Homologs in group_1960

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14300 FBDBKF_14300 100.0 Morganella morganii S1 fabB beta-ketoacyl-ACP synthase I
NLDBIP_08305 NLDBIP_08305 100.0 Morganella morganii S4 fabB beta-ketoacyl-ACP synthase I
LHKJJB_05960 LHKJJB_05960 100.0 Morganella morganii S3 fabB beta-ketoacyl-ACP synthase I
HKOGLL_04955 HKOGLL_04955 100.0 Morganella morganii S5 fabB beta-ketoacyl-ACP synthase I
F4V73_RS02605 F4V73_RS02605 93.3 Morganella psychrotolerans fabB beta-ketoacyl-ACP synthase I
PMI_RS08800 PMI_RS08800 85.9 Proteus mirabilis HI4320 fabB beta-ketoacyl-ACP synthase I

Distribution of the homologs in the orthogroup group_1960

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1960

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A953 0.0 688 81 2 406 1 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Escherichia coli (strain K12)
P0A954 0.0 688 81 2 406 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P43710 0.0 586 70 2 405 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q02K94 0.0 563 67 1 404 1 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q89AY4 3.53e-179 507 59 4 406 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57193 2.57e-169 482 56 4 406 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8KA28 2.54e-160 459 58 5 407 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q83E37 3.85e-90 281 41 8 410 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
O34340 2.93e-87 273 41 6 412 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Bacillus subtilis (strain 168)
P55338 3.46e-84 266 40 9 413 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Vibrio harveyi
P56902 8.18e-82 259 39 8 422 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Rhizobium meliloti (strain 1021)
Q9KQH9 1.3e-81 259 39 9 414 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8NXE1 1.33e-77 249 38 7 411 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain MW2)
Q6GAU2 1.33e-77 249 38 7 411 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain MSSA476)
Q5HHA1 1.33e-77 249 38 7 411 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain COL)
Q7A6F8 2.79e-77 248 38 7 411 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain N315)
Q99VA6 2.79e-77 248 38 7 411 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GIA3 7.99e-77 246 38 7 410 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain MRSA252)
P0AAI8 3.69e-75 242 38 7 413 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Shigella flexneri
P0AAI5 3.69e-75 242 38 7 413 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Escherichia coli (strain K12)
P0AAI6 3.69e-75 242 38 7 413 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAI7 3.69e-75 242 38 7 413 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Escherichia coli O157:H7
P73283 5.42e-75 242 37 7 411 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5TKS0 1.49e-74 240 38 7 405 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) Staphylococcus aureus
Q8L3X9 4.79e-72 236 38 12 432 1 KAS 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Arabidopsis thaliana
O94297 3.8e-69 227 34 12 425 3 SPBC887.13c Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9D404 1.21e-68 227 35 10 417 1 Oxsm 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Mus musculus
Q9NWU1 6.46e-67 222 34 10 418 1 OXSM 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Homo sapiens
P52410 8.11e-67 222 34 7 414 1 KAS1 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic Arabidopsis thaliana
P23902 5.08e-65 218 34 7 415 1 KAS12 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic Hordeum vulgare
Q9C9P4 1.02e-64 219 35 10 415 1 KAS2 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic Arabidopsis thaliana
Q0VCA7 5.46e-61 207 34 10 417 2 OXSM 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Bos taurus
P72331 2.08e-60 204 32 6 406 3 nodE Nodulation protein E Rhizobium sp. (strain N33)
P06230 6.61e-60 202 33 9 412 3 nodE Nodulation protein E Rhizobium meliloti (strain 1021)
P06231 1.39e-55 191 33 9 411 3 nodE Nodulation protein E Rhizobium meliloti
P04684 2.94e-55 190 32 8 407 3 nodE Nodulation protein E Rhizobium leguminosarum bv. trifolii
P9WQD7 4.64e-53 185 32 8 412 1 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQD6 4.64e-53 185 32 8 412 3 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63457 4.64e-53 185 32 8 412 3 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q05356 2.37e-52 183 32 12 415 3 sch1 Putative polyketide beta-ketoacyl synthase 1 Streptomyces halstedii
P04683 5.06e-52 182 33 14 416 3 nodE Nodulation protein E Rhizobium leguminosarum bv. viciae
Q02059 3.34e-51 181 32 11 425 1 SCO5087 Actinorhodin polyketide putative beta-ketoacyl synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P39525 3.94e-51 180 29 16 451 1 CEM1 3-oxoacyl-[acyl-carrier-protein] synthase homolog Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P9WQD9 4.48e-51 179 34 9 397 1 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQD8 4.48e-51 179 34 9 397 3 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
H8ESN0 4.48e-51 179 34 9 397 2 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)
P63455 4.48e-51 179 34 9 397 3 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O69473 7.25e-50 176 30 7 410 3 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium leprae (strain TN)
Q9CBS7 1.12e-49 176 34 8 397 3 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium leprae (strain TN)
Q02578 1.85e-47 170 30 16 423 3 curA Putative polyketide beta-ketoacyl synthase 1 Streptomyces cyaneus
P41175 1.07e-46 168 31 12 427 3 None Putative polyketide beta-ketoacyl synthase 1 Streptomyces virginiae
P23155 6.24e-46 166 30 12 415 3 SCO5318 Putative polyketide beta-ketoacyl synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P16540 6.02e-45 163 32 12 423 3 gra-orf1 Granaticin polyketide putative beta-ketoacyl synthase 1 Streptomyces violaceoruber
P43678 2.22e-42 157 31 12 423 3 None Oxytetracycline polyketide putative beta-ketoacyl synthase 1 Streptomyces rimosus
P16538 5.59e-41 153 30 8 419 1 tcmK Tetracenomycin polyketide synthase ketoacyl synthase alpha subunit Streptomyces glaucescens
P40804 2.85e-35 137 29 12 403 1 pksF Polyketide biosynthesis malonyl-ACP decarboxylase PksF Bacillus subtilis (strain 168)
Q54IX3 2.14e-29 124 30 8 285 3 pks26 Probable polyketide synthase 26 Dictyostelium discoideum
Q55E72 3.62e-27 117 26 15 451 1 stlA Probable polyketide synthase 1 Dictyostelium discoideum
I6X8D2 3.5e-26 114 29 15 423 1 pks13 Polyketide synthase Pks13 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q869X2 1.84e-25 112 28 12 296 3 pks17 Probable polyketide synthase 17 Dictyostelium discoideum
Q54FQ2 2.32e-25 112 28 8 292 3 pks30 Probable polyketide synthase 30 Dictyostelium discoideum
Q54FQ3 2.72e-25 112 27 7 292 3 pks29 Probable polyketide synthase 29 Dictyostelium discoideum
Q558W4 1.28e-24 110 27 8 307 3 pks15 Probable polyketide synthase 15 Dictyostelium discoideum
Q869W9 9.64e-24 107 28 12 295 2 pks16 Probable polyketide synthase 16 Dictyostelium discoideum
B3FWU0 1.44e-23 107 29 13 345 1 rdc5 Reducing polyketide synthase rdc5 Metacordyceps chlamydosporia
Q54FN7 3.57e-23 105 26 7 295 3 pks33 Probable polyketide synthase 33 Dictyostelium discoideum
Q54FP8 3.63e-23 105 27 8 291 3 pks32 Probable polyketide synthase 32 Dictyostelium discoideum
A0A075TRC0 5.2e-23 105 25 10 342 1 patK 6-methylsalicylic acid synthase Penicillium expansum
Q54FN2 5.29e-23 105 27 7 283 3 pks34 Probable polyketide synthase 34 Dictyostelium discoideum
B0G170 6.26e-23 105 26 7 287 3 pks28 Probable polyketide synthase 28 Dictyostelium discoideum
Q54FC8 8.23e-23 104 27 7 288 3 pks39 Probable polyketide synthase 39 Dictyostelium discoideum
Q54FD2 8.39e-23 104 27 7 288 3 pks38 Probable polyketide synthase 38 Dictyostelium discoideum
C8VJR7 1.16e-22 104 30 10 294 1 alnA Highly reducing polyketide synthase alnA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54FQ1 2.52e-22 103 27 8 284 3 pks31 Probable polyketide synthase 31 Dictyostelium discoideum
A0A3G9H990 6.07e-22 102 30 9 278 1 ALT1 Highly reducing polyketide synthase ALT1 Alternaria alternata
Q54G30 6.15e-22 102 26 7 289 3 pks27 Probable polyketide synthase 27 Dictyostelium discoideum
Q54KU3 7.33e-22 102 26 8 294 3 pks25 Probable polyketide synthase 25 Dictyostelium discoideum
A0A6S5ZY48 1.39e-21 101 29 8 297 2 g433 Highly reducing polyketide synthase g433 Fusarium sp.
