Homologs in group_1922

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14300 FBDBKF_14300 85.9 Morganella morganii S1 fabB beta-ketoacyl-ACP synthase I
EHELCC_07980 EHELCC_07980 85.9 Morganella morganii S2 fabB beta-ketoacyl-ACP synthase I
NLDBIP_08305 NLDBIP_08305 85.9 Morganella morganii S4 fabB beta-ketoacyl-ACP synthase I
LHKJJB_05960 LHKJJB_05960 85.9 Morganella morganii S3 fabB beta-ketoacyl-ACP synthase I
HKOGLL_04955 HKOGLL_04955 85.9 Morganella morganii S5 fabB beta-ketoacyl-ACP synthase I
F4V73_RS02605 F4V73_RS02605 87.1 Morganella psychrotolerans fabB beta-ketoacyl-ACP synthase I

Distribution of the homologs in the orthogroup group_1922

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1922

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A953 0.0 674 81 3 405 1 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Escherichia coli (strain K12)
P0A954 0.0 674 81 3 405 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P43710 0.0 594 71 3 405 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q02K94 0.0 566 67 2 404 1 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q89AY4 0.0 525 62 5 406 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8KA28 4.37e-170 484 61 5 407 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57193 2.42e-169 483 57 5 406 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q83E37 6.5e-89 278 41 9 410 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q9KQH9 9.54e-85 267 39 9 414 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P55338 2.76e-84 266 40 9 413 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Vibrio harveyi
O34340 6.44e-84 265 41 7 411 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Bacillus subtilis (strain 168)
P56902 4.64e-79 253 39 11 424 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Rhizobium meliloti (strain 1021)
P0AAI8 1.3e-76 246 38 7 411 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Shigella flexneri
P0AAI5 1.3e-76 246 38 7 411 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Escherichia coli (strain K12)
P0AAI6 1.3e-76 246 38 7 411 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAI7 1.3e-76 246 38 7 411 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Escherichia coli O157:H7
P52410 7.19e-76 246 37 6 413 1 KAS1 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic Arabidopsis thaliana
Q8NXE1 7.24e-75 241 39 11 414 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain MW2)
Q6GAU2 7.24e-75 241 39 11 414 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain MSSA476)
Q5HHA1 7.24e-75 241 39 11 414 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain COL)
Q7A6F8 1.69e-74 241 39 11 414 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain N315)
Q99VA6 1.69e-74 241 39 11 414 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GIA3 4.29e-74 239 39 11 413 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain MRSA252)
O94297 2.25e-73 238 34 9 426 3 SPBC887.13c Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P73283 6.52e-73 236 36 6 411 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5TKS0 5.84e-72 234 40 11 407 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) Staphylococcus aureus
P23902 4.2e-71 233 36 8 417 1 KAS12 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic Hordeum vulgare
Q9C9P4 6.21e-70 232 36 12 416 1 KAS2 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic Arabidopsis thaliana
Q8L3X9 7.46e-68 225 36 12 431 1 KAS 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Arabidopsis thaliana
Q9D404 1.35e-66 221 33 9 418 1 Oxsm 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Mus musculus
Q9NWU1 8.22e-65 217 33 10 418 1 OXSM 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Homo sapiens
Q0VCA7 1.97e-60 205 33 10 418 2 OXSM 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Bos taurus
P72331 6.29e-60 202 33 5 405 3 nodE Nodulation protein E Rhizobium sp. (strain N33)
P9WQD7 1.71e-59 202 33 5 406 1 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQD6 1.71e-59 202 33 5 406 3 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63457 1.71e-59 202 33 5 406 3 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQD9 1.24e-57 197 35 7 397 1 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQD8 1.24e-57 197 35 7 397 3 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
H8ESN0 1.24e-57 197 35 7 397 2 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)
P63455 1.24e-57 197 35 7 397 3 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P06230 7.56e-57 194 32 6 406 3 nodE Nodulation protein E Rhizobium meliloti (strain 1021)
Q9CBS7 3.51e-56 193 34 6 397 3 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium leprae (strain TN)
O69473 8.98e-56 192 31 4 406 3 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium leprae (strain TN)
P04684 5.34e-54 187 32 7 406 3 nodE Nodulation protein E Rhizobium leguminosarum bv. trifolii
P16538 1.22e-53 186 32 10 423 1 tcmK Tetracenomycin polyketide synthase ketoacyl synthase alpha subunit Streptomyces glaucescens
P06231 1.62e-53 186 32 8 411 3 nodE Nodulation protein E Rhizobium meliloti
Q05356 1.41e-52 184 32 14 423 3 sch1 Putative polyketide beta-ketoacyl synthase 1 Streptomyces halstedii
P41175 8.1e-52 182 32 13 425 3 None Putative polyketide beta-ketoacyl synthase 1 Streptomyces virginiae
P04683 2.66e-51 180 32 6 406 3 nodE Nodulation protein E Rhizobium leguminosarum bv. viciae
P16540 8.88e-51 179 32 8 419 3 gra-orf1 Granaticin polyketide putative beta-ketoacyl synthase 1 Streptomyces violaceoruber
P39525 1.86e-50 179 30 13 444 1 CEM1 3-oxoacyl-[acyl-carrier-protein] synthase homolog Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q02059 3.16e-49 176 31 11 419 1 SCO5087 Actinorhodin polyketide putative beta-ketoacyl synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q02578 1.79e-48 173 32 16 425 3 curA Putative polyketide beta-ketoacyl synthase 1 Streptomyces cyaneus
P23155 1.55e-45 165 29 13 426 3 SCO5318 Putative polyketide beta-ketoacyl synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P43678 4.77e-45 164 31 12 422 3 None Oxytetracycline polyketide putative beta-ketoacyl synthase 1 Streptomyces rimosus
P40804 3.38e-40 150 30 12 401 1 pksF Polyketide biosynthesis malonyl-ACP decarboxylase PksF Bacillus subtilis (strain 168)
Q54FQ2 2.64e-29 124 28 11 350 3 pks30 Probable polyketide synthase 30 Dictyostelium discoideum
Q54IX3 3.92e-29 123 27 11 346 3 pks26 Probable polyketide synthase 26 Dictyostelium discoideum
Q54FP8 2.68e-27 118 27 10 355 3 pks32 Probable polyketide synthase 32 Dictyostelium discoideum
Q54FQ1 2.7e-27 118 27 11 352 3 pks31 Probable polyketide synthase 31 Dictyostelium discoideum
Q558W4 3.93e-27 117 28 9 315 3 pks15 Probable polyketide synthase 15 Dictyostelium discoideum
Q54FQ3 4.11e-27 117 26 11 360 3 pks29 Probable polyketide synthase 29 Dictyostelium discoideum
Q54FN7 4.35e-27 117 26 10 349 3 pks33 Probable polyketide synthase 33 Dictyostelium discoideum
Q54FN2 6.59e-27 117 26 10 350 3 pks34 Probable polyketide synthase 34 Dictyostelium discoideum
Q55E72 2.46e-26 115 25 13 446 1 stlA Probable polyketide synthase 1 Dictyostelium discoideum
I6X8D2 4.03e-26 114 30 16 426 1 pks13 Polyketide synthase Pks13 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B0G170 1.52e-25 112 25 9 345 3 pks28 Probable polyketide synthase 28 Dictyostelium discoideum
Q54FC8 1.57e-25 112 26 10 347 3 pks39 Probable polyketide synthase 39 Dictyostelium discoideum
Q54FD2 1.6e-25 112 26 10 347 3 pks38 Probable polyketide synthase 38 Dictyostelium discoideum
B3FWU0 6e-25 111 28 12 343 1 rdc5 Reducing polyketide synthase rdc5 Metacordyceps chlamydosporia
Q54G30 6.56e-25 111 27 7 282 3 pks27 Probable polyketide synthase 27 Dictyostelium discoideum
Q869W9 1.6e-24 110 29 11 298 2 pks16 Probable polyketide synthase 16 Dictyostelium discoideum
G3Y419 3.71e-24 108 26 11 348 1 yanA 6-methylsalicylic acid synthase Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q869X2 3.08e-23 105 24 15 432 3 pks17 Probable polyketide synthase 17 Dictyostelium discoideum
Q559A9 1.44e-22 103 23 10 349 3 pks13 Probable polyketide synthase 13 Dictyostelium discoideum
E9F5E7 1.5e-22 103 30 10 286 1 subA Non-reducing polyketide synthase subA Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q7SHI6 1.58e-22 103 29 10 344 2 srdA Highly reducing polyketide synthase srdA Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A0A6S5ZY48 1.6e-22 103 29 7 295 2 g433 Highly reducing polyketide synthase g433 Fusarium sp.
P9WEX6 1.64e-22 103 30 10 286 1 dpmaA Non-reducing polyketide synthase dpmaA Metarhizium anisopliae
C8VJR7 1.97e-22 103 26 15 417 1 alnA Highly reducing polyketide synthase alnA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B0G138 3.7e-22 102 25 8 289 3 pks21 Probable polyketide synthase 21 Dictyostelium discoideum
B0G100 7.61e-22 102 23 15 455 3 pks7 Probable polyketide synthase 7 Dictyostelium discoideum
A0A075TRC0 7.67e-22 101 27 8 285 1 patK 6-methylsalicylic acid synthase Penicillium expansum
Q5KTM9 8.36e-22 101 27 9 336 1 alt5 Highly reducing polyketide synthase alt5 Alternaria solani
E9F8M3 9.05e-22 101 26 9 341 1 swnK PKS-NRPS hybrid synthetase swnK Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
G2Q9A5 9.6e-22 101 29 11 316 1 mycA Hybrid PKS-NRPS synthetase mycA Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)
Q558Y6 1.06e-21 101 24 17 445 3 pks14 Probable polyketide synthase 14 Dictyostelium discoideum
A1KQG0 1.11e-21 101 28 11 338 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
W7LKX1 1.11e-21 101 29 11 338 2 FUM1 Highly reducing polyketide synthase FUM1 Gibberella moniliformis (strain M3125 / FGSC 7600)
P9WQE9 1.17e-21 101 28 11 338 1 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE8 1.17e-21 101 28 11 338 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9F4 1.17e-21 101 28 11 338 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q7TVK8 1.17e-21 101 28 11 338 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A0U5GK88 1.4e-21 100 28 12 359 1 ausV Highly reducing polyketide synthase ausV Aspergillus calidoustus
Q54T36 1.55e-21 100 25 8 289 3 pks19 Probable polyketide synthase 19 Dictyostelium discoideum
Q54ED6 2.07e-21 100 23 11 353 3 pks41 Probable polyketide synthase 41 Dictyostelium discoideum
Q54KU3 2.19e-21 100 25 9 349 3 pks25 Probable polyketide synthase 25 Dictyostelium discoideum
A0A4P8DJV2 2.31e-21 100 26 10 354 3 dmxL2 Highly reducing polyketide synthase dmxL2 Cryptosporiopsis sp. (strain 8999)
Q86JI5 2.87e-21 100 24 15 450 2 pks5 Probable polyketide synthase 5 Dictyostelium discoideum
Q9ZGI5 3.66e-21 99 28 7 296 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 5.59e-19 93 25 10 346 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 7.44e-15 80 25 7 341 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q55CN6 4.44e-21 99 25 8 277 3 pks3 Probable polyketide synthase 3 Dictyostelium discoideum
Q54TW0 4.94e-21 99 26 10 301 2 pks18 Probable polyketide synthase 18 Dictyostelium discoideum
A0A3G9H990 6e-21 99 28 9 277 1 ALT1 Highly reducing polyketide synthase ALT1 Alternaria alternata
A0A193PS74 6.49e-21 99 27 14 387 1 stbA Non-reducing polyketide synthase stbA Stachybotrys bisbyi
D7UQ44 7.08e-21 99 27 10 350 1 sol1 Prosolanapyrone synthase Alternaria solani
B0G0Z9 7.57e-21 99 23 13 446 3 pks6 Probable polyketide synthase 6 Dictyostelium discoideum
Q71SP7 7.85e-21 99 28 14 336 1 FASN Fatty acid synthase Bos taurus
P12276 1.2e-20 98 26 17 441 1 FASN Fatty acid synthase Gallus gallus
Q2T4N1 1.48e-20 98 27 8 346 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N1 8.31e-14 77 23 8 345 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N1 2.02e-13 76 25 10 348 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N1 2.36e-13 75 25 9 342 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
S7Z800 1.5e-20 98 29 9 286 3 opdA Hybrid PKS-NRPs synthetase opdA Penicillium oxalicum (strain 114-2 / CGMCC 5302)
A0A1L7U4V5 1.51e-20 97 26 6 309 2 FMN1 Reducing polyketide synthase 8 Fusarium mangiferae
A0A179H0J7 1.95e-20 97 30 6 285 2 lcsC Highly reducing polyketide synthase lcsC Purpureocillium lilacinum
Q7TXM0 1.96e-20 97 30 7 273 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0R1E8 2.23e-20 97 29 9 297 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0A0Y0M151 2.29e-20 97 26 9 341 1 cla2 Highly reducing polyketide synthase cla2 Cladosporium cladosporioides
Q54KU5 2.76e-20 97 27 10 296 3 pks24 Probable polyketide synthase 24 Dictyostelium discoideum
S3D9F1 2.77e-20 97 28 9 303 1 gloL Highly reducing polyketide synthase gloL Glarea lozoyensis (strain ATCC 20868 / MF5171)
A0A2P1DP91 2.87e-20 97 25 8 313 1 macA 6-methylsalicylic acid synthase Penicillium terrestre
K3VA96 3.1e-20 97 26 9 339 3 PKS40 Highly reducing polyketide synthase 40 Fusarium pseudograminearum (strain CS3096)
D9N1A1 3.14e-20 97 26 9 349 2 ACTTS3 Highly reducing polyketide synthase ACTTS3 Alternaria alternata
P49327 3.57e-20 96 27 17 430 1 FASN Fatty acid synthase Homo sapiens
Q54ED7 3.92e-20 96 24 11 352 3 pks40 Probable polyketide synthase 40 Dictyostelium discoideum
Q02251 4.38e-20 96 28 8 290 1 mas Mycocerosic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P40806 5.09e-20 96 25 13 424 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
P40806 8.95e-15 80 25 10 356 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
P40806 4.09e-14 78 26 8 280 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
P19096 5.24e-20 96 28 12 334 1 Fasn Fatty acid synthase Mus musculus
A0A481WNP4 5.38e-20 96 28 10 281 3 traA Hybrid PKS-NRPS synthetase traA Penicillium crustosum
Q02579 6.23e-20 94 25 14 415 3 curB Putative polyketide beta-ketoacyl synthase 2 Streptomyces cyaneus
G4N296 6.36e-20 95 28 9 346 2 PKS19 Highly reducing polyketide synthase 19 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
P9WQE6 6.83e-20 95 29 7 273 3 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQE7 6.89e-20 95 29 7 273 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P12785 7.14e-20 95 28 12 334 1 Fasn Fatty acid synthase Rattus norvegicus
B0G103 8.03e-20 95 23 15 431 3 pks10 Probable polyketide synthase 10 Dictyostelium discoideum
Q54B49 8.46e-20 95 25 9 306 3 pks45 Probable polyketide synthase 45 Dictyostelium discoideum
C5H885 8.77e-20 95 28 13 345 3 rads1 Reducing polyketide synthase rads1 Floropilus chiversii
Q54B51 9.27e-20 95 25 9 303 3 pks44 Probable polyketide synthase 44 Dictyostelium discoideum
A0A5C1RDA3 9.32e-20 95 26 10 338 3 orf7 Highly reducing polyketide synthase Didymella fabae
Q03132 9.84e-20 95 26 10 336 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
Q03132 1.84e-15 82 23 11 340 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
Q2HBN0 1.01e-19 95 28 7 283 1 cghG Hybrid PKS-NRPS synthetase cghG Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
A0A1W5T1U1 1.13e-19 95 29 8 301 2 poxE Hybrid PKS-NRPS synthetase poxE Penicillium oxalicum
P9WQE3 1.2e-19 95 26 9 342 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit D Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE2 1.2e-19 95 26 9 342 3 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TXL7 1.2e-19 95 26 9 342 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A017SEX7 1.25e-19 95 28 8 288 1 fogA Highly reducing polyketide synthase fogA Aspergillus ruber (strain CBS 135680)
S7ZFK6 1.28e-19 95 29 8 301 2 poxE Hybrid PKS-NRPS synthetase poxE Penicillium oxalicum (strain 114-2 / CGMCC 5302)
I1RVD8 1.48e-19 95 29 12 341 3 PKS6 Highly reducing polyketide synthase PKS6 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
M2XHZ5 1.57e-19 94 28 16 391 2 pksA Norsolorinic acid synthase Dothistroma septosporum (strain NZE10 / CBS 128990)
Q30DW5 1.57e-19 94 28 16 391 2 pksA Norsolorinic acid synthase Dothistroma septosporum
B8MKY6 1.67e-19 94 31 11 277 1 tstA Highly reducing polyketide synthase tstA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
A0A8F4S6Z6 1.75e-19 94 29 9 283 1 pydA Hybrid PKS-NRPS synthetase pydA Acremonium sp.
B6HNK3 1.83e-19 94 28 11 337 3 sorA Highly reducing polyketide synthase sorA Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
A0A482N9V7 2.04e-19 94 26 10 350 1 iccA Hybrid PKS-NRPS synthetase iccA Talaromyces variabilis
Q86AE3 2.19e-19 94 23 15 447 2 pks9 Probable polyketide synthase 9/36 Dictyostelium discoideum
K2QVI8 2.19e-19 94 26 7 285 1 dpmpA Non-reducing polyketide synthase dpmpA Macrophomina phaseolina (strain MS6)
Q2ABP6 2.2e-19 94 28 8 269 1 pksF Reducing polyketide synthase pksF Alternaria solani
A0A2L0P0K3 2.34e-19 94 26 9 336 1 TwmB Polyketide synthase-nonribosomal peptide synthetase TwmB Talaromyces wortmannii
O31782 2.36e-19 94 27 13 362 1 pksN Polyketide synthase PksN Bacillus subtilis (strain 168)
O31782 5.54e-15 80 27 13 359 1 pksN Polyketide synthase PksN Bacillus subtilis (strain 168)
O31782 1.48e-14 79 24 16 447 1 pksN Polyketide synthase PksN Bacillus subtilis (strain 168)
Q0CF73 2.8e-19 94 25 10 353 1 ATEG_07661 Non-reducing polyketide synthase ATEG_07661 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P22367 3.04e-19 94 27 8 283 1 None 6-methylsalicylic acid synthase Penicillium patulum
A0A1Y0BRF1 3.48e-19 94 26 18 438 3 adrD Non-reducing polyketide synthase adrD Penicillium roqueforti
D7PHZ2 4.12e-19 93 28 9 334 1 vrtA Non-reducing polyketide synthase vrtA Penicillium aethiopicum
G9N4B2 4.26e-19 93 24 11 380 1 virA Highly reducing polyketide synthase virA Hypocrea virens (strain Gv29-8 / FGSC 10586)
Q05470 4.83e-19 93 24 13 426 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
Q05470 3.83e-15 81 31 15 301 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
Q05470 8.28e-15 80 23 13 441 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
Q05470 2.02e-13 76 26 7 279 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
A0A0M4L8I7 5e-19 93 26 10 354 1 aurA Highly reducing polyketide synthase aurA Calcarisporium arbuscula
A0A1B3PEI8 5.23e-19 93 27 7 273 1 ORF-B Polyunsaturated fatty acid synthase subunit B Thraustochytrium sp. (strain ATCC 26185 / S-3)
Q03131 5.33e-19 93 26 7 298 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q03131 1.15e-14 80 26 9 342 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q9ZGI3 5.49e-19 93 26 10 342 1 pikAIII Narbonolide/10-deoxymethynolide synthase PikA3, module 5 Streptomyces venezuelae
O53901 5.5e-19 93 29 9 294 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q5ATG8 5.68e-19 93 28 11 305 1 apdA Hybrid PKS-NRPS synthetase apdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0A0RM07 6.46e-19 92 25 11 343 1 MLNS Mellein synthase Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A1L9WLD9 7.34e-19 92 31 10 283 1 AacuL Atrochrysone carboxylic acid synthase AacuL Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
Q5BEJ4 7.68e-19 92 28 7 276 1 afoG Asperfuranone polyketide synthase afoG Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B0G101 7.88e-19 92 24 11 350 3 pks8 Probable polyketide synthase 8/35 Dictyostelium discoideum
P96202 9.62e-19 92 27 10 343 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7TXL8 9.62e-19 92 27 10 343 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5BA83 1.05e-18 92 27 9 333 3 easB Highly reducing polyketide synthase easB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q55DM7 1.19e-18 92 27 8 292 3 pks2 Probable polyketide synthase 2 Dictyostelium discoideum
P0CU84 1.36e-18 92 27 6 272 1 apmlA Highly reducing polyketide synthase apmlA Arthrinium phaeospermum
P0DO30 1.36e-18 92 28 10 280 1 iliA Hybrid PKS-NRPS synthetase iliA Neonectria sp. (strain DH2)
P16539 1.4e-18 90 23 10 409 1 tcmL Tetracenomycin polyketide synthase ketoacyl synthase beta subunit Streptomyces glaucescens
W7MLD7 1.53e-18 92 27 8 335 1 FUS1 Fusarin C synthetase Gibberella moniliformis (strain M3125 / FGSC 7600)
A0A0S6XH49 1.57e-18 91 26 12 344 1 frbB Highly reducing polyketide synthase frbB Fungal sp. (strain No.11243)
B8N8R0 1.57e-18 91 26 12 357 2 afvB Non-reducing polyketide synthase afvB Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A1CFL8 1.65e-18 91 27 10 283 1 patK 6-methylcalicylic acide synthase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
A0A5C1RD96 1.65e-18 91 28 8 288 3 pksAC Non-reducing polyketide synthase AC Didymella fabae
S0EEY3 1.74e-18 91 27 9 335 1 FUS1 Fusarin C synthetase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q84HC6 2.19e-18 91 25 9 292 1 ncsB Neocarzinostatin naphthoate synthase Streptomyces carzinostaticus
A0A167LUQ4 2.21e-18 91 28 10 311 3 fumoS Fumosorinone synthetase Cordyceps fumosorosea (strain ARSEF 2679)
Q4WQZ5 2.26e-18 91 30 11 282 2 tpcC Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9ZGI4 2.31e-18 91 26 7 297 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q9ZGI4 2.67e-18 91 26 11 342 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
A0A1B7YCC9 2.39e-18 91 28 7 287 1 dpchA Non-reducing polyketide synthase dpchA Colletotrichum higginsianum (strain IMI 349063)
Q4WLD4 3.04e-18 90 26 10 353 1 pyr2 Non-reducing polyketide synthase pyr2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P9WEZ4 3.48e-18 90 25 10 341 2 pytA Hybrid PKS-NRPS synthetase pytA Aspergillus terreus
A0A6J4B487 3.89e-18 90 27 10 351 3 LUC5 Hybrid PKS-NRPS synthetase LUC5 Fusarium sp.
A0A089QRB9 4.26e-18 90 27 8 292 1 msl3 Mycolipanoate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A455M2Y3 4.27e-18 90 27 11 341 2 ntnH Highly reducing polyketide synthase ntnH Nectria sp.
Q07017 4.45e-18 90 25 9 342 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
Q07017 1.05e-15 83 24 8 326 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
P9WES9 5.08e-18 90 27 6 275 1 PFUR17_0229 Non-reducing polyketide synthase PFUR17_0229 Pseudevernia furfuracea
Q0CZH1 5.28e-18 89 25 10 341 2 pytA Hybrid PKS-NRPS synthetase pytA (Fragment) Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q5BEJ6 5.56e-18 90 24 11 350 1 afoE Iterative polyketide synthase afoE Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q3S2T9 6.15e-18 90 27 8 315 1 mokA Lovastatin nonaketide synthase mokA Monascus pilosus
Q4WKW9 6.71e-18 89 29 7 273 1 fgnA Fumigermin synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P96284 6.79e-18 89 28 9 296 1 pks15 Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B3FWT3 7.08e-18 89 27 10 344 1 hpm8 Reducing polyketide synthase hmp8 Hypomyces subiculosus
B6QK76 7.16e-18 89 24 12 398 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN5 7.16e-18 89 24 12 398 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei
A0A1L9WN37 7.52e-18 89 27 8 283 1 acuA 6-methylsalicylic acid synthase acuA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
Q03133 9.78e-18 89 25 7 289 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
Q03133 4.58e-08 59 24 12 342 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
Q3S2U6 1.02e-17 89 25 5 286 1 mokB Lovastatin diketide synthase mokB Monascus pilosus
A0A2Z5XAL7 1.17e-17 89 28 8 280 1 phm1 Hybrid PKS-NRPS synthetase phm1 Pyrenochaetopsis sp.
A0A8F4S8Q3 1.22e-17 89 26 13 381 1 gkaA Hybrid PKS-NRPS synthetase gkaA Penicillium citrinum
A0A0G0AID6 1.22e-17 89 27 9 309 1 thnA Hybrid PKS-NRPS synthetase thnA Trichoderma harzianum
A0A097ZPE0 1.23e-17 89 28 7 271 1 andM Non-reducing polyketide synthase andM Emericella variicolor
A0A0N7D745 1.42e-17 89 27 8 306 2 Dhc5 Non-reducing polyketide synthase Dhc5 Alternaria cinerariae
A0A6F9DXA0 1.52e-17 89 25 10 340 1 men1 Partially reducing polyketide synthase men1 Menisporopsis theobromae
A0A1B4XBH3 1.92e-17 88 28 7 271 3 sdnO Highly reducing polyketide synthase sdnO Sordaria araneosa
P23156 1.98e-17 87 25 12 414 3 SCO5317 Putative polyketide beta-ketoacyl synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
W6QDA2 2.08e-17 88 34 8 208 1 anuA Highly reducing polyketide synthase anuA Penicillium roqueforti (strain FM164)
A0A455LLX1 2.67e-17 88 28 8 266 1 atnH Highly reducing polyketide synthase atnH Arthrinium sp.
D4AU31 3.1e-17 87 24 11 345 3 swnK PKS-NRPS hybrid synthetase swnK Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
P9WEQ0 3.11e-17 87 27 12 356 3 olcA Non-reducing polyketide synthase olcA Penicillium canescens
N4WHE3 3.8e-17 87 29 10 269 3 PKS1 Reducing polyketide synthase PKS1 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
A0A0U4ZX08 3.87e-17 87 29 9 274 1 drtA Low-reducing polyketide synthase drtA Aspergillus calidoustus
Q12397 3.91e-17 87 27 14 364 2 stcA Norsolorinic acid synthase stcA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
G4MVZ2 3.94e-17 87 24 10 355 1 ACE1 Polyketide synthase-nonribosomal peptide synthetase ACE1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q7TXK8 3.99e-17 87 28 10 296 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A0D2YG10 4.33e-17 87 27 11 337 1 FUB1 Reducing polyketide synthase FUB1 Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936)
A1CLY8 4.56e-17 87 27 7 305 3 ccsA Polyketide synthase-nonribosomal peptide synthetase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
G3J453 4.6e-17 87 28 11 334 1 cm3B Highly reducing polyketide synthase cm3B Cordyceps militaris (strain CM01)
L7X8J4 4.65e-17 87 27 12 343 1 curS1 Highly reducing polyketide synthase curS1 Aspergillus terreus
G0R6S8 5.04e-17 87 26 15 421 2 sor1 Highly reducing polyketide synthase sor1 Hypocrea jecorina (strain QM6a)
Q2UB00 5.1e-17 87 27 10 312 3 ppsB Reducing polyketide synthase ppsB Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q4WA61 5.28e-17 87 27 13 337 3 nscA Non-reducing polyketide synthase nscA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B3FWT6 5.32e-17 87 28 11 318 1 rdc1 Non-reducing polyketide synthase rdc1 Metacordyceps chlamydosporia
A0A1L7U3D7 5.54e-17 87 27 8 270 2 FPY1 Highly reducing polyketide synthase 40 Fusarium mangiferae
A0A481WQB6 5.57e-17 87 26 12 394 1 claF Clavatol synthase claF Penicillium crustosum
W7MT31 5.62e-17 87 27 12 336 1 FUB1 Reducing polyketide synthase FUB1 Gibberella moniliformis (strain M3125 / FGSC 7600)
A0A3G9GQ29 5.68e-17 87 27 9 337 1 cdmE 6-hydroxymellein synthase cdmE Talaromyces verruculosus
A0A0F7U103 5.75e-17 87 28 8 273 3 ausA Non-reducing polyketide synthase ausA Penicillium brasilianum
A0A2V5GX43 5.95e-17 87 24 10 343 3 pyvA Hybrid PKS-NRPS synthetase pyvA Aspergillus violaceofuscus (strain CBS 115571)
A0A7L9EYL1 6.02e-17 87 25 13 382 1 xenE Hybrid PKS-NRPS synthetase xenE Xenoacremonium sinensis
B8MV59 6.72e-17 86 25 10 343 3 tpeA Partially reducing polyketide synthase tpeA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
A0A1W5T1T1 6.72e-17 86 25 12 367 2 poxF Highly reducing polyketide synthase poxF Penicillium oxalicum
A0A7R7ZK98 6.78e-17 86 26 13 360 3 AcPKS Atrochrysone carboxylic acid synthase Aspergillus chevalieri
A1D8I9 6.8e-17 86 27 13 337 3 nscA Non-reducing polyketide synthase nscA Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
S0DRI1 7.18e-17 86 27 11 337 1 FUB1 Reducing polyketide synthase FUB1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
G4NEB1 8.13e-17 86 35 9 225 1 NEC1 Highly reducing polyketide synthase NEC1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A0A6H0YV38 8.35e-17 86 27 8 280 2 crz7 Non-reducing polyketide synthase crz7 Cladonia metacorallifera
A0A0E4AZP0 9.36e-17 86 26 8 283 3 fsa1 Hybrid PKS-NRPS synthetase fsa1 Fusarium sp. (strain FN080326)
A0A0N7D4P6 9.48e-17 86 27 12 344 2 Dhc3 Highly reducing polyketide synthase Dhc3 Alternaria cinerariae
A0A1E1FFN8 1.01e-16 86 27 8 273 3 prhL Non-reducing polyketide synthase prhL Penicillium brasilianum
B6F209 1.05e-16 86 24 9 347 1 cpaA Cyclo-acetoacetyl-L-tryptophan synthase Aspergillus oryzae
Q54FI3 1.05e-16 86 24 10 340 1 StlB Polyketide synthase 37 Dictyostelium discoideum
Q86ZD9 1.1e-16 86 26 9 295 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain C2932)
Q0D159 1.11e-16 86 26 10 310 2 ATEG_00325 Hybrid PKS-NRPS synthetase ATEG_00325 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
B1GVX7 1.12e-16 86 25 10 355 2 BOA6 Reducing polyketide synthase BOA6 Botryotinia fuckeliana (strain B05.10)
Q0CCY3 1.14e-16 85 28 15 342 1 gedC Atrochrysone carboxylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A0N0DCA3 1.21e-16 85 24 10 347 2 DEP5 Reducing polyketide synthase DEP5 Fusarium langsethiae
A0A411KUP8 1.29e-16 85 27 7 295 1 ucsA Hybrid PKS-NRPS synthetase ucsA Acremonium sp.
S4W172 1.31e-16 85 26 8 283 1 eqxS Equisetin synthetase eqxS Fusarium heterosporum
G0R6S9 1.38e-16 85 26 8 291 2 sor2 Non-reducing polyketide synthase sor2 Hypocrea jecorina (strain QM6a)
Q0CF75 1.39e-16 85 28 8 270 1 ATEG_07659 Highly reducing polyketide synthase ATEG_07659 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q4WAZ9 1.44e-16 85 25 8 308 2 NRPS14 PKS-NRPS hybrid synthetase psoA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A0R8YWJ7 1.46e-16 85 26 16 429 1 mpas Methylphloroacetophenone synthase Cladonia uncialis
B6QK81 1.5e-16 85 28 10 283 3 pks12 Non-reducing polyketide synthase pks12 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN6 1.5e-16 85 28 10 283 3 pks12 Non-reducing polyketide synthase pks12 Talaromyces marneffei
Q9R9J1 1.7e-16 85 26 9 361 1 mycA Mycosubtilin synthase subunit A Bacillus subtilis
A0A3T0QHT6 1.7e-16 85 27 8 281 1 pvhA Hybrid PKS-NRPS synthetase pvhA Talaromyces variabilis
Q0C8M3 1.7e-16 85 25 7 312 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q9Y8A5 1.7e-16 85 25 7 312 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus
G0REX6 1.87e-16 85 26 10 352 1 iliA Hybrid PKS-NRPS synthetase iliA Hypocrea jecorina (strain QM6a)
F1DBA9 1.96e-16 85 25 6 294 1 mpaC Non-reducing polyketide synthase mapC Penicillium brevicompactum
A0A1P8NTI3 1.99e-16 85 31 7 230 2 pks8 Non-reducing polyketide synthase 8 Pestalotiopsis microspora
A0A455M7S4 2.08e-16 85 26 7 280 1 atnG Non-reducing polyketide synthase atnG Arthrinium sp.
I6XD69 2.19e-16 85 26 9 317 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I6XD69 1.93e-15 82 24 10 339 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A0N9HNS9 2.22e-16 85 26 12 354 3 desS Desertorin synthase Aspergillus desertorum
A0A067XNI2 2.24e-16 85 31 13 286 2 ptaA Non-reducing polyketide synthase ptaA Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
B6HN77 2.39e-16 85 24 7 342 3 sorB Non-reducing polyketide synthase sorB Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
Q8J0F7 2.44e-16 85 27 12 341 1 mlcA Compactin nonaketide synthase, polyketide synthase component Penicillium citrinum
Q5BBP5 2.48e-16 85 26 8 273 1 pkhB Highly reducing polyketide synthase pkhB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A481WR96 2.53e-16 85 26 11 342 3 claI Highly reducing polyketide synthase claI Penicillium crustosum
A2QK66 2.64e-16 84 27 14 357 3 ktnS Kotanin synthase Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A0A0B5KU17 2.64e-16 85 25 6 294 1 mpaC' Non-reducing polyketide synthase mapC' Penicillium brevicompactum
Q0CJ59 2.65e-16 84 24 11 344 1 atX 6-methylsalicylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A2Z5TM64 2.99e-16 84 25 10 354 3 himA Polyketide synthase-nonribosomal peptide synthetase hybrid himA Aspergillus japonicus
Q54D44 3.21e-16 84 24 7 280 3 pks42 Probable polyketide synthase 42 Dictyostelium discoideum
R4WH05 3.65e-16 84 25 10 362 3 ACRTS2 Highly reducing polyketide synthase ACRTS2 Alternaria alternata
A0A2I2F262 3.75e-16 84 25 8 358 1 acdB PKS-NRPS hybrid synthetase acdB Aspergillus candidus
A0A098D8A0 3.79e-16 84 27 10 340 2 ZEA2 Highly reducing polyketide synthase ZEA2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
E5A7D9 3.8e-16 84 24 10 345 2 pks5 Highly reducing polyketide synthase pks5 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
Q8J0F5 3.86e-16 84 26 7 292 1 mlcB Compactin diketide synthase mlcB Penicillium citrinum
B8NYX0 4.02e-16 84 24 7 297 2 fluP Cluster 41 polyketide synthase Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0A1U8QN18 4.03e-16 84 25 14 395 1 sdgA Highly reducing polyketide synthase sdgA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q12053 4.08e-16 84 27 13 364 1 aflC Norsolorinic acid synthase Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
E9KMQ2 4.19e-16 84 27 9 280 2 PKS16 Non-reducing polyketide synthase PKS16 Cladonia grayi
Q0D1N9 4.26e-16 84 30 7 229 1 terA Non-reducing polyketide synthase terA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
B8NJG3 4.4e-16 84 25 10 351 3 lepA Hybrid PKS-NRPS synthetase lepA Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
L7XAV2 4.46e-16 84 26 7 311 1 curS2 Non-reducing polyketide synthase curS2 Aspergillus terreus
D7PI15 4.84e-16 84 27 8 277 1 gsfA Non-reducing polyketide synthase gsfA Penicillium aethiopicum
Q9Y7D5 4.87e-16 84 25 9 336 1 lovF Lovastatin diketide synthase lovF Aspergillus terreus
A0A455LXK0 5.34e-16 84 25 15 414 2 ntnG Non-reducing polyketide synthase ntnG Nectria sp.
Q4W944 5.95e-16 84 26 15 379 1 encA Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A067MTM1 6.24e-16 83 24 10 369 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Botryobasidium botryosum (strain FD-172 SS1)
A0A0H4ADX3 7.11e-16 83 26 12 358 2 None Non-reducing polyketide synthase PKS19 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q9HU15 8.42e-16 82 29 12 277 1 fabY Beta-ketoacyl-[acyl-carrier-protein] synthase FabY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A089FSA4 8.65e-16 83 24 8 300 3 prlS Hybrid PKS-NRPS synthetase prlS Fungal sp. (strain NRRL 50135)
S0DS59 8.87e-16 83 26 9 279 2 PKS-NRPS1 Trichosetin synthetase PKS-NRPS1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q7TXL9 9.4e-16 83 26 8 337 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQE5 9.57e-16 83 26 8 337 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE4 9.57e-16 83 26 8 337 3 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0A6F8RNP4 1.04e-15 83 27 8 305 1 grgA Reducing polyketide synthase grgA Penicillium sp.
C5H882 1.09e-15 83 28 10 293 3 radS2 Non-reducing polyketide synthase rads2 Floropilus chiversii
B8MV60 1.1e-15 83 27 12 315 3 tpeB Non-reducing polyketide synthase tpeB Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
A0JJU1 1.18e-15 83 27 9 303 1 tenS Tenellin synthetase Beauveria bassiana
A0A348HAX6 1.2e-15 82 30 11 272 1 phiA Highly reducing polyketide synthase phiA Fungal sp. (strain ATCC 74256)
A0A084API3 1.25e-15 82 26 8 302 3 SAT13 Highly reducing polyketide synthase SAT13 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
A0A1V6NYI6 1.27e-15 82 26 9 321 3 verA Highly reducing polyketide synthase verA Penicillium polonicum
B6HV32 1.38e-15 82 25 16 434 1 adrD Non-reducing polyketide synthase adrD Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
A0A1L9WQM9 1.52e-15 82 27 9 298 2 acrA Highly reducing polyketide synthase acrA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
J4KMC1 1.63e-15 82 27 9 304 1 tenS Tenellin synthetase Beauveria bassiana (strain ARSEF 2860)
Q5B0D0 1.71e-15 82 26 9 316 1 aptA Non-reducing polyketide synthase aptA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q0C9L7 1.74e-15 82 27 9 291 1 ctvA Highly reducing polyketide synthase ctvA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q54QD1 1.79e-15 82 28 12 295 3 pks23 Probable polyketide synthase 23 Dictyostelium discoideum
Q54QD3 1.79e-15 82 28 12 295 3 pks22 Probable polyketide synthase 22 Dictyostelium discoideum
A0A0C6E0I7 1.87e-15 82 26 9 282 1 bet1 Highly reducing polyketide synthase bet1 Neocamarosporium betae
C5FM57 1.99e-15 82 27 12 316 3 nscA Non-reducing polyketide synthase nscA Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
P9WET6 2.24e-15 82 25 15 401 1 Preu3 Non-reducing polyketide synthase Preu3 Preussia isomera
I1RL11 2.3e-15 82 26 7 286 1 dpfgA Non-reducing polyketide synthase dpfgA Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A0K0MCJ4 2.33e-15 82 23 12 433 1 cazM Iterative polyketide synthase CazM Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
P0CU67 2.44e-15 82 28 9 277 1 claG Atrochrysone carboxylic acid synthase Passalora fulva
A0A443HK66 2.76e-15 81 28 8 276 3 VdtX Highly reducing polyketide synthase VdtX Byssochlamys spectabilis
Q0C8A4 2.77e-15 81 27 8 273 1 trt4 Non-reducing polyketide synthase trt4 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
B3FWS8 2.93e-15 81 25 15 375 1 hpm3 Non-reducing polyketide synthase hmp3 Hypomyces subiculosus
A0A8D5M692 2.99e-15 81 26 6 272 1 esdpA Non-reducing polyketide synthase esdpA Penicillium shearii
G3JUI8 3.12e-15 81 26 8 290 1 milA Highly reducing polyketide synthase milA Cordyceps militaris (strain CM01)
A0A2I1C3X5 3.2e-15 81 30 12 268 1 nsrB Atrochrysone carboxylic acid synthase nsrB Aspergillus novofumigatus (strain IBT 16806)
A0A161CEU9 3.4e-15 81 25 11 360 1 citS Citrinin polyketide synthase Monascus ruber
Q65Z23 3.4e-15 81 25 11 360 1 pksCT Citrinin polyketide synthase Monascus purpureus
A0A2I1BSV9 3.43e-15 81 27 8 272 1 nvfA Non-reducing polyketide synthase nvfA Aspergillus novofumigatus (strain IBT 16806)
B8M9J9 4.23e-15 81 25 6 273 1 tropA 3-methylorcinaldehyde synthase tropA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
A0A179H2I8 4.47e-15 81 30 6 223 2 lcsB Highly reducing polyketide synthase lcsB Purpureocillium lilacinum
A0A3G1DJF3 4.73e-15 81 28 7 288 2 pks2 Squalestatin hexaketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
Q0CRQ5 4.82e-15 81 27 7 270 1 ATEG_03629 5-methylorsellinic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
K2QYX5 4.97e-15 81 26 9 289 1 mpsA Hybrid PKS-NRPS synthetase mpsA Macrophomina phaseolina (strain MS6)
