Homologs in group_1709

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11590 FBDBKF_11590 100.0 Morganella morganii S1 crr PTS glucose transporter subunit IIA
EHELCC_17510 EHELCC_17510 100.0 Morganella morganii S2 crr PTS glucose transporter subunit IIA
NLDBIP_18720 NLDBIP_18720 100.0 Morganella morganii S4 crr PTS glucose transporter subunit IIA
HKOGLL_18700 HKOGLL_18700 100.0 Morganella morganii S5 crr PTS glucose transporter subunit IIA
F4V73_RS08090 F4V73_RS08090 96.4 Morganella psychrotolerans crr PTS glucose transporter subunit IIA
PMI_RS09030 PMI_RS09030 89.9 Proteus mirabilis HI4320 crr PTS glucose transporter subunit IIA

Distribution of the homologs in the orthogroup group_1709

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1709

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A283 1.62e-102 294 89 0 169 1 crr PTS system glucose-specific EIIA component Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A284 1.62e-102 294 89 0 169 1 crr PTS system glucose-specific EIIA component Salmonella typhi
P69785 2.11e-102 294 88 0 169 3 crr PTS system glucose-specific EIIA component Shigella flexneri
P69783 2.11e-102 294 88 0 169 1 crr PTS system glucose-specific EIIA component Escherichia coli (strain K12)
P69784 2.11e-102 294 88 0 169 3 crr PTS system glucose-specific EIIA component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45338 1.17e-79 236 70 1 169 1 crr PTS system glucose-specific EIIA component Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8KA51 1.59e-64 198 63 0 147 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9WXI7 1.86e-60 187 60 0 151 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89B05 2.32e-58 182 61 0 149 3 crr PTS system glucose-specific EIIA component Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q44840 4.41e-52 167 53 0 140 3 crr PTS system glucose-specific EIIA component Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8CZD5 2.09e-43 144 40 1 162 3 crr PTS system glucose-specific EIIA component Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q814U8 6.43e-43 143 45 2 166 3 crr PTS system glucose-specific EIIA component Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81JY0 7.49e-43 143 45 2 166 3 crr PTS system glucose-specific EIIA component Bacillus anthracis
Q9KCQ4 3.79e-42 141 44 2 170 3 crr PTS system glucose-specific EIIA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P45604 1.13e-41 150 49 1 147 3 nagE PTS system N-acetylglucosamine-specific EIICBA component Klebsiella pneumoniae
P09323 2.6e-40 146 47 1 149 1 nagE PTS system N-acetylglucosamine-specific EIICBA component Escherichia coli (strain K12)
Q6GGY5 2.38e-37 129 40 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MRSA252)
P60857 2.77e-37 129 40 1 162 1 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain N315)
P60856 2.77e-37 129 40 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q93P61 3.09e-37 129 40 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus
Q5HFZ9 3.09e-37 129 40 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain COL)
Q8CP79 3.16e-37 129 39 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB5 3.16e-37 129 39 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8NWR1 1.38e-36 127 39 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MW2)
Q6G9D9 1.38e-36 127 39 1 162 3 crr PTS system glucose-specific EIIA component Staphylococcus aureus (strain MSSA476)
Q7A807 3.74e-36 135 46 2 143 1 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain N315)
Q99X32 3.74e-36 135 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IP58 3.74e-36 135 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain JH9)
A6TXX3 3.74e-36 135 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain JH1)
A7WXI2 3.74e-36 135 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YUZ1 6.44e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NYM1 7.18e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MW2)
A8Z0F5 7.18e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain USA300 / TCH1516)
Q6GCT7 7.18e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MSSA476)
A6QDH3 7.18e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain Newman)
Q5HJI3 7.18e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain COL)
Q2G1G8 7.18e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK73 7.18e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain USA300)
Q6GKB7 7.77e-36 134 46 2 143 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus aureus (strain MRSA252)
Q4A0C4 9.56e-36 134 46 0 129 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P42015 2.24e-35 128 43 2 148 3 ptsG PTS system glucose-specific EIICBA component (Fragment) Geobacillus stearothermophilus
P50829 2.77e-34 121 43 0 128 4 ptsA Phosphotransferase enzyme IIA component PtsA Bacillus subtilis (strain 168)
Q7CCJ4 1.33e-33 128 46 1 139 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HL73 1.33e-33 128 46 1 139 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8VRH0 1.33e-33 128 46 1 139 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus epidermidis
Q57071 1.18e-32 125 42 0 143 1 ptsG PTS system glucose-specific EIICBA component Staphylococcus carnosus (strain TM300)
Q4L945 1.31e-32 125 49 0 122 3 ptsG PTS system glucose-specific EIICBA component Staphylococcus haemolyticus (strain JCSC1435)
P20166 2.09e-32 124 44 1 148 1 ptsG PTS system glucose-specific EIICBA component Bacillus subtilis (strain 168)
P39816 3.45e-32 124 47 0 124 2 gamP PTS system glucosamine-specific EIICBA component Bacillus subtilis (strain 168)
Q53922 3.86e-32 124 43 0 143 1 glcB PTS system glucoside-specific EIICBA component Staphylococcus carnosus (strain TM300)
A5IVW5 1.76e-31 122 45 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain JH9)
A6U4R9 1.76e-31 122 45 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain JH1)
Q45298 1.95e-31 122 40 0 147 3 ptsG PTS system glucose-specific EIIBCA component Corynebacterium glutamicum
Q6GDR0 2.98e-31 121 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MRSA252)
Q8NUS2 3.7e-31 121 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MW2)
A8Z3D6 3.7e-31 121 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6D6 3.7e-31 121 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain MSSA476)
A6QK27 3.7e-31 121 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Newman)
Q5HD13 3.7e-31 121 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain COL)
Q2FV87 3.7e-31 121 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDW8 3.7e-31 121 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain USA300)
Q2YWC1 7.1e-31 120 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A3G4 1.11e-30 119 44 0 127 1 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain N315)
Q99R97 1.11e-30 119 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X6P1 1.11e-30 119 44 0 127 3 glcB PTS system glucoside-specific EIICBA component Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q46072 2.12e-30 119 40 0 148 4 ptsM PTS system mannose-specific EIIBCA component Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P12655 4.12e-29 115 39 2 149 1 scrA PTS system sucrose-specific EIIBCA component Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P35595 7.37e-29 114 45 0 122 3 exp5 PTS system glucose-specific EIICBA component Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P26207 4.3e-28 112 41 0 126 3 arbF PTS system beta-glucoside-specific EIIBCA component Dickeya chrysanthemi
P45618 4.74e-28 105 38 2 147 1 crr PTS system glucose-specific EIIA component Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
P08722 3.54e-27 109 38 1 147 1 bglF PTS system beta-glucoside-specific EIIBCA component Escherichia coli (strain K12)
P43466 4.72e-26 106 35 0 142 3 rafP Raffinose carrier protein Pediococcus pentosaceus
Q9KF90 3.54e-25 103 34 0 129 3 bglP PTS system beta-glucoside-specific EIIBCA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P40739 1.3e-24 102 38 0 124 3 bglP PTS system beta-glucoside-specific EIIBCA component Bacillus subtilis (strain 168)
P22733 4.26e-22 95 36 1 125 3 lacY Lactose permease Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
P23936 6.17e-22 94 35 0 139 3 lacS Lactose permease Streptococcus thermophilus
P43470 8.38e-22 94 33 0 131 3 scrA PTS system sucrose-specific EIIBCA component Pediococcus pentosaceus
Q7WTB2 2.83e-20 90 45 1 104 2 lacS Lactose permease Lactobacillus helveticus
Q48624 1.95e-12 67 32 1 110 3 lacS Lactose permease Leuconostoc lactis
P47315 8.87e-12 65 31 7 163 3 ptsG PTS system glucose-specific EIICBA component Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75569 3.82e-11 63 30 7 159 3 ptsG PTS system glucose-specific EIICBA component Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O32292 1.81e-09 54 42 0 63 3 yyzE Putative phosphotransferase enzyme IIA component YyzE Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_17950
Feature type CDS
Gene crr
Product PTS glucose transporter subunit IIA
Location 11788 - 12297 (strand: -1)
Length 510 (nucleotides) / 169 (amino acids)
In genomic island -