P16539 1.66e-21 99 26 14 414 1 tcmL Tetracenomycin polyketide synthase ketoacyl synthase beta subunit Streptomyces glaucescens
S0EEY3 1.76e-21 100 30 10 305 1 FUS1 Fusarin C synthetase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q55CN6 1.86e-21 100 25 8 277 3 pks3 Probable polyketide synthase 3 Dictyostelium discoideum
Q71SP7 1.97e-21 100 27 16 423 1 FASN Fatty acid synthase Bos taurus
W7LKX1 2.24e-21 100 31 11 300 2 FUM1 Highly reducing polyketide synthase FUM1 Gibberella moniliformis (strain M3125 / FGSC 7600)
Q559A9 2.87e-21 100 27 9 287 3 pks13 Probable polyketide synthase 13 Dictyostelium discoideum
O31782 3.45e-21 100 27 10 354 1 pksN Polyketide synthase PksN Bacillus subtilis (strain 168)
O31782 3.46e-17 87 25 16 440 1 pksN Polyketide synthase PksN Bacillus subtilis (strain 168)
O31782 5.9e-16 84 26 10 357 1 pksN Polyketide synthase PksN Bacillus subtilis (strain 168)
Q9ZGI5 3.61e-21 99 28 7 299 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 1.28e-16 85 27 8 297 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 4.33e-14 78 26 15 407 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
A0A1W5T1U1 3.85e-21 99 32 11 283 2 poxE Hybrid PKS-NRPS synthetase poxE Penicillium oxalicum
S7ZFK6 4.07e-21 99 32 11 282 2 poxE Hybrid PKS-NRPS synthetase poxE Penicillium oxalicum (strain 114-2 / CGMCC 5302)
P12276 4.48e-21 99 29 14 340 1 FASN Fatty acid synthase Gallus gallus
S7Z800 4.66e-21 99 30 9 287 3 opdA Hybrid PKS-NRPs synthetase opdA Penicillium oxalicum (strain 114-2 / CGMCC 5302)
P19096 1.1e-20 98 28 12 335 1 Fasn Fatty acid synthase Mus musculus
G3Y419 1.2e-20 98 27 9 289 1 yanA 6-methylsalicylic acid synthase Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q54B49 1.45e-20 98 27 10 295 3 pks45 Probable polyketide synthase 45 Dictyostelium discoideum
P0DO30 1.78e-20 97 28 7 293 1 iliA Hybrid PKS-NRPS synthetase iliA Neonectria sp. (strain DH2)
K3VA96 1.9e-20 97 26 8 341 3 PKS40 Highly reducing polyketide synthase 40 Fusarium pseudograminearum (strain CS3096)
P49327 2.89e-20 97 27 12 335 1 FASN Fatty acid synthase Homo sapiens
Q54KU5 3.3e-20 97 26 8 291 3 pks24 Probable polyketide synthase 24 Dictyostelium discoideum
A0A482N9V7 3.63e-20 97 27 9 350 1 iccA Hybrid PKS-NRPS synthetase iccA Talaromyces variabilis
Q54B51 3.71e-20 96 27 10 295 3 pks44 Probable polyketide synthase 44 Dictyostelium discoideum
G2Q9A5 3.87e-20 96 28 11 311 1 mycA Hybrid PKS-NRPS synthetase mycA Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)
P12785 3.9e-20 96 28 12 335 1 Fasn Fatty acid synthase Rattus norvegicus
A0A6J4B487 4.55e-20 96 29 10 308 3 LUC5 Hybrid PKS-NRPS synthetase LUC5 Fusarium sp.
A0A0U5GK88 5.04e-20 96 27 13 358 1 ausV Highly reducing polyketide synthase ausV Aspergillus calidoustus
Q7SHI6 5.13e-20 96 31 8 279 2 srdA Highly reducing polyketide synthase srdA Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q2T4N1 5.59e-20 96 28 8 297 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N1 5.62e-14 77 25 12 351 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N1 4.89e-12 72 26 11 338 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N1 2.79e-11 69 27 11 294 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B0G138 5.63e-20 96 24 8 289 3 pks21 Probable polyketide synthase 21 Dictyostelium discoideum
Q02579 7.12e-20 94 26 17 423 3 curB Putative polyketide beta-ketoacyl synthase 2 Streptomyces cyaneus
A0A1L7U4V5 7.91e-20 95 26 7 312 2 FMN1 Reducing polyketide synthase 8 Fusarium mangiferae
A0A0M4L8I7 8.15e-20 95 27 11 354 1 aurA Highly reducing polyketide synthase aurA Calcarisporium arbuscula
A0A193PS74 9.53e-20 95 31 11 289 1 stbA Non-reducing polyketide synthase stbA Stachybotrys bisbyi
K2QVI8 1.02e-19 95 28 8 283 1 dpmpA Non-reducing polyketide synthase dpmpA Macrophomina phaseolina (strain MS6)
Q558Y6 1.06e-19 95 25 8 300 3 pks14 Probable polyketide synthase 14 Dictyostelium discoideum
P22367 1.1e-19 95 24 10 341 1 None 6-methylsalicylic acid synthase Penicillium patulum
P40806 1.22e-19 95 24 13 424 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
P40806 4.84e-18 90 26 10 356 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
P40806 3.33e-14 78 27 10 281 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
Q54T36 1.31e-19 95 24 7 289 3 pks19 Probable polyketide synthase 19 Dictyostelium discoideum
S3D9F1 1.45e-19 95 27 8 295 1 gloL Highly reducing polyketide synthase gloL Glarea lozoyensis (strain ATCC 20868 / MF5171)
P23156 1.48e-19 93 27 13 415 3 SCO5317 Putative polyketide beta-ketoacyl synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
M2XHZ5 1.56e-19 94 27 12 389 2 pksA Norsolorinic acid synthase Dothistroma septosporum (strain NZE10 / CBS 128990)
Q30DW5 1.56e-19 94 27 12 389 2 pksA Norsolorinic acid synthase Dothistroma septosporum
D7PHZ2 1.67e-19 94 29 9 312 1 vrtA Non-reducing polyketide synthase vrtA Penicillium aethiopicum
I1RVD8 2.2e-19 94 28 10 342 3 PKS6 Highly reducing polyketide synthase PKS6 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
W7MLD7 2.28e-19 94 29 10 305 1 FUS1 Fusarin C synthetase Gibberella moniliformis (strain M3125 / FGSC 7600)
Q4WQZ5 2.74e-19 94 27 18 392 2 tpcC Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A8F4S6Z6 2.77e-19 94 29 11 303 1 pydA Hybrid PKS-NRPS synthetase pydA Acremonium sp.
N4WHA7 3.01e-19 94 26 11 342 3 PKS2 Reducing polyketide synthase PKS2 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
Q3S2T9 3.12e-19 94 29 11 308 1 mokA Lovastatin nonaketide synthase mokA Monascus pilosus
Q54ED7 3.2e-19 94 25 8 294 3 pks40 Probable polyketide synthase 40 Dictyostelium discoideum
A1KQG0 3.35e-19 94 30 12 339 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P9WQE9 3.38e-19 94 30 12 339 1 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE8 3.38e-19 94 30 12 339 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9F4 3.38e-19 94 30 12 339 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q7TVK8 3.38e-19 94 30 12 339 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q03131 3.69e-19 94 27 8 298 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q03131 1.39e-12 73 26 10 367 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q5BEJ4 3.83e-19 93 28 11 294 1 afoG Asperfuranone polyketide synthase afoG Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A1L9WLD9 4.2e-19 93 31 13 309 1 AacuL Atrochrysone carboxylic acid synthase AacuL Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
G4MVZ2 4.24e-19 93 26 11 357 1 ACE1 Polyketide synthase-nonribosomal peptide synthetase ACE1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q55DM7 4.65e-19 93 28 10 290 3 pks2 Probable polyketide synthase 2 Dictyostelium discoideum
Q84HC6 4.88e-19 93 24 11 369 1 ncsB Neocarzinostatin naphthoate synthase Streptomyces carzinostaticus
Q03132 5.36e-19 93 26 9 335 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
Q03132 6.74e-16 84 28 11 306 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
B6HNK3 5.58e-19 93 29 11 293 3 sorA Highly reducing polyketide synthase sorA Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
A0A167LUQ4 6.57e-19 93 27 14 393 3 fumoS Fumosorinone synthetase Cordyceps fumosorosea (strain ARSEF 2679)
E9F5E7 7.29e-19 92 28 9 285 1 subA Non-reducing polyketide synthase subA Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q54ED6 1e-18 92 21 8 353 3 pks41 Probable polyketide synthase 41 Dictyostelium discoideum
A0A481WNP4 1.33e-18 92 27 10 284 3 traA Hybrid PKS-NRPS synthetase traA Penicillium crustosum
A0A8F4S8Q3 1.47e-18 92 27 14 382 1 gkaA Hybrid PKS-NRPS synthetase gkaA Penicillium citrinum
Q2ABP6 1.5e-18 92 29 9 271 1 pksF Reducing polyketide synthase pksF Alternaria solani
P9WEX6 1.68e-18 91 28 10 285 1 dpmaA Non-reducing polyketide synthase dpmaA Metarhizium anisopliae
B6QK81 1.81e-18 91 29 11 283 3 pks12 Non-reducing polyketide synthase pks12 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN6 1.81e-18 91 29 11 283 3 pks12 Non-reducing polyketide synthase pks12 Talaromyces marneffei
Q05470 1.93e-18 91 26 14 429 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
Q05470 4.33e-17 87 24 12 438 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
Q05470 3.04e-15 81 31 14 297 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
Q05470 2.92e-12 72 24 8 301 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
G0R6S8 2.15e-18 91 26 19 427 2 sor1 Highly reducing polyketide synthase sor1 Hypocrea jecorina (strain QM6a)
B0G103 2.43e-18 91 23 11 353 3 pks10 Probable polyketide synthase 10 Dictyostelium discoideum
Q7TXM0 3.48e-18 90 28 7 275 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A017SEX7 3.75e-18 90 27 8 281 1 fogA Highly reducing polyketide synthase fogA Aspergillus ruber (strain CBS 135680)
B8N8R0 3.93e-18 90 25 8 298 2 afvB Non-reducing polyketide synthase afvB Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0A1B7YCC9 5.04e-18 90 28 7 285 1 dpchA Non-reducing polyketide synthase dpchA Colletotrichum higginsianum (strain IMI 349063)
A0JJU1 5.39e-18 90 26 8 309 1 tenS Tenellin synthetase Beauveria bassiana
Q0CZH1 5.44e-18 89 26 11 344 2 pytA Hybrid PKS-NRPS synthetase pytA (Fragment) Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q9R9J1 5.46e-18 90 28 11 360 1 mycA Mycosubtilin synthase subunit A Bacillus subtilis
D9N1A1 5.65e-18 90 27 6 294 2 ACTTS3 Highly reducing polyketide synthase ACTTS3 Alternaria alternata
Q54TW0 5.78e-18 90 24 8 288 2 pks18 Probable polyketide synthase 18 Dictyostelium discoideum
K2QYX5 5.82e-18 90 27 9 303 1 mpsA Hybrid PKS-NRPS synthetase mpsA Macrophomina phaseolina (strain MS6)
B0G100 6.31e-18 90 25 8 290 3 pks7 Probable polyketide synthase 7 Dictyostelium discoideum
A0A6F9DXA0 6.63e-18 89 25 16 421 1 men1 Partially reducing polyketide synthase men1 Menisporopsis theobromae
Q8J0F5 6.86e-18 89 26 7 292 1 mlcB Compactin diketide synthase mlcB Penicillium citrinum
A0A5C1RDA3 7.38e-18 89 27 10 338 3 orf7 Highly reducing polyketide synthase Didymella fabae
J4KMC1 8.94e-18 89 26 8 310 1 tenS Tenellin synthetase Beauveria bassiana (strain ARSEF 2860)
Q86JI5 9.66e-18 89 25 8 291 2 pks5 Probable polyketide synthase 5 Dictyostelium discoideum
P9WET2 1.01e-17 89 29 7 258 1 Preu6 Non-reducing polyketide synthase Preu6 Preussia isomera
G4N296 1.11e-17 89 30 9 281 2 PKS19 Highly reducing polyketide synthase 19 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A0A2P1DP91 1.18e-17 89 25 8 288 1 macA 6-methylsalicylic acid synthase Penicillium terrestre
B8MKY6 1.18e-17 89 30 11 278 1 tstA Highly reducing polyketide synthase tstA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
G9N4B2 1.32e-17 89 26 8 276 1 virA Highly reducing polyketide synthase virA Hypocrea virens (strain Gv29-8 / FGSC 10586)
A0A1B3PEI8 1.33e-17 89 26 8 271 1 ORF-B Polyunsaturated fatty acid synthase subunit B Thraustochytrium sp. (strain ATCC 26185 / S-3)
P9WQE6 1.36e-17 89 28 7 275 3 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q3S2U6 1.38e-17 89 26 7 294 1 mokB Lovastatin diketide synthase mokB Monascus pilosus
P9WQE7 1.4e-17 89 28 7 275 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A1V6NYI6 1.81e-17 88 27 10 305 3 verA Highly reducing polyketide synthase verA Penicillium polonicum
C5H885 1.86e-17 88 30 11 285 3 rads1 Reducing polyketide synthase rads1 Floropilus chiversii
Q02251 1.87e-17 88 28 7 283 1 mas Mycocerosic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q0D1N9 1.9e-17 88 28 9 299 1 terA Non-reducing polyketide synthase terA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A1L9WN37 1.92e-17 88 24 13 352 1 acuA 6-methylsalicylic acid synthase acuA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
E9F8M3 1.95e-17 88 26 12 338 1 swnK PKS-NRPS hybrid synthetase swnK Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
A0A1L7U3D7 1.99e-17 88 27 8 277 2 FPY1 Highly reducing polyketide synthase 40 Fusarium mangiferae
A0A4P8DJV2 2.03e-17 88 25 12 357 3 dmxL2 Highly reducing polyketide synthase dmxL2 Cryptosporiopsis sp. (strain 8999)
P9WES9 2.19e-17 88 26 7 275 1 PFUR17_0229 Non-reducing polyketide synthase PFUR17_0229 Pseudevernia furfuracea
A0A067XNI2 2.34e-17 88 29 13 310 2 ptaA Non-reducing polyketide synthase ptaA Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
A0A1L9WQM9 2.35e-17 88 28 10 306 2 acrA Highly reducing polyketide synthase acrA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A0H4ADX3 2.36e-17 88 27 10 308 2 None Non-reducing polyketide synthase PKS19 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A1CFL8 2.44e-17 88 23 11 341 1 patK 6-methylcalicylic acide synthase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q5ATG8 2.68e-17 88 26 10 310 1 apdA Hybrid PKS-NRPS synthetase apdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A2Z5TM64 2.8e-17 88 29 10 292 3 himA Polyketide synthase-nonribosomal peptide synthetase hybrid himA Aspergillus japonicus
A1D8I9 3.05e-17 87 27 10 304 3 nscA Non-reducing polyketide synthase nscA Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q9ZGI4 3.22e-17 87 27 7 282 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q9ZGI4 8.47e-17 86 27 12 342 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q4WA61 3.43e-17 87 27 11 315 3 nscA Non-reducing polyketide synthase nscA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P9WEZ4 3.48e-17 87 26 11 342 2 pytA Hybrid PKS-NRPS synthetase pytA Aspergillus terreus
Q0D159 3.61e-17 87 28 12 297 2 ATEG_00325 Hybrid PKS-NRPS synthetase ATEG_00325 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A0N7D745 3.68e-17 87 29 11 310 2 Dhc5 Non-reducing polyketide synthase Dhc5 Alternaria cinerariae
A0R1E8 3.97e-17 87 29 13 337 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q4WKW9 4.03e-17 87 28 7 271 1 fgnA Fumigermin synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q0CRQ5 4.11e-17 87 28 9 287 1 ATEG_03629 5-methylorsellinic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A455LLX1 4.13e-17 87 27 8 269 1 atnH Highly reducing polyketide synthase atnH Arthrinium sp.
P96202 4.95e-17 87 28 8 289 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7TXL8 4.95e-17 87 28 8 289 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8J0F7 5.2e-17 87 25 10 347 1 mlcA Compactin nonaketide synthase, polyketide synthase component Penicillium citrinum
B0G0Z9 5.32e-17 87 24 7 287 3 pks6 Probable polyketide synthase 6 Dictyostelium discoideum
G0REX6 5.35e-17 87 28 10 305 1 iliA Hybrid PKS-NRPS synthetase iliA Hypocrea jecorina (strain QM6a)
A0A1P8NTI3 5.45e-17 87 31 8 232 2 pks8 Non-reducing polyketide synthase 8 Pestalotiopsis microspora
G3J453 6.21e-17 87 29 7 265 1 cm3B Highly reducing polyketide synthase cm3B Cordyceps militaris (strain CM01)
A0A411KUP8 7.56e-17 86 29 9 287 1 ucsA Hybrid PKS-NRPS synthetase ucsA Acremonium sp.
Q5KTM9 7.58e-17 86 27 12 344 1 alt5 Highly reducing polyketide synthase alt5 Alternaria solani
A0A0G0AID6 7.92e-17 86 28 11 305 1 thnA Hybrid PKS-NRPS synthetase thnA Trichoderma harzianum
A0A0Y0M151 8.22e-17 86 27 11 342 1 cla2 Highly reducing polyketide synthase cla2 Cladosporium cladosporioides
Q2HBN0 8.75e-17 86 28 9 306 1 cghG Hybrid PKS-NRPS synthetase cghG Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
N4WHE3 8.75e-17 86 28 10 285 3 PKS1 Reducing polyketide synthase PKS1 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
Q0CF75 8.94e-17 86 29 13 293 1 ATEG_07659 Highly reducing polyketide synthase ATEG_07659 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A7L9EYL1 1.19e-16 86 26 15 363 1 xenE Hybrid PKS-NRPS synthetase xenE Xenoacremonium sinensis
Q86AE3 1.28e-16 85 25 9 289 2 pks9 Probable polyketide synthase 9/36 Dictyostelium discoideum
G4NEB1 1.3e-16 85 34 7 222 1 NEC1 Highly reducing polyketide synthase NEC1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
C5FM57 1.47e-16 85 28 13 316 3 nscA Non-reducing polyketide synthase nscA Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
Q5BBP5 1.71e-16 85 25 11 344 1 pkhB Highly reducing polyketide synthase pkhB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A6F8RNP4 1.76e-16 85 28 10 292 1 grgA Reducing polyketide synthase grgA Penicillium sp.
Q9ZGI3 1.87e-16 85 27 6 292 1 pikAIII Narbonolide/10-deoxymethynolide synthase PikA3, module 5 Streptomyces venezuelae
F1DBA9 2e-16 85 24 7 294 1 mpaC Non-reducing polyketide synthase mapC Penicillium brevicompactum
P96284 2e-16 84 27 9 301 1 pks15 Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q5BA83 2.04e-16 85 27 10 334 3 easB Highly reducing polyketide synthase easB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q02062 2.07e-16 84 24 9 408 1 SCO5088 Actinorhodin polyketide putative beta-ketoacyl synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P40872 2.14e-16 85 25 7 287 1 pksM Polyketide synthase PksM Bacillus subtilis (strain 168)
P40872 3.08e-13 75 24 7 284 1 pksM Polyketide synthase PksM Bacillus subtilis (strain 168)
P40872 1.56e-11 70 23 11 359 1 pksM Polyketide synthase PksM Bacillus subtilis (strain 168)
A0A0S6XH49 2.14e-16 85 26 11 343 1 frbB Highly reducing polyketide synthase frbB Fungal sp. (strain No.11243)
A0A0N0DCA3 2.24e-16 85 25 11 343 2 DEP5 Reducing polyketide synthase DEP5 Fusarium langsethiae
P9WQE3 2.53e-16 85 28 12 343 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit D Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE2 2.53e-16 85 28 12 343 3 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
I1RL11 2.53e-16 85 29 11 287 1 dpfgA Non-reducing polyketide synthase dpfgA Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q7TXL7 2.6e-16 85 28 12 343 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q4W944 2.61e-16 85 28 10 305 1 encA Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B3FWT6 2.75e-16 84 29 11 295 1 rdc1 Non-reducing polyketide synthase rdc1 Metacordyceps chlamydosporia
A0A0E4AZP0 3.05e-16 84 26 9 305 3 fsa1 Hybrid PKS-NRPS synthetase fsa1 Fusarium sp. (strain FN080326)
Q0C8M3 3.09e-16 84 26 8 309 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A1B4XBH3 3.18e-16 84 27 7 271 3 sdnO Highly reducing polyketide synthase sdnO Sordaria araneosa
Q9Y8A5 3.54e-16 84 26 7 307 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus
A0A0A0RM07 3.7e-16 84 23 12 342 1 MLNS Mellein synthase Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A097ZPE0 4.02e-16 84 26 8 289 1 andM Non-reducing polyketide synthase andM Emericella variicolor
A0A6H0YV38 4.13e-16 84 26 7 275 2 crz7 Non-reducing polyketide synthase crz7 Cladonia metacorallifera
W6QDA2 4.13e-16 84 33 7 204 1 anuA Highly reducing polyketide synthase anuA Penicillium roqueforti (strain FM164)
Q12053 4.17e-16 84 27 13 389 1 aflC Norsolorinic acid synthase Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
P9WEQ0 4.17e-16 84 28 13 362 3 olcA Non-reducing polyketide synthase olcA Penicillium canescens
A0A0B5KU17 4.3e-16 84 24 7 294 1 mpaC' Non-reducing polyketide synthase mapC' Penicillium brevicompactum
S4W172 4.45e-16 84 26 9 305 1 eqxS Equisetin synthetase eqxS Fusarium heterosporum
I6XD69 4.51e-16 84 27 8 283 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I6XD69 5.46e-15 80 27 10 305 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
W7MT31 4.9e-16 84 28 8 303 1 FUB1 Reducing polyketide synthase FUB1 Gibberella moniliformis (strain M3125 / FGSC 7600)
Q4WLD4 5.09e-16 84 27 11 315 1 pyr2 Non-reducing polyketide synthase pyr2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q2HEW5 5.2e-16 84 25 10 367 2 cheA PKS-NRPS hybrid synthetase cheA Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
A0A0N9HNS9 5.42e-16 84 27 9 298 3 desS Desertorin synthase Aspergillus desertorum
G0R6S9 5.77e-16 84 23 7 285 2 sor2 Non-reducing polyketide synthase sor2 Hypocrea jecorina (strain QM6a)
Q2UB00 5.87e-16 84 26 9 310 3 ppsB Reducing polyketide synthase ppsB Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A0A179H0J7 5.89e-16 84 27 6 285 2 lcsC Highly reducing polyketide synthase lcsC Purpureocillium lilacinum
B6HN77 6.04e-16 84 26 7 285 3 sorB Non-reducing polyketide synthase sorB Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
A0A0R8YWJ7 6.18e-16 84 29 10 285 1 mpas Methylphloroacetophenone synthase Cladonia uncialis
A0A8D5M692 6.28e-16 84 27 8 282 1 esdpA Non-reducing polyketide synthase esdpA Penicillium shearii
B0G101 6.57e-16 84 24 8 293 3 pks8 Probable polyketide synthase 8/35 Dictyostelium discoideum
A0A7R7ZK98 6.58e-16 83 28 11 306 3 AcPKS Atrochrysone carboxylic acid synthase Aspergillus chevalieri
E9KMQ2 7.01e-16 83 26 7 275 2 PKS16 Non-reducing polyketide synthase PKS16 Cladonia grayi
A0A3T0QHT6 7.12e-16 83 27 9 302 1 pvhA Hybrid PKS-NRPS synthetase pvhA Talaromyces variabilis
G3KLH6 7.68e-16 83 27 13 342 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger
D4AU31 7.74e-16 83 26 12 337 3 swnK PKS-NRPS hybrid synthetase swnK Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
A0A0C6E0I7 7.77e-16 83 24 10 349 1 bet1 Highly reducing polyketide synthase bet1 Neocamarosporium betae
A0A1B3PEI6 8.03e-16 83 24 15 392 1 ORF-A Polyunsaturated fatty acid synthase subunit A Thraustochytrium sp. (strain ATCC 26185 / S-3)
A0A3T0ZHJ0 8.65e-16 83 28 7 285 1 cle1 Triacetic acid lactone synthase cle1 Aspergillus versicolor
E4V2N2 8.79e-16 83 26 11 315 3 nscA Non-reducing polyketide synthase nscA Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)
A0A2L0P0K3 9.41e-16 83 26 9 308 1 TwmB Polyketide synthase-nonribosomal peptide synthetase TwmB Talaromyces wortmannii
G3JUI8 9.73e-16 83 27 9 290 1 milA Highly reducing polyketide synthase milA Cordyceps militaris (strain CM01)
A1CLY8 1.01e-15 83 27 8 302 3 ccsA Polyketide synthase-nonribosomal peptide synthetase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
F2S6Z9 1.08e-15 83 26 8 278 3 nscA Non-reducing polyketide synthase nscA Trichophyton tonsurans (strain CBS 112818)
Q5BH30 1.09e-15 83 29 14 307 3 mdpG Atrochrysone carboxylic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
D7PI15 1.13e-15 82 27 10 305 1 gsfA Non-reducing polyketide synthase gsfA Penicillium aethiopicum
Q7TXK8 1.17e-15 82 28 8 268 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
S0DS59 1.17e-15 83 27 10 292 2 PKS-NRPS1 Trichosetin synthetase PKS-NRPS1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q0CCY3 1.22e-15 82 28 11 284 1 gedC Atrochrysone carboxylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A348HAX6 1.31e-15 82 29 11 273 1 phiA Highly reducing polyketide synthase phiA Fungal sp. (strain ATCC 74256)
A2QK66 1.36e-15 82 25 9 312 3 ktnS Kotanin synthase Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
B8NJG3 1.42e-15 82 27 8 287 3 lepA Hybrid PKS-NRPS synthetase lepA Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
P36189 1.47e-15 80 27 16 371 1 FASN Fatty acid synthase (Fragment) Anser anser anser
D7UQ44 1.56e-15 82 27 9 271 1 sol1 Prosolanapyrone synthase Alternaria solani
Q4WAZ9 1.61e-15 82 25 9 319 2 NRPS14 PKS-NRPS hybrid synthetase psoA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q0CF73 1.63e-15 82 23 6 281 1 ATEG_07661 Non-reducing polyketide synthase ATEG_07661 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A5C1RD96 1.64e-15 82 27 8 268 3 pksAC Non-reducing polyketide synthase AC Didymella fabae
Q0CJ59 1.66e-15 82 23 11 349 1 atX 6-methylsalicylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A0F7U103 1.81e-15 82 26 8 277 3 ausA Non-reducing polyketide synthase ausA Penicillium brasilianum
B2HIL7 1.85e-15 82 27 9 296 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium marinum (strain ATCC BAA-535 / M)
P0CU67 1.92e-15 82 27 11 315 1 claG Atrochrysone carboxylic acid synthase Passalora fulva
L7X8J4 1.97e-15 82 26 10 342 1 curS1 Highly reducing polyketide synthase curS1 Aspergillus terreus
A0A8F4SKJ7 2.11e-15 82 26 8 287 1 atr1 Non-reducing polyketide synthase atr1 Stereocaulon alpinum
A0A1W5T1T1 2.23e-15 82 26 13 345 2 poxF Highly reducing polyketide synthase poxF Penicillium oxalicum
A0A084B9Z6 2.3e-15 82 25 8 276 3 SAT8 Non-reducing polyketide synthase SAT8 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
F2PWS5 2.36e-15 82 26 8 278 3 nscA Non-reducing polyketide synthase nscA Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
Q5B0D0 2.42e-15 82 28 9 281 1 aptA Non-reducing polyketide synthase aptA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
D4CZZ2 2.43e-15 82 26 11 315 3 nscA Non-reducing polyketide synthase nscA Trichophyton verrucosum (strain HKI 0517)
A0A3G9GQ29 2.49e-15 82 27 9 336 1 cdmE 6-hydroxymellein synthase cdmE Talaromyces verruculosus
A2QX22 2.63e-15 82 26 13 342 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
D4AWH3 2.9e-15 81 26 8 278 3 nscA Non-reducing polyketide synthase nscA Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
F2T0M0 3.01e-15 81 26 11 315 3 nscA Non-reducing polyketide synthase nscA Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
Q2T4N2 3.26e-15 81 26 8 302 3 thaH Polyketide synthase ThaH Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N2 6.73e-09 62 27 6 216 3 thaH Polyketide synthase ThaH Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B8MV59 3.42e-15 81 23 15 430 3 tpeA Partially reducing polyketide synthase tpeA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q0C9L7 3.54e-15 81 27 9 286 1 ctvA Highly reducing polyketide synthase ctvA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q12397 3.75e-15 81 26 14 389 2 stcA Norsolorinic acid synthase stcA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
I1S166 3.87e-15 81 26 11 320 2 FSL1 Fusarielin synthase FSL1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q03133 3.87e-15 81 24 7 278 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
Q03133 7.66e-07 55 26 9 293 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
P0CU84 4.35e-15 81 26 7 272 1 apmlA Highly reducing polyketide synthase apmlA Arthrinium phaeospermum
B8NYX0 4.57e-15 80 24 8 298 2 fluP Cluster 41 polyketide synthase Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0A0D2YG10 4.79e-15 81 29 11 304 1 FUB1 Reducing polyketide synthase FUB1 Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936)
B1GVX7 4.97e-15 80 27 8 304 2 BOA6 Reducing polyketide synthase BOA6 Botryotinia fuckeliana (strain B05.10)
A0A7L8UVC9 5.03e-15 81 28 10 296 3 ffsA Polyketide synthase-nonribosomal peptide synthetase ffsA Aspergillus flavipes
Q0UK48 5.29e-15 80 25 11 344 1 sthA Highly reducing polyketide synthase sthA Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A2Z5XAL7 5.54e-15 80 27 12 304 1 phm1 Hybrid PKS-NRPS synthetase phm1 Pyrenochaetopsis sp.
A0A1E1FFN8 5.8e-15 80 26 8 277 3 prhL Non-reducing polyketide synthase prhL Penicillium brasilianum
L7XAV2 5.92e-15 80 28 10 307 1 curS2 Non-reducing polyketide synthase curS2 Aspergillus terreus
A0A089QRB9 5.98e-15 80 25 12 370 1 msl3 Mycolipanoate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A1U8QN18 8.09e-15 80 26 10 334 1 sdgA Highly reducing polyketide synthase sdgA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54D44 8.36e-15 80 23 7 281 3 pks42 Probable polyketide synthase 42 Dictyostelium discoideum
Q05357 9.01e-15 79 26 12 415 3 sch2 Putative polyketide beta-ketoacyl synthase 2 Streptomyces halstedii
A0A161CEU9 9.28e-15 80 26 8 287 1 citS Citrinin polyketide synthase Monascus ruber
Q65Z23 9.28e-15 80 26 8 287 1 pksCT Citrinin polyketide synthase Monascus purpureus
Q07017 1.06e-14 80 26 7 278 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
Q07017 3.37e-14 78 26 10 321 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
W3X8X8 1.07e-14 80 25 8 277 1 fnsA Naringenin synthase Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
E9F646 1.08e-14 80 25 8 339 1 Pks1 Polyketide synthase 1 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
A0A084API3 1.1e-14 80 27 8 272 3 SAT13 Highly reducing polyketide synthase SAT13 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
A0A2U8NEV6 1.19e-14 79 25 8 339 1 Pks1 Polyketide synthase 1 Metarhizium acridum (strain CQMa 102)
B6F209 1.23e-14 79 24 10 349 1 cpaA Cyclo-acetoacetyl-L-tryptophan synthase Aspergillus oryzae
Q54FI3 1.31e-14 79 23 9 338 1 StlB Polyketide synthase 37 Dictyostelium discoideum
A0A0B4FTU6 1.39e-14 79 25 8 339 1 Pks1 Polyketide synthase 1 Metarhizium anisopliae (strain ARSEF 549)
A0A455M2Y3 1.46e-14 79 28 9 275 2 ntnH Highly reducing polyketide synthase ntnH Nectria sp.
A0A2I1BSV9 1.62e-14 79 24 15 413 1 nvfA Non-reducing polyketide synthase nvfA Aspergillus novofumigatus (strain IBT 16806)
A0A0B4ESU9 1.77e-14 79 25 8 339 1 Pks1 Polyketide synthase 1 Metarhizium brunneum (strain ARSEF 3297)
Q5W262 1.94e-14 79 27 10 280 1 pigJ Beta-ketoacyl synthase PigJ Serratia sp. (strain ATCC 39006)
A0A411PQP9 1.94e-14 79 28 15 321 3 Agnpks1 Atrochrysone carboxylic acid synthase Agnpks1 Paecilomyces divaricatus
Q5SBL6 2.05e-14 79 27 10 285 3 fsdS Fusaridione A synthetase fsdS Fusarium heterosporum
W6QL47 2.22e-14 79 25 7 286 3 mpaC Non-reducing polyketide synthase mapC Penicillium roqueforti (strain FM164)
A0A3G1DJF3 2.5e-14 79 27 8 276 2 pks2 Squalestatin hexaketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
A0A2I1C3X5 2.53e-14 79 29 7 231 1 nsrB Atrochrysone carboxylic acid synthase nsrB Aspergillus novofumigatus (strain IBT 16806)
S0DRI1 2.92e-14 78 28 9 303 1 FUB1 Reducing polyketide synthase FUB1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
A0A455R5P9 2.92e-14 78 31 12 287 1 ascC Non-reducing polyketide synthase ascC Acremonium egyptiacum
Q86ZD9 2.94e-14 78 27 14 298 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain C2932)
M3A326 3.13e-14 78 26 14 376 2 PKS8-1 Non-reducing polyketide synthase PKS8-1 Pseudocercospora fijiensis (strain CIRAD86)
A0A481WQB6 3.16e-14 78 24 9 385 1 claF Clavatol synthase claF Penicillium crustosum
B3FWT3 3.32e-14 78 27 10 344 1 hpm8 Reducing polyketide synthase hmp8 Hypomyces subiculosus
A0A1Y0BRF1 3.41e-14 78 24 16 436 3 adrD Non-reducing polyketide synthase adrD Penicillium roqueforti
A0A0B4G9F9 3.53e-14 78 25 8 339 1 Pks1 Polyketide synthase 1 Metarhizium guizhouense (strain ARSEF 977)
A0A0B4H4F0 3.56e-14 78 25 8 339 1 Pks1 Polyketide synthase 1 Metarhizium majus (strain ARSEF 297)
A0A4P8WAE5 3.59e-14 78 26 10 317 3 pyiS Polyketide synthase-nonribosomal peptide synthetase pyiS Pyricularia grisea
O53901 3.65e-14 78 28 6 245 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B6QK76 4.16e-14 78 22 12 396 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN5 4.16e-14 78 22 12 396 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei
A0A0N7D4P6 4.35e-14 78 26 12 343 2 Dhc3 Highly reducing polyketide synthase Dhc3 Alternaria cinerariae
Q5BG07 4.57e-14 78 27 8 273 1 pkdA Non-reducing polyketide synthase pkdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q9Y7D5 4.83e-14 78 27 12 346 1 lovF Lovastatin diketide synthase lovF Aspergillus terreus
P9WET1 5e-14 77 27 11 282 1 Preu7 Non-reducing polyketide synthase Preu7 Preussia isomera
A0A443HK81 5.03e-14 77 25 10 355 1 VdtA Non-reducing polyketide synthase VdtA Byssochlamys spectabilis
A0A2I2F262 5.09e-14 77 28 8 275 1 acdB PKS-NRPS hybrid synthetase acdB Aspergillus candidus
M1WG96 5.82e-14 77 27 8 280 2 CPUR_05437 Non-reducing polyketide synthase CPUR_05437 Claviceps purpurea (strain 20.1)
A0A1W7M1U5 5.97e-14 77 24 12 375 1 pgmA Non-reducing polyketide synthase pgmA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
G3XMD1 5.99e-14 77 25 8 291 1 azaB Highly reducing polyketide synthase azaB Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
J4UHQ6 7.7e-14 77 25 6 281 1 OpS1 Orsellinic acid synthase Beauveria bassiana (strain ARSEF 2860)
P9WET8 8.5e-14 77 28 9 273 2 Preu1 Highly reducing polyketide synthase Preu1 Preussia isomera
P9WEV0 9.27e-14 77 28 10 274 3 valA Highly reducing polyketide synthase valA Aspergillus terreus
B4XYB8 1e-13 77 29 9 282 1 aziB 5-methyl-1-naphthoate synthase Streptomyces sahachiroi
M2YKT6 1.15e-13 77 27 15 356 2 hps1 Hybrid PKS-NRPS synthetase 1 Dothistroma septosporum (strain NZE10 / CBS 128990)
A0A1R3RGK0 1.22e-13 76 27 7 267 1 otaA Highly reducing polyketide synthase otaA Aspergillus carbonarius (strain ITEM 5010)
D2E9X0 1.22e-13 76 24 10 342 2 DEP5 Reducing polyketide synthase DEP5 Alternaria brassicicola
A0A098D8A0 1.28e-13 76 28 8 275 2 ZEA2 Highly reducing polyketide synthase ZEA2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q5B7U4 1.32e-13 76 23 6 280 1 pkiA Non-reducing polyketide synthase pkiA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A443HK66 1.46e-13 76 28 9 285 3 VdtX Highly reducing polyketide synthase VdtX Byssochlamys spectabilis
C5H882 1.51e-13 76 27 9 295 3 radS2 Non-reducing polyketide synthase rads2 Floropilus chiversii
A0A089FSA4 1.55e-13 76 25 10 321 3 prlS Hybrid PKS-NRPS synthetase prlS Fungal sp. (strain NRRL 50135)
A0A2I2F2N6 1.7e-13 76 24 7 279 1 cfoA Chalcone synthase cfoA Aspergillus candidus
S0DTP6 1.82e-13 76 23 8 371 2 FSR1 Non-reducing polyketide synthase fsr1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
S7RK07 1.9e-13 75 25 8 282 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Gloeophyllum trabeum (strain ATCC 11539 / FP-39264 / Madison 617)
A0A455M7S4 1.92e-13 76 26 6 244 1 atnG Non-reducing polyketide synthase atnG Arthrinium sp.
A0A345BJN0 2e-13 76 27 9 276 1 clz14 Squalestatin hexaketide synthase clz14 Cochliobolus lunatus
Q5AXA9 2.27e-13 75 26 8 292 1 pkgA Non-reducing polyketide synthase pkgA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54QD3 2.87e-13 75 26 11 299 3 pks22 Probable polyketide synthase 22 Dictyostelium discoideum
Q50LG3 3.03e-13 75 27 10 290 3 AFT9-1 Highly reducing polyketide synthase AFT9-1 Alternaria alternata
P9WET9 3.16e-13 75 26 14 359 1 PvBS090_009107 Non-reducing polyketide synthase PvBS090_009107 Byssochlamys spectabilis
Q7TXL6 3.3e-13 75 25 8 273 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQE1 3.36e-13 75 25 8 273 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE0 3.36e-13 75 25 8 273 3 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q54QD1 3.49e-13 75 26 11 289 3 pks23 Probable polyketide synthase 23 Dictyostelium discoideum
A0A0B4H8J1 3.52e-13 75 24 13 403 2 Pks2 Polyketide synthase 2 Metarhizium brunneum (strain ARSEF 3297)
P9WET5 3.58e-13 75 26 13 356 1 Preu4 Non-reducing polyketide synthase Preu4 Preussia isomera
Q0V6Q6 3.61e-13 75 28 6 219 1 phmA Polyketide synthase-nonribosomal peptide synthetase phmA Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q9HU15 3.86e-13 74 29 10 275 1 fabY Beta-ketoacyl-[acyl-carrier-protein] synthase FabY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8MV60 3.89e-13 75 25 12 310 3 tpeB Non-reducing polyketide synthase tpeB Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
P0DUK1 4.06e-13 75 27 12 347 3 pspA Highly reducing polyketide synthase pspA Penicillium soppii
B3FWS8 4.17e-13 75 26 10 290 1 hpm3 Non-reducing polyketide synthase hmp3 Hypomyces subiculosus
A0A455LXK0 4.58e-13 75 26 12 303 2 ntnG Non-reducing polyketide synthase ntnG Nectria sp.