B2HIL7 5.32e-15 80 26 7 290 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium marinum (strain ATCC BAA-535 / M)
F2S6Z9 5.38e-15 80 26 9 278 3 nscA Non-reducing polyketide synthase nscA Trichophyton tonsurans (strain CBS 112818)
Q5BH30 5.43e-15 80 33 9 229 3 mdpG Atrochrysone carboxylic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5SBL6 5.95e-15 80 25 9 341 3 fsdS Fusaridione A synthetase fsdS Fusarium heterosporum
E4V2N2 6.21e-15 80 26 12 316 3 nscA Non-reducing polyketide synthase nscA Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)
Q2HEW5 6.28e-15 80 26 7 292 2 cheA PKS-NRPS hybrid synthetase cheA Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
A0A411PQP9 6.62e-15 80 32 10 229 3 Agnpks1 Atrochrysone carboxylic acid synthase Agnpks1 Paecilomyces divaricatus
P9WQE1 6.66e-15 80 26 6 277 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE0 6.66e-15 80 26 6 277 3 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
I1S166 6.73e-15 80 25 10 322 2 FSL1 Fusarielin synthase FSL1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q7TXL6 6.78e-15 80 26 6 277 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P40872 7.67e-15 80 25 15 369 1 pksM Polyketide synthase PksM Bacillus subtilis (strain 168)
P40872 6.72e-14 77 25 20 437 1 pksM Polyketide synthase PksM Bacillus subtilis (strain 168)
P40872 1.85e-12 73 22 12 426 1 pksM Polyketide synthase PksM Bacillus subtilis (strain 168)
W3X8X8 8.29e-15 80 26 8 277 1 fnsA Naringenin synthase Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
F2PWS5 9.35e-15 80 26 9 278 3 nscA Non-reducing polyketide synthase nscA Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
Q4WAY3 1.06e-14 80 29 8 275 1 af370 Fumagillin dodecapentaenoate synthase af370 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q5AUX1 1.14e-14 79 28 7 276 1 orsA Orsellinic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
D4CZZ2 1.17e-14 79 26 9 278 3 nscA Non-reducing polyketide synthase nscA Trichophyton verrucosum (strain HKI 0517)
P9WET2 1.2e-14 79 27 7 259 1 Preu6 Non-reducing polyketide synthase Preu6 Preussia isomera
D4AWH3 1.31e-14 79 26 9 278 3 nscA Non-reducing polyketide synthase nscA Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
A0A3T0ZHJ0 1.42e-14 79 25 8 344 1 cle1 Triacetic acid lactone synthase cle1 Aspergillus versicolor
A0A6F9DYX9 1.5e-14 79 27 7 274 1 men2 Non-reducing polyketide synthase men2 Menisporopsis theobromae
F2T0M0 1.59e-14 79 26 9 278 3 nscA Non-reducing polyketide synthase nscA Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
M1WG96 1.63e-14 79 29 10 280 2 CPUR_05437 Non-reducing polyketide synthase CPUR_05437 Claviceps purpurea (strain 20.1)
A0A084B9Z6 1.72e-14 79 24 6 290 3 SAT8 Non-reducing polyketide synthase SAT8 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
Q02062 1.86e-14 78 22 8 403 1 SCO5088 Actinorhodin polyketide putative beta-ketoacyl synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q2T4N2 2.06e-14 79 25 5 280 3 thaH Polyketide synthase ThaH Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N2 1.74e-11 70 28 6 205 3 thaH Polyketide synthase ThaH Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A0A7L8UVC9 2.32e-14 79 25 13 374 3 ffsA Polyketide synthase-nonribosomal peptide synthetase ffsA Aspergillus flavipes
A0A0S2CHA9 2.38e-14 79 22 11 394 1 pigA Non-reducing polyketide synthase pigA Monascus ruber
A0A345BJN0 2.45e-14 79 27 7 288 1 clz14 Squalestatin hexaketide synthase clz14 Cochliobolus lunatus
P36189 2.52e-14 77 26 15 383 1 FASN Fatty acid synthase (Fragment) Anser anser anser
S0EMV0 2.54e-14 79 28 10 291 1 GPY1 Highly reducing polyketide synthase GPY1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
P9WET1 3.11e-14 78 27 15 341 1 Preu7 Non-reducing polyketide synthase Preu7 Preussia isomera
W6QL47 3.37e-14 78 24 6 295 3 mpaC Non-reducing polyketide synthase mapC Penicillium roqueforti (strain FM164)
Q5BG07 3.4e-14 78 26 8 293 1 pkdA Non-reducing polyketide synthase pkdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A1R3RGK0 3.54e-14 78 26 7 267 1 otaA Highly reducing polyketide synthase otaA Aspergillus carbonarius (strain ITEM 5010)
P0DUK1 3.76e-14 78 28 6 266 3 pspA Highly reducing polyketide synthase pspA Penicillium soppii
A0A3G1DJH7 4.2e-14 78 26 8 295 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
Q5B7U4 4.86e-14 77 24 7 288 1 pkiA Non-reducing polyketide synthase pkiA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A2I2F2N6 4.87e-14 78 25 7 280 1 cfoA Chalcone synthase cfoA Aspergillus candidus
B8MYS6 5.32e-14 77 25 18 437 1 pks27 Non-reducing polyketide synthase pks27 Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
P9WEV0 5.37e-14 77 27 7 270 3 valA Highly reducing polyketide synthase valA Aspergillus terreus
Q9ZGI2 5.53e-14 77 23 8 296 1 pikAIV Narbonolide/10-deoxymethynolide synthase PikA4, module 6 Streptomyces venezuelae
A5ABG0 6.11e-14 77 24 10 341 1 pynA Hybrid PKS-NRPS synthetase pynA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
M2YKT6 6.81e-14 77 25 11 356 2 hps1 Hybrid PKS-NRPS synthetase 1 Dothistroma septosporum (strain NZE10 / CBS 128990)
A0A4P8WAE5 7.14e-14 77 27 10 310 3 pyiS Polyketide synthase-nonribosomal peptide synthetase pyiS Pyricularia grisea
Q50LG3 8.18e-14 77 26 6 291 3 AFT9-1 Highly reducing polyketide synthase AFT9-1 Alternaria alternata
D2E9X0 8.34e-14 77 23 11 342 2 DEP5 Reducing polyketide synthase DEP5 Alternaria brassicicola
A0A8F4SKJ7 9.01e-14 77 24 13 422 1 atr1 Non-reducing polyketide synthase atr1 Stereocaulon alpinum
A0A098D6U0 9.01e-14 77 25 10 302 1 ZEA1 Non-reducing polyketide synthase ZEA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
O31784 9.86e-14 77 24 10 354 1 pksR Polyketide synthase PksR Bacillus subtilis (strain 168)
O31784 8.91e-11 67 25 9 280 1 pksR Polyketide synthase PksR Bacillus subtilis (strain 168)
M3A326 1.03e-13 77 28 10 282 2 PKS8-1 Non-reducing polyketide synthase PKS8-1 Pseudocercospora fijiensis (strain CIRAD86)
N4WHA7 1.24e-13 76 23 8 285 3 PKS2 Reducing polyketide synthase PKS2 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
F9XMW3 1.26e-13 76 25 14 392 3 PKS1 Non-reducing polyketide synthase PKS1 Zymoseptoria tritici (strain CBS 115943 / IPO323)
A0A455R5P9 1.36e-13 76 28 10 291 1 ascC Non-reducing polyketide synthase ascC Acremonium egyptiacum
Q0UK48 1.39e-13 76 27 8 276 1 sthA Highly reducing polyketide synthase sthA Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A1B3PEI6 1.46e-13 76 25 9 282 1 ORF-A Polyunsaturated fatty acid synthase subunit A Thraustochytrium sp. (strain ATCC 26185 / S-3)
P9WET8 1.76e-13 76 28 8 270 2 Preu1 Highly reducing polyketide synthase Preu1 Preussia isomera
Q5ATJ7 1.79e-13 76 25 7 273 1 ausA Non-reducing polyketide synthase ausA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
G3XMD1 1.81e-13 76 25 8 298 1 azaB Highly reducing polyketide synthase azaB Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q5B8A0 1.82e-13 76 27 11 276 1 pkfA Non-reducing polyketide synthase pkfA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B4XYB8 1.98e-13 75 28 9 293 1 aziB 5-methyl-1-naphthoate synthase Streptomyces sahachiroi
A0A1W7M1U5 2.02e-13 75 24 10 364 1 pgmA Non-reducing polyketide synthase pgmA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q05357 2.06e-13 74 24 9 410 3 sch2 Putative polyketide beta-ketoacyl synthase 2 Streptomyces halstedii
J4UHQ6 2.11e-13 75 24 11 345 1 OpS1 Orsellinic acid synthase Beauveria bassiana (strain ARSEF 2860)
A0A411L027 2.11e-13 75 25 9 309 3 buaA Hybrid PKS-NRPS synthetase buaA Petromyces alliaceus
E9F646 2.31e-13 75 27 8 284 1 Pks1 Polyketide synthase 1 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q0CS88 2.35e-13 75 30 7 246 2 tazB Highly reducing polyketide synthase tazB Aspergillus terreus (strain NIH 2624 / FGSC A1156)
G3KLH6 2.53e-13 75 25 11 316 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger
A2QX22 2.91e-13 75 25 11 316 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q5W262 3.22e-13 75 25 14 360 1 pigJ Beta-ketoacyl synthase PigJ Serratia sp. (strain ATCC 39006)
A0A0B4G9F9 3.24e-13 75 27 8 284 1 Pks1 Polyketide synthase 1 Metarhizium guizhouense (strain ARSEF 977)
A0A0U5GFS8 3.51e-13 75 26 7 276 1 ausA Non-reducing polyketide synthase ausA Aspergillus calidoustus
A0A0B4FTU6 3.81e-13 75 27 9 284 1 Pks1 Polyketide synthase 1 Metarhizium anisopliae (strain ARSEF 549)
A0A0B4ESU9 4.71e-13 74 27 9 284 1 Pks1 Polyketide synthase 1 Metarhizium brunneum (strain ARSEF 3297)
A0A2U8NEV6 4.84e-13 74 27 8 284 1 Pks1 Polyketide synthase 1 Metarhizium acridum (strain CQMa 102)
A0A1V6PAF7 4.92e-13 74 25 14 416 1 calA Highly reducing polyketide synthase calA Penicillium decumbens
Q00681 6.16e-13 74 27 6 269 2 stcJ Fatty acid synthase alpha subunit stcJ Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0B4H4F0 6.49e-13 74 27 8 284 1 Pks1 Polyketide synthase 1 Metarhizium majus (strain ARSEF 297)
P9WET9 6.67e-13 74 26 13 359 1 PvBS090_009107 Non-reducing polyketide synthase PvBS090_009107 Byssochlamys spectabilis
Q5AUX7 7.07e-13 74 25 17 435 1 dbaI Non-reducing polyketide synthase dbaI Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
E5AE40 9.12e-13 73 25 12 344 2 PKS2 Highly reducing polyketide synthase PKS2 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
G3XMC4 9.31e-13 73 24 8 291 1 azaA Non-reducing polyketide synthase azaA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A0A0B4H8J1 9.86e-13 73 27 9 280 2 Pks2 Polyketide synthase 2 Metarhizium brunneum (strain ARSEF 3297)
P9WEX0 1.21e-12 73 27 7 272 1 dpasA Non-reducing polyketide synthase dpasA Apiospora sacchari
A2R6H1 1.21e-12 73 27 8 267 2 otaA Highly reducing polyketide synthase otaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
B6H999 1.47e-12 73 24 12 365 1 xilA Highly reducing polyketide synthase xilA Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
A0A1B5L6A0 1.78e-12 73 22 9 357 1 UVI_02036160 Non-reducing polyketide synthase ustP Ustilaginoidea virens
A7UMW1 1.79e-12 73 25 14 392 2 PKS1 Non-reducing polyketide synthase 1 Elsinoe fawcettii
S0DTP6 1.82e-12 73 23 8 362 2 FSR1 Non-reducing polyketide synthase fsr1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
A2QTE9 2.22e-12 72 23 8 291 3 epaA Non-reducing polyketide synthase epaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
P9WET5 2.5e-12 72 25 10 355 1 Preu4 Non-reducing polyketide synthase Preu4 Preussia isomera
S7RK07 2.53e-12 72 24 12 369 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Gloeophyllum trabeum (strain ATCC 11539 / FP-39264 / Madison 617)
Q0V6Q6 2.61e-12 72 27 5 219 1 phmA Polyketide synthase-nonribosomal peptide synthetase phmA Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
P9WET4 2.81e-12 72 24 13 349 1 Preu5 Highly reducing polyketide synthase Preu5 Preussia isomera
A0A0B4FLB2 2.86e-12 72 27 9 280 2 Pks2 Polyketide synthase 2 Metarhizium anisopliae (strain ARSEF 549)
A0A4P8DJU2 3.18e-12 72 28 13 281 3 dmx-nrPKS Atrochrysone carboxylic acid synthase Cryptosporiopsis sp. (strain 8999)
G1XU04 3.56e-12 72 24 7 295 1 AOL_s00215g283 6-methylsalicylic acid synthase AOL_s00215g283 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)
A0A0B4I1L1 4e-12 72 26 8 280 2 Pks2 Polyketide synthase 2 Metarhizium guizhouense (strain ARSEF 977)
A0A0D1DNX1 4.11e-12 72 30 11 260 2 fas2 Fatty acid synthase 2 Ustilago maydis (strain 521 / FGSC 9021)
A0A0A2JW91 4.39e-12 72 25 7 270 1 cnsI Highly reducing polyketide synthase cnsI Penicillium expansum
P9WET3 4.49e-12 72 27 9 265 1 Preu8 Non-reducing polyketide synthase Preu8 Preussia isomera
Q0C8L6 4.85e-12 71 24 10 323 1 lovF Lovastatin diketide synthase lovF Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q6DQW3 5.47e-12 71 25 11 356 1 CTB1 Non-reducing polyketide synthase CTB1 Cercospora nicotianae
Q5AXA9 6.11e-12 71 26 6 279 1 pkgA Non-reducing polyketide synthase pkgA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A443HK81 6.45e-12 71 24 9 329 1 VdtA Non-reducing polyketide synthase VdtA Byssochlamys spectabilis
E9ET39 1.05e-11 70 26 8 280 2 Pks2 Polyketide synthase 2 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
E9EHG2 1.08e-11 70 26 8 280 2 Pks2 Polyketide synthase 2 Metarhizium acridum (strain CQMa 102)
A0A142C799 1.3e-11 70 25 12 362 1 phnA Non-reducing polyketide synthase phnA Penicillium herquei
A0A125R003 1.39e-11 70 26 5 205 1 cla3 Non-reducing polyketide synthase cla3 Cladosporium cladosporioides
A5PHD6 1.46e-11 70 25 6 274 1 aspks1 3-methylorcinaldehyde synthase Sarocladium schorii
A0A2G5IC96 1.47e-11 70 24 11 356 3 CTB1 Non-reducing polyketide synthase CTB1 Cercospora beticola
Q0UI00 1.57e-11 70 24 11 357 1 elcA Non-reducing polyketide synthase elcA (Fragment) Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A0B4I1J8 1.95e-11 69 26 8 280 2 Pks2 Polyketide synthase 2 Metarhizium majus (strain ARSEF 297)
S0EET5 2.09e-11 69 27 10 309 2 PKS19 Polyketide synthase 19 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
A0A9P5GG56 2.52e-11 69 24 12 365 1 xilA Highly reducing polyketide synthase xilA Penicillium crustosum
A0A068ABB7 2.84e-11 69 26 13 346 1 Bref-PKS Highly reducing polyketide synthase Eupenicillium brefeldianum
G3XNF4 4.12e-11 68 23 10 365 1 ATPKS PKS-NRPS hybrid synthetase ATPKS Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
W3X7U2 4.13e-11 68 25 17 400 2 PfmaE Conidial pigment polyketide synthase PfmaE Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
A0A345BJP0 4.21e-11 68 30 7 195 3 clz2 Squalestatin tetraketide synthase clz2 Cochliobolus lunatus
Q03149 5.58e-11 68 24 10 359 1 wA Conidial yellow pigment biosynthesis polyketide synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0A2KT65 7.33e-11 68 27 8 277 2 melA Conidial yellow pigment biosynthesis polyketide synthase melA Penicillium expansum
I1RLA7 8.46e-11 67 22 13 377 2 FGR1 Highly reducing polyketide synthase 2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
G0LET7 1.04e-10 67 26 11 276 2 BOA9 Reducing polyketide synthase BOA9 Botryotinia fuckeliana (strain B05.10)
P9WET0 1.14e-10 67 27 8 219 1 Preu9 Polyketide synthase-like protein Preu9 Preussia isomera
P0DUT7 1.19e-10 67 24 7 275 1 Ba17a Highly reducing polyketide synthase 17 Metarhizium anisopliae
P41176 1.48e-10 65 28 5 197 3 None Putative polyketide beta-ketoacyl synthase 2 Streptomyces virginiae
A0A084R1H6 1.63e-10 67 26 8 275 3 ATR6 Highly reducing polyketide synthase ATR6 Stachybotrys chlorohalonata (strain IBT 40285)
Q4WZA8 3.67e-10 65 25 8 277 1 alb1 Conidial pigment polyketide synthase alb1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
S0DZM7 4.05e-10 65 23 10 356 1 bik1 Bikaverin polyketide synthase bik1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
A0A2U8NET4 5.18e-10 65 24 10 349 1 Pks1 Polyketide synthase 1 Metarhizium album (strain ARSEF 1941)
A2QUI2 5.36e-10 65 27 8 278 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
V5Y0F7 7.23e-10 65 24 11 350 3 AFT16-1 Reducing polyketide synthase AFT16-1 Alternaria alternata
I1RF58 8.57e-10 64 27 6 229 1 PKS12 Non-reducing polyketide synthase PKS12 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
G3XLL5 1.19e-09 64 26 8 278 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A0A4P8GHJ1 1.25e-09 64 23 9 268 1 eupA 3-methylorcinaldehyde synthase Phoma sp.