Contig

Accession ZDB_381
Length 42053 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1709
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00358 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2190 Carbohydrate transport and metabolism (G) G Phosphotransferase system IIA component

Kegg Ortholog Annotation(s)

Protein Sequence

MGLFDKLKSLVSDDKKDSCTIDIVAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPAGNKIVAPVDGTIGKIFETNHAFSIESDSGIELFVHFGIDTVELKGEGFKRIAEEGQRVQKGDLVLEFDLALLEEKAKSTLTPVVISNMDEIKEMTKMTGPVTVGETVVIKIKK

Flanking regions ( +/- flanking 50bp)

AGAAAGCCAAATTCACGCCCGGTCCCGTATCAACATTTAGGAGAGTATTCATGGGTCTGTTTGACAAACTGAAGTCGCTGGTTTCGGATGATAAGAAAGACAGCTGCACGATTGACATCGTGGCGCCGCTGTCCGGTGAGATTGTGAATATCGAAGACGTGCCTGACGTTGTTTTCGCTGAAAAAATTGTCGGCGATGGTATTGCCATCAAACCGGCAGGGAATAAAATCGTTGCCCCTGTTGACGGTACAATCGGTAAAATTTTTGAAACTAATCACGCGTTCTCCATTGAATCGGACAGCGGAATTGAACTGTTTGTTCACTTCGGGATCGACACTGTCGAACTGAAAGGTGAAGGCTTCAAACGTATTGCGGAAGAAGGCCAGCGCGTACAAAAAGGCGACCTGGTACTTGAATTCGATCTGGCGCTTCTCGAAGAGAAAGCCAAATCCACCCTGACCCCGGTGGTTATCTCCAATATGGATGAAATCAAAGAGATGACCAAAATGACCGGCCCTGTCACTGTCGGCGAAACCGTTGTCATCAAAATCAAAAAATAACGGCTTCTGCATCACAGTCTGTACACTGAAAAACGGTTTCTGCGGAAGCC