Homologs in group_2187

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16470 FBDBKF_16470 62.7 Morganella morganii S1 baeR two-component system response regulator BaeR
EHELCC_08335 EHELCC_08335 62.7 Morganella morganii S2 baeR two-component system response regulator BaeR
NLDBIP_08660 NLDBIP_08660 62.7 Morganella morganii S4 baeR two-component system response regulator BaeR
LHKJJB_05605 LHKJJB_05605 62.7 Morganella morganii S3 baeR two-component system response regulator BaeR
HKOGLL_05310 HKOGLL_05310 62.7 Morganella morganii S5 baeR two-component system response regulator BaeR
F4V73_RS02985 F4V73_RS02985 63.1 Morganella psychrotolerans baeR two-component system response regulator BaeR

Distribution of the homologs in the orthogroup group_2187

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2187

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P69228 9.21e-107 310 64 1 231 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 9.21e-107 310 64 1 231 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P08368 3.11e-52 171 41 3 221 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
P35163 9.67e-52 171 39 5 237 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
A0A4P7TS68 1.39e-49 165 38 3 227 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 1.39e-49 165 38 3 227 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 1.39e-49 165 38 3 227 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 1.39e-49 165 38 3 227 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 1.39e-49 165 38 3 227 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 1.39e-49 165 38 3 227 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 1.39e-49 165 38 3 227 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 1.39e-49 165 38 3 227 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
Q7A0U4 1.19e-48 162 38 5 236 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 1.19e-48 162 38 5 236 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 1.19e-48 162 38 5 236 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 1.19e-48 162 38 5 236 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 1.19e-48 162 38 5 236 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 1.19e-48 162 38 5 236 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 1.19e-48 162 38 5 236 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 1.19e-48 162 38 5 236 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P9WGL9 5.39e-48 160 37 1 224 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 5.39e-48 160 37 1 224 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 5.39e-48 160 37 1 224 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9F868 5.92e-48 160 37 1 225 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P45606 2.38e-47 159 36 4 225 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P0AFJ5 2.38e-47 159 36 4 225 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 2.38e-47 159 36 4 225 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45607 8.35e-47 157 36 4 225 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
Q06239 9.64e-47 157 37 3 227 3 vanR Regulatory protein VanR Enterococcus faecium
P50350 1.33e-46 157 35 2 239 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
P45605 2.23e-46 156 36 4 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P94413 6.99e-46 155 33 2 225 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
P28835 4.63e-45 153 37 2 228 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P13792 7.77e-45 153 41 6 231 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P37478 1.41e-44 152 37 3 225 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q8CQK0 1.48e-44 152 38 4 225 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 1.48e-44 152 38 4 225 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4A160 1.88e-44 152 38 4 225 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4LAJ9 2e-44 151 38 4 225 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q7A216 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 3.51e-44 151 39 5 225 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 3.51e-44 151 39 5 225 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 3.51e-44 151 39 5 225 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 3.51e-44 151 39 5 225 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q52990 4.15e-44 150 37 4 225 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P50351 4.39e-44 151 35 2 240 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A0QTK2 1.66e-43 149 39 2 218 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9I0I1 3.35e-43 148 37 3 224 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q07783 4.17e-43 148 35 2 239 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q93CB8 4.49e-43 148 40 2 218 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 4.94e-43 148 40 2 218 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 4.94e-43 148 40 2 218 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 4.94e-43 148 40 2 218 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CCJ2 5e-43 148 40 2 218 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P44895 7.71e-43 147 35 2 221 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9HUI2 1.23e-42 147 37 4 237 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P48259 1.88e-42 147 36 2 231 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q1XDC9 6.79e-42 145 35 2 228 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P51358 1.11e-41 145 35 2 228 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q9TLQ4 8.4e-41 143 35 4 232 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P23620 1.29e-40 142 35 5 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P32040 2.11e-40 142 34 4 235 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P0C001 2.42e-40 140 35 2 216 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 2.42e-40 140 35 2 216 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 2.42e-40 140 35 2 216 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 2.42e-40 140 35 2 216 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 2.42e-40 140 35 2 216 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 2.42e-40 140 35 2 216 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 2.42e-40 140 35 2 216 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 2.42e-40 140 35 2 216 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
P45189 4.17e-40 140 35 3 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O78428 8.56e-40 140 35 2 228 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q8DPL7 1.19e-39 139 36 4 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 1.19e-39 139 36 4 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 1.19e-39 139 36 4 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q4L6C6 1.59e-39 139 36 2 217 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
O06978 3.86e-39 138 35 5 232 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
P42244 6.57e-39 137 33 2 222 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
P28257 7.11e-39 138 35 3 228 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P54884 7.73e-39 136 37 1 197 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q4L8L9 1.6e-38 136 36 5 218 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
P0A9Q4 1.64e-38 136 33 2 239 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 1.64e-38 136 33 2 239 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 1.64e-38 136 33 2 239 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 1.64e-38 136 33 2 239 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
P39663 1.98e-38 137 34 5 238 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P42421 4.48e-38 135 34 3 223 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q82EB1 4.87e-38 135 32 5 231 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
O32192 5.61e-38 135 34 5 226 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q9ZEP4 7.69e-38 135 31 4 230 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
G3XCY6 9.9e-38 134 32 3 231 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5HLN2 1.82e-37 133 32 3 219 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN92 4.44e-37 132 32 3 219 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A0A0H3GGB5 5.72e-37 132 37 3 230 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P44918 5.9e-37 132 32 3 231 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7A039 6.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 6.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 6.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 6.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 6.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 6.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 6.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 6.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 6.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 6.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GE73 7.19e-37 132 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q9AE24 9.55e-37 132 36 4 221 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
A6QJK3 1.13e-36 131 32 6 224 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 1.13e-36 131 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
Q7D9K0 1.54e-36 132 34 2 222 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 1.54e-36 132 34 2 222 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q2YZ24 1.81e-36 131 32 6 224 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P0AE90 1.96e-36 131 36 2 230 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 1.96e-36 131 36 2 230 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 1.96e-36 131 36 2 230 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
Q99U73 2.5e-36 130 36 5 218 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P0DMK7 3.27e-36 130 33 1 216 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 3.27e-36 130 33 1 216 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q5HPC3 3.74e-36 130 36 2 217 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CP82 6.26e-36 129 36 2 217 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q04942 1.84e-35 128 32 0 220 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q49XM7 1.88e-35 128 35 2 217 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q55890 3.27e-35 128 35 6 231 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P94504 7.57e-35 127 30 2 224 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
P45337 9.22e-35 126 32 2 217 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P54443 1.15e-34 126 31 4 231 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
Q01473 5.53e-34 131 33 1 217 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 1.5e-06 52 25 2 121 3 rcaC Protein RcaC Microchaete diplosiphon
P38684 6.73e-34 124 34 5 228 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P58357 1.47e-33 123 34 5 228 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
Q49ZT8 1.72e-33 123 30 3 219 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q44006 1.7e-32 120 31 1 216 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9K621 1.76e-32 120 28 2 221 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KM23 2.73e-32 120 33 5 221 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P31079 6.05e-32 119 28 3 232 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q31S42 1.22e-31 119 32 5 236 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A1KHB7 1.3e-31 118 29 4 224 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 1.3e-31 118 29 4 224 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CD68 1.78e-31 118 29 4 221 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
O31432 1.97e-31 118 31 8 229 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P9WGM9 1.99e-31 118 29 4 224 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 1.99e-31 118 29 4 224 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 1.99e-31 118 29 4 224 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P52076 3.03e-31 117 32 2 217 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q742C1 4.69e-31 117 29 4 221 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 4.69e-31 117 29 4 221 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q8DN02 6.21e-31 116 31 3 219 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 6.21e-31 116 31 3 219 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q44929 7.56e-31 117 29 3 230 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
L7N689 1.17e-30 117 32 6 226 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q55933 1.19e-30 116 31 6 232 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1B3X8 1.39e-30 115 30 4 221 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 1.39e-30 115 30 4 221 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 1.39e-30 115 30 4 221 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
O34951 1.42e-30 115 27 3 222 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
A1TEL7 1.47e-30 115 30 4 222 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q7A1J1 1.55e-30 115 32 7 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 1.55e-30 115 32 7 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 1.55e-30 115 32 7 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 1.55e-30 115 32 7 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 1.55e-30 115 32 7 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 1.55e-30 115 32 7 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 1.55e-30 115 32 7 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 1.55e-30 115 32 7 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 1.55e-30 115 32 7 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 1.55e-30 115 32 7 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