A0A1L9UCG2 1.5e-09 63 29 6 227 3 albA Non-reducing polyketide synthase albA Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
Q5BBP8 1.77e-09 63 24 9 275 1 pkhA Non-reducing polyketide synthase pkhA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
G4N137 2.27e-09 63 25 4 196 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
P9WET7 4.07e-09 62 23 7 259 2 Preu2 Reducing polyketide synthase Preu2 Preussia isomera
Q5AZ32 1.05e-08 61 25 14 359 1 pkbA Non-reducing polyketide synthase pkbA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0F7GFS4 1.13e-08 61 23 8 313 1 tasS Hybrid PKS-NRPS synthetase tasS Hapsidospora irregularis
A0A3G9K3K9 1.14e-08 61 25 7 208 1 hisps Hispidin synthase Neonothopanus nambi
Q10289 1.84e-08 60 34 4 123 1 fas2 Fatty acid synthase subunit alpha Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A2H3CTK0 2.82e-08 59 25 7 295 1 armB Orsellinic acid synthase armB Armillaria gallica
I3ZNU9 4.36e-08 59 26 9 296 1 armB Orsellinic acid synthase armB Armillaria mellea
Q0CSA2 5.55e-08 58 26 9 207 1 tazA Non-reducing polyketide synthase tazA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A284RE13 6.29e-08 58 24 7 294 1 armB Orsellinic acid synthase ArmB Armillaria ostoyae
P19097 8.96e-07 55 35 2 108 1 FAS2 Fatty acid synthase subunit alpha Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
G8BAW7 1.22e-06 54 33 2 118 2 FAS2 Fatty acid synthase subunit alpha Candida parapsilosis (strain CDC 317 / ATCC MYA-4646)
P43098 1.59e-06 54 33 2 118 1 FAS2 Fatty acid synthase subunit alpha Candida albicans
Q2TXF0 2.27e-06 53 36 2 108 3 oryfasA Fatty acid synthase subunit alpha Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q765N2 3.86e-06 53 34 2 108 3 FAS2 Fatty acid synthase subunit alpha Lachancea kluyveri
A0A1D5AG16 5.08e-06 52 33 4 115 1 pigJ Fatty acid synthase alpha subunit pigJ Monascus ruber
Q2T4P1 6.28e-06 52 22 6 275 3 thaQ Polyketide synthase ThaQ Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
G3J9P0 7.18e-06 52 22 9 316 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Cordyceps militaris (strain CM01)
S5NIA2 1.92e-05 50 34 3 123 3 TOXH Fatty acid synthase subunit alpha Cochliobolus carbonum
S0DL59 3.51e-05 50 33 5 130 1 apf5 Fatty acid synthase apf5 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
S0DL59 6.79e-05 48 33 3 112 1 apf5 Fatty acid synthase apf5 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08800
Feature type CDS
Gene fabB
Product beta-ketoacyl-ACP synthase I
Location 1924567 - 1925778 (strand: -1)
Length 1212 (nucleotides) / 403 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1922
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00109 Beta-ketoacyl synthase, N-terminal domain
PF02801 Beta-ketoacyl synthase, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0304 Lipid transport and metabolism (I)
Secondary metabolites biosynthesis, transport and catabolism (Q)		 IQ 3-oxoacyl-(acyl-carrier-protein) synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MKRAVITGLGIVSSIGNNQQEVLDSLKEGRSGITFSEEFKEMGLRSHIWGNVKLDTEGLIDRKIRRFMSDASVYAYLSMQQAIEDSGLTEDQVSNIRSGLVVGSGGGSPRNQVQGSDGMRAKGLRGVGPYMVTRAMASGVSACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGKQDVVFAGGGEELSWEMTCEFDAMGALSTKYNDTPAKASRTYDKNRDGFVIAGGGGIVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMQGIDHVDYINTHGTSTPVGDLKELEAIAEVFGTKTPAISATKAMTGHSLGAAGVHEAIYSLLMLEHGFIAPSINIEELDDKADGMNIITKPTEQKLDTVMSNSFGFGGTNASLVMSKYKK

Flanking regions ( +/- flanking 50bp)

GTGCTATTCAGAAATCCCGCAGCTACAACTATTATTGTAAAGAGGTATAAATGAAGCGCGCAGTGATCACGGGTCTGGGTATTGTTTCGAGCATTGGTAATAACCAGCAAGAAGTGCTGGACTCTTTAAAAGAAGGCCGTTCCGGGATAACTTTCTCAGAAGAATTTAAAGAGATGGGGCTACGTAGCCACATTTGGGGTAATGTTAAGCTTGATACTGAAGGTCTTATTGACCGTAAAATCCGCCGTTTTATGAGTGATGCATCGGTTTATGCCTATTTATCTATGCAACAAGCGATTGAAGATTCAGGTCTAACAGAAGATCAAGTTTCTAACATTCGTTCTGGTTTAGTTGTCGGCTCCGGTGGTGGTTCTCCTCGTAACCAAGTACAAGGTTCGGACGGCATGAGAGCTAAAGGTCTACGCGGTGTAGGTCCTTATATGGTAACTCGTGCAATGGCGTCTGGTGTATCAGCTTGTTTAGCTACACCGTTTAAAATTAAAGGTGTTAACTATTCAATTAGTTCAGCTTGCTCAACATCAGCACACTGTATTGGTCATGCGGTTGAATTAATTCAATTAGGTAAACAAGATGTGGTTTTCGCCGGTGGTGGTGAAGAGCTAAGTTGGGAGATGACCTGTGAGTTTGATGCTATGGGGGCACTTTCAACAAAATATAATGATACACCAGCCAAAGCTTCTCGTACCTATGATAAAAACCGTGATGGTTTCGTTATCGCTGGTGGTGGCGGTATTGTGGTTGTTGAAGAATTAGAGCACGCATTAGCACGTGGTGCGCATATCTACGCTGAAATTGTCGGCTATGGTGCAACATCTGATGGTGCTGACATGGTTGCTCCATCGGGAGAAGGTGCCGTACGTTGTATGCAAATGGCAATGCAAGGTATTGATCATGTTGATTATATCAATACTCATGGTACATCGACGCCTGTGGGTGATTTAAAAGAGCTTGAAGCGATTGCTGAAGTTTTTGGAACTAAAACACCGGCTATTTCTGCAACTAAGGCAATGACAGGTCACTCATTAGGGGCTGCAGGTGTTCATGAAGCCATTTACAGTCTACTGATGTTAGAGCATGGTTTTATCGCACCAAGTATTAATATTGAAGAGCTTGATGATAAAGCGGATGGTATGAATATCATTACCAAACCAACAGAGCAAAAACTAGATACAGTGATGTCAAATAGCTTTGGTTTCGGTGGCACTAATGCTTCACTTGTGATGAGTAAGTATAAGAAATAGTTAGTTATACTTAGATTTCCTTGTATAAATGATAAAGGCAGTTGCTTATA