A0A0B4I1L1 4.63e-13 75 24 13 405 2 Pks2 Polyketide synthase 2 Metarhizium guizhouense (strain ARSEF 977)
A0A0U5GFS8 4.97e-13 74 26 7 273 1 ausA Non-reducing polyketide synthase ausA Aspergillus calidoustus
P9WET6 5.4e-13 74 26 7 270 1 Preu3 Non-reducing polyketide synthase Preu3 Preussia isomera
Q0C8A4 5.47e-13 74 26 8 273 1 trt4 Non-reducing polyketide synthase trt4 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A0U4ZX08 5.75e-13 74 27 9 272 1 drtA Low-reducing polyketide synthase drtA Aspergillus calidoustus
A0A0S2CHA9 6.1e-13 74 24 7 282 1 pigA Non-reducing polyketide synthase pigA Monascus ruber
A0A098D6U0 6.28e-13 74 26 12 315 1 ZEA1 Non-reducing polyketide synthase ZEA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A0A2KT65 6.43e-13 74 24 14 423 2 melA Conidial yellow pigment biosynthesis polyketide synthase melA Penicillium expansum
P9WEX0 6.85e-13 74 26 7 270 1 dpasA Non-reducing polyketide synthase dpasA Apiospora sacchari
P9WET4 7.24e-13 74 25 14 347 1 Preu5 Highly reducing polyketide synthase Preu5 Preussia isomera
O31784 7.5e-13 74 22 15 436 1 pksR Polyketide synthase PksR Bacillus subtilis (strain 168)
O31784 1.03e-10 67 25 10 280 1 pksR Polyketide synthase PksR Bacillus subtilis (strain 168)
B8M9J9 7.61e-13 74 25 6 268 1 tropA 3-methylorcinaldehyde synthase tropA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
A0A0B4FLB2 8.33e-13 73 24 14 408 2 Pks2 Polyketide synthase 2 Metarhizium anisopliae (strain ARSEF 549)
E9ET39 8.86e-13 73 24 14 408 2 Pks2 Polyketide synthase 2 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
A0A179H2I8 9.69e-13 73 29 5 217 2 lcsB Highly reducing polyketide synthase lcsB Purpureocillium lilacinum
A0A481WR96 9.7e-13 73 26 11 294 3 claI Highly reducing polyketide synthase claI Penicillium crustosum
A0A0B4I1J8 1.08e-12 73 24 13 405 2 Pks2 Polyketide synthase 2 Metarhizium majus (strain ARSEF 297)
F9XMW3 1.18e-12 73 28 5 227 3 PKS1 Non-reducing polyketide synthase PKS1 Zymoseptoria tritici (strain CBS 115943 / IPO323)
A0A1B5L6A0 1.44e-12 73 24 10 300 1 UVI_02036160 Non-reducing polyketide synthase ustP Ustilaginoidea virens
A0A3G1DJH7 1.52e-12 73 27 12 298 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
B6HV32 1.52e-12 73 25 7 278 1 adrD Non-reducing polyketide synthase adrD Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
S0EMV0 1.67e-12 73 27 8 271 1 GPY1 Highly reducing polyketide synthase GPY1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
S0DZM7 1.68e-12 73 22 12 404 1 bik1 Bikaverin polyketide synthase bik1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q4WZA8 1.69e-12 73 24 10 367 1 alb1 Conidial pigment polyketide synthase alb1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A4P8GHJ1 1.88e-12 73 24 7 267 1 eupA 3-methylorcinaldehyde synthase Phoma sp.
Q5ATJ7 2.06e-12 72 26 8 274 1 ausA Non-reducing polyketide synthase ausA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A2R6H1 2.4e-12 72 27 8 291 2 otaA Highly reducing polyketide synthase otaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A0A2V5GX43 2.81e-12 72 26 14 353 3 pyvA Hybrid PKS-NRPS synthetase pyvA Aspergillus violaceofuscus (strain CBS 115571)
Q5BEJ6 3e-12 72 22 6 281 1 afoE Iterative polyketide synthase afoE Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A6F9DYX9 3.05e-12 72 25 5 244 1 men2 Non-reducing polyketide synthase men2 Menisporopsis theobromae
Q03149 3.21e-12 72 25 8 300 1 wA Conidial yellow pigment biosynthesis polyketide synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
E5A7D9 3.22e-12 72 24 13 351 2 pks5 Highly reducing polyketide synthase pks5 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
A0A0D1DNX1 3.24e-12 72 31 12 260 2 fas2 Fatty acid synthase 2 Ustilago maydis (strain 521 / FGSC 9021)
A0A142C799 3.24e-12 72 25 9 305 1 phnA Non-reducing polyketide synthase phnA Penicillium herquei
S0EET5 3.53e-12 72 25 11 371 2 PKS19 Polyketide synthase 19 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
P9WET3 3.54e-12 72 26 8 278 1 Preu8 Non-reducing polyketide synthase Preu8 Preussia isomera
A0A1V6PAF7 3.85e-12 72 25 9 290 1 calA Highly reducing polyketide synthase calA Penicillium decumbens
A0A4P8DJU2 6.17e-12 71 28 13 283 3 dmx-nrPKS Atrochrysone carboxylic acid synthase Cryptosporiopsis sp. (strain 8999)
R4WH05 6.29e-12 71 25 12 374 3 ACRTS2 Highly reducing polyketide synthase ACRTS2 Alternaria alternata
A0A411L027 6.72e-12 71 25 11 309 3 buaA Hybrid PKS-NRPS synthetase buaA Petromyces alliaceus
Q5AUX7 7.95e-12 71 28 8 271 1 dbaI Non-reducing polyketide synthase dbaI Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q4WAY3 9.09e-12 70 26 8 275 1 af370 Fumagillin dodecapentaenoate synthase af370 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q00681 9.14e-12 70 29 11 271 2 stcJ Fatty acid synthase alpha subunit stcJ Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P9WQE5 9.88e-12 70 27 7 268 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE4 9.88e-12 70 27 7 268 3 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TXL9 9.96e-12 70 27 7 268 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A5PHD6 1e-11 70 25 5 282 1 aspks1 3-methylorcinaldehyde synthase Sarocladium schorii
B8MYS6 1.03e-11 70 23 14 435 1 pks27 Non-reducing polyketide synthase pks27 Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0A0A2JW91 1.07e-11 70 25 9 290 1 cnsI Highly reducing polyketide synthase cnsI Penicillium expansum
E5AE40 1.34e-11 70 25 13 343 2 PKS2 Highly reducing polyketide synthase PKS2 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
Q9ZGI2 1.41e-11 70 25 9 296 1 pikAIV Narbonolide/10-deoxymethynolide synthase PikA4, module 6 Streptomyces venezuelae
V5Y0F7 1.8e-11 70 25 9 311 3 AFT16-1 Reducing polyketide synthase AFT16-1 Alternaria alternata
Q5B8A0 2.13e-11 69 27 12 272 1 pkfA Non-reducing polyketide synthase pkfA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A125R003 2.16e-11 69 28 7 205 1 cla3 Non-reducing polyketide synthase cla3 Cladosporium cladosporioides
W3X7U2 2.23e-11 69 25 9 282 2 PfmaE Conidial pigment polyketide synthase PfmaE Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q0CS88 2.32e-11 69 28 8 256 2 tazB Highly reducing polyketide synthase tazB Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q0C8L6 2.47e-11 69 27 13 333 1 lovF Lovastatin diketide synthase lovF Aspergillus terreus (strain NIH 2624 / FGSC A1156)
E9EHG2 2.53e-11 69 27 10 285 2 Pks2 Polyketide synthase 2 Metarhizium acridum (strain CQMa 102)
Q5AUX1 2.94e-11 69 28 8 253 1 orsA Orsellinic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A5ABG0 4.17e-11 68 25 11 342 1 pynA Hybrid PKS-NRPS synthetase pynA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
G3XMC4 4.94e-11 68 24 7 280 1 azaA Non-reducing polyketide synthase azaA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
I1RF58 5.64e-11 68 26 6 252 1 PKS12 Non-reducing polyketide synthase PKS12 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A0K0MCJ4 5.98e-11 68 23 8 285 1 cazM Iterative polyketide synthase CazM Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
