTGGCGGTT