Homologs in group_519

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00510 FBDBKF_00510 80.5 Morganella morganii S1 fliZ flagella biosynthesis regulatory protein FliZ
EHELCC_01035 EHELCC_01035 80.5 Morganella morganii S2 fliZ flagella biosynthesis regulatory protein FliZ
NLDBIP_02425 NLDBIP_02425 80.5 Morganella morganii S4 fliZ flagella biosynthesis regulatory protein FliZ
LHKJJB_03940 LHKJJB_03940 80.5 Morganella morganii S3 fliZ flagella biosynthesis regulatory protein FliZ
HKOGLL_03105 HKOGLL_03105 80.5 Morganella morganii S5 fliZ flagella biosynthesis regulatory protein FliZ
F4V73_RS06520 F4V73_RS06520 78.2 Morganella psychrotolerans fliZ flagella biosynthesis regulatory protein FliZ

Distribution of the homologs in the orthogroup group_519

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_519

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A210 1.48e-61 191 54 0 162 4 fliZ Protein FliZ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A211 1.48e-61 191 54 0 162 4 fliZ Protein FliZ Salmonella typhi
P52627 5.08e-56 177 51 0 162 2 fliZ Regulator of sigma S factor FliZ Escherichia coli (strain K12)
P52629 4.48e-25 95 69 0 59 4 fliZ Protein FliZ (Fragment) Yersinia enterocolitica

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07900
Feature type CDS
Gene fliZ
Product flagella biosynthesis regulatory protein FliZ
Location 1731852 - 1732382 (strand: -1)
Length 531 (nucleotides) / 176 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_519
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02899 Phage integrase, N-terminal SAM-like domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02425 regulator of sigma S factor FliZ Biofilm formation - Escherichia coli
Flagellar assembly
-

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG002318 alternative sigma factor regulatory protein VF0394 Motility

Protein Sequence

MSVSTQKKRPLSRYIKDYKHSQTHCLHCHKALDRISLVFNRQVINKEAISEMTDLIDDETWETLQGKFSALCRFCSEIYCNSETDYFDIMSFKQYLFEQTEMSHSTVREYVVRLRRLDELLTSTNFPRQEFTTEKIQSDLSKKLTPSAFSNYNIALRKYEQYLDWCQAPTSMSSGH

Flanking regions ( +/- flanking 50bp)

CTTATTTTTGTTTTTATTTATTAAGACTACAACACAGGGCTTTATCTCTTATGTCTGTTTCAACACAAAAGAAACGGCCGCTAAGCCGTTACATTAAAGACTATAAACACAGCCAAACTCATTGTTTGCATTGCCATAAGGCGCTTGATCGGATTTCTCTCGTATTCAATCGCCAAGTTATCAATAAAGAAGCCATTTCTGAAATGACAGATTTAATTGATGATGAAACATGGGAAACCTTGCAAGGAAAGTTTTCTGCGCTGTGCCGTTTTTGTAGTGAGATTTACTGTAATAGTGAAACTGATTACTTTGACATTATGTCTTTTAAGCAGTATTTGTTCGAACAAACGGAGATGAGCCACAGTACTGTTCGTGAGTATGTGGTTCGTTTACGTCGACTCGATGAATTGCTGACTTCCACTAATTTTCCTCGTCAAGAATTCACGACAGAGAAAATTCAGTCAGACTTGAGTAAAAAGCTCACTCCCTCCGCATTTAGTAACTACAACATTGCCCTACGTAAGTATGAGCAATATCTTGATTGGTGCCAAGCGCCAACCTCGATGAGTAGTGGTCACTAATCGCATTCAAGAGAGACCTAAAAAAAGGGGTAACATTATGTTGCTCCTTT