A7UMW1 6.37e-11 68 27 5 227 2 PKS1 Non-reducing polyketide synthase 1 Elsinoe fawcettii
P9WET7 8.82e-11 67 26 7 226 2 Preu2 Reducing polyketide synthase Preu2 Preussia isomera
G3XNF4 1.09e-10 67 25 12 371 1 ATPKS PKS-NRPS hybrid synthetase ATPKS Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A0A067MTM1 1.11e-10 67 24 8 290 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Botryobasidium botryosum (strain FD-172 SS1)
P9WET0 1.12e-10 67 28 8 226 1 Preu9 Polyketide synthase-like protein Preu9 Preussia isomera
P0DUT7 1.16e-10 67 23 8 282 1 Ba17a Highly reducing polyketide synthase 17 Metarhizium anisopliae
A2QTE9 1.17e-10 67 23 7 280 3 epaA Non-reducing polyketide synthase epaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
P41176 1.36e-10 66 29 6 206 3 None Putative polyketide beta-ketoacyl synthase 2 Streptomyces virginiae
A0A2H3CTK0 1.41e-10 67 26 8 291 1 armB Orsellinic acid synthase armB Armillaria gallica
I1RLA7 1.52e-10 67 22 12 380 2 FGR1 Highly reducing polyketide synthase 2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q0UI00 1.66e-10 67 24 12 361 1 elcA Non-reducing polyketide synthase elcA (Fragment) Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
G0LET7 2.1e-10 66 26 10 281 2 BOA9 Reducing polyketide synthase BOA9 Botryotinia fuckeliana (strain B05.10)
Q5BBP8 3.65e-10 65 22 8 274 1 pkhA Non-reducing polyketide synthase pkhA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5AZ32 4.15e-10 65 29 8 216 1 pkbA Non-reducing polyketide synthase pkbA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q6DQW3 4.42e-10 65 23 12 359 1 CTB1 Non-reducing polyketide synthase CTB1 Cercospora nicotianae
A0A9P5GG56 4.85e-10 65 24 13 361 1 xilA Highly reducing polyketide synthase xilA Penicillium crustosum
A0A284RE13 5.71e-10 65 25 8 290 1 armB Orsellinic acid synthase ArmB Armillaria ostoyae
A0A2G5IC96 5.91e-10 65 23 11 359 3 CTB1 Non-reducing polyketide synthase CTB1 Cercospora beticola
A2QUI2 8.75e-10 64 25 8 301 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
G3XLL5 8.89e-10 64 25 8 301 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
B6H999 9.12e-10 64 24 13 360 1 xilA Highly reducing polyketide synthase xilA Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
A0A1L9UCG2 2.46e-09 63 25 8 301 3 albA Non-reducing polyketide synthase albA Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
A0A2U8NET4 3.09e-09 62 24 10 348 1 Pks1 Polyketide synthase 1 Metarhizium album (strain ARSEF 1941)
G1XU04 8.85e-09 61 22 9 284 1 AOL_s00215g283 6-methylsalicylic acid synthase AOL_s00215g283 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)
A0A0F7GFS4 9.48e-09 61 24 11 338 1 tasS Hybrid PKS-NRPS synthetase tasS Hapsidospora irregularis
I3ZNU9 1.37e-08 60 25 8 291 1 armB Orsellinic acid synthase armB Armillaria mellea
Q10289 1.52e-08 60 34 4 123 1 fas2 Fatty acid synthase subunit alpha Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A345BJP0 1.64e-08 60 31 9 180 3 clz2 Squalestatin tetraketide synthase clz2 Cochliobolus lunatus
A0A3G9K3K9 1.64e-07 57 24 7 209 1 hisps Hispidin synthase Neonothopanus nambi
G4N137 2.98e-07 56 25 4 196 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
S5NIA2 3.4e-07 56 34 3 123 3 TOXH Fatty acid synthase subunit alpha Cochliobolus carbonum
A0A1D5AG16 4.07e-07 56 35 4 113 1 pigJ Fatty acid synthase alpha subunit pigJ Monascus ruber
A0A068ABB7 4.6e-07 55 25 10 289 1 Bref-PKS Highly reducing polyketide synthase Eupenicillium brefeldianum
Q0CSA2 5.91e-07 55 25 9 203 1 tazA Non-reducing polyketide synthase tazA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q2TXF0 6.21e-07 55 32 4 143 3 oryfasA Fatty acid synthase subunit alpha Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A0A084R1H6 8.26e-07 55 23 10 275 3 ATR6 Highly reducing polyketide synthase ATR6 Stachybotrys chlorohalonata (strain IBT 40285)
P19097 1.95e-06 53 35 2 108 1 FAS2 Fatty acid synthase subunit alpha Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
S0DL59 3.7e-06 53 32 2 123 1 apf5 Fatty acid synthase apf5 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
P43098 4.69e-06 52 29 4 160 1 FAS2 Fatty acid synthase subunit alpha Candida albicans
G8BAW7 5.78e-06 52 30 3 142 2 FAS2 Fatty acid synthase subunit alpha Candida parapsilosis (strain CDC 317 / ATCC MYA-4646)
Q765N2 6.03e-06 52 35 1 99 3 FAS2 Fatty acid synthase subunit alpha Lachancea kluyveri
I1R9A6 1.05e-05 51 26 2 170 3 FG00036 Fatty acid synthase subunit alpha Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P78615 4.09e-05 49 33 3 124 3 fasA Fatty acid synthase subunit alpha Emericella nidulans

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_07980
Feature type CDS
Gene fabB
Product beta-ketoacyl-ACP synthase I
Location 55920 - 57134 (strand: 1)
Length 1215 (nucleotides) / 404 (amino acids)
In genomic island -

Contig

Accession ZDB_217
Length 250991 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1960
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00109 Beta-ketoacyl synthase, N-terminal domain
PF02801 Beta-ketoacyl synthase, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0304 Lipid transport and metabolism (I)
Secondary metabolites biosynthesis, transport and catabolism (Q)
IQ 3-oxoacyl-(acyl-carrier-protein) synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MKRAVITGLGIISSIGNNREEVLASLREGRSGITFSEEFKEIGMRSQVWGNVKLDTAGLIDRKTARFMSDASVYAYLSMEQAIADSGLTEEQVSHYRTGVVAGSGGGSPRTQAIAADGMRAKGLRGVGPYLVPRAMASGVSANLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGKQDVVFAGGGEELCWEMSCEFDAMGALSTKYNETPDKASRTYDQGRDGFVIAGGGGMVVVEELEHALARGAHIYGEVVGYGATSDGADMVAPSGEGAVRCMQMAMHGLDTPVDYINTHGTSTPVGDTKELEAIREVFGDHTPALSATKAMTGHSLGAAGVHEAIYSLLMLEHGFIAPSINVENLDEKAEGMAIITEPTERKLTTVMSNSFGFGGTNATLVMRKYQN

Flanking regions ( +/- flanking 50bp)

GCTAAAGTAGCGCTAAAATCCCGTACTACTTAAAATGACAGAGGTATTAAATGAAGCGTGCAGTAATCACCGGTCTGGGGATTATCTCAAGTATCGGTAATAACCGGGAGGAAGTACTGGCTTCTTTGAGAGAAGGTCGTTCCGGGATCACATTCTCAGAAGAATTTAAAGAGATCGGCATGCGCAGCCAGGTTTGGGGTAACGTCAAACTGGACACCGCGGGTCTTATTGATCGTAAAACTGCCCGTTTCATGAGTGATGCTTCTGTCTATGCGTATCTTTCCATGGAGCAGGCCATCGCAGACTCCGGTCTGACAGAAGAGCAGGTATCTCACTACCGTACCGGTGTGGTTGCCGGTTCAGGCGGCGGTTCCCCGCGCACTCAGGCTATCGCGGCTGACGGCATGCGTGCCAAAGGTCTGCGTGGTGTCGGTCCTTACCTGGTACCGCGTGCAATGGCATCCGGTGTGTCCGCAAACTTAGCGACACCGTTTAAAATCAAAGGCGTGAACTACTCAATCAGTTCTGCCTGCTCCACCTCTGCACACTGTATCGGCCACGCGGTGGAACTGATCCAGCTGGGCAAACAGGATGTGGTGTTTGCCGGCGGCGGTGAAGAACTGTGCTGGGAAATGAGCTGCGAATTTGACGCAATGGGCGCACTGTCCACTAAATACAACGAAACACCGGACAAAGCATCCCGTACTTATGATCAGGGCCGTGACGGCTTCGTGATCGCAGGCGGCGGCGGTATGGTCGTGGTGGAAGAGCTGGAGCACGCGCTGGCGCGCGGTGCACATATCTACGGTGAAGTGGTCGGCTACGGCGCGACATCTGACGGCGCGGACATGGTTGCCCCGTCCGGTGAAGGTGCGGTCCGCTGCATGCAGATGGCGATGCACGGCCTGGATACGCCGGTTGACTACATCAACACCCACGGCACATCCACGCCGGTCGGTGATACCAAAGAGCTGGAAGCTATCCGTGAAGTCTTCGGTGACCATACTCCGGCACTGTCAGCGACCAAAGCCATGACTGGTCACTCACTGGGTGCCGCAGGTGTTCACGAGGCTATTTACAGCCTGCTGATGCTGGAGCACGGTTTTATCGCGCCGAGCATCAACGTGGAAAACCTTGATGAGAAAGCGGAAGGCATGGCGATTATCACCGAACCGACCGAACGCAAGCTGACGACTGTGATGTCCAACAGCTTCGGCTTCGGCGGCACCAACGCCACACTGGTTATGCGCAAATATCAGAACTGATTTTGCCCTGTTGATCAGATAAATGCCCCGGTTTAATCACCGGGGCATTT