O34903 1.85e-30 115 33 5 222 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
P66795 3.6e-30 114 31 2 217 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 3.6e-30 114 31 2 217 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
P21866 4.13e-30 114 32 4 225 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q8XBS3 4.18e-30 114 31 2 217 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
Q02540 6.92e-30 114 33 5 225 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q8CQ37 1.11e-29 113 29 3 220 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 1.11e-29 113 29 3 220 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6GJ11 1.23e-29 113 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q2YSS2 1.35e-29 113 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A8Z181 1.38e-29 113 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 1.38e-29 113 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 1.38e-29 113 28 3 221 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 1.38e-29 113 28 3 221 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 1.38e-29 113 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q04803 1.58e-29 115 32 1 224 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7A1L2 2.82e-29 112 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 2.82e-29 112 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 2.82e-29 112 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
Q932F1 2.82e-29 112 28 3 221 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IQL2 2.82e-29 112 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 2.82e-29 112 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 2.82e-29 112 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
A0PWB4 3.01e-29 112 29 3 222 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q8CQ17 3.85e-29 112 31 5 226 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 3.85e-29 112 31 5 226 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L481 8.53e-29 111 27 2 219 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q47744 8.61e-29 111 31 4 222 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
P33112 1.09e-28 110 33 5 227 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
P52108 1.41e-28 110 31 2 237 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
A0R3I8 1.59e-28 110 29 4 222 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9HV32 1.62e-28 110 32 5 220 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I4F9 1.94e-28 110 32 2 217 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2FWH6 3.6e-28 109 32 2 220 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
O24973 5.25e-28 109 32 1 221 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q47456 5.98e-28 108 34 4 221 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q8Z7H2 8.27e-28 108 32 3 221 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
Q07597 9.2e-28 108 29 2 227 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
Q57QC3 1.26e-27 108 33 3 221 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P13359 1.51e-27 108 29 2 226 3 virG Regulatory protein VirG Rhizobium rhizogenes
P36556 1.54e-27 107 33 4 220 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q50136 1.97e-27 107 33 6 206 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P0DM78 1.97e-27 107 32 3 221 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 1.97e-27 107 32 3 221 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 1.97e-27 107 32 3 221 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 1.97e-27 107 32 3 221 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 1.97e-27 107 32 3 221 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P76340 2.41e-27 107 30 2 216 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
P30843 3.3e-27 107 32 4 220 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
P62722 3.64e-27 108 33 7 231 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
Q83RR0 4.18e-27 106 31 2 220 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 4.18e-27 106 31 2 220 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X738 4.18e-27 106 31 2 220 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
P23836 4.5e-27 106 31 2 220 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
P0A4I0 6.89e-27 106 29 4 224 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 6.89e-27 106 29 4 224 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
Q49VK3 1.48e-26 105 27 3 221 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0A4I2 1.69e-26 105 31 3 219 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 1.69e-26 105 31 3 219 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P9WGM1 1.74e-26 105 32 6 206 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 1.74e-26 105 32 6 206 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 1.74e-26 105 32 6 206 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A6WZ81 5.72e-26 103 27 2 218 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8FZ93 5.84e-26 103 27 2 218 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 5.84e-26 103 27 2 218 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 5.84e-26 103 27 2 218 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 5.84e-26 103 27 2 218 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 5.84e-26 103 27 2 218 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 5.84e-26 103 27 2 218 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 5.84e-26 103 27 2 218 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 5.84e-26 103 27 2 218 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q44444 9.92e-26 104 33 7 231 3 virG Regulatory protein VirG Rhizobium radiobacter
P9WGN1 5.49e-25 101 26 2 227 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 5.49e-25 101 26 2 227 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0ACZ8 9.21e-25 100 31 5 224 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 9.21e-25 100 31 5 224 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 9.21e-25 100 31 5 224 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P07545 1.22e-24 100 30 3 234 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
O69730 1.34e-24 100 29 4 224 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0CL17 1e-23 97 30 4 223 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 1e-23 97 30 4 223 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
B8H358 1.61e-23 97 27 1 217 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.61e-23 97 27 1 217 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P0A4H8 5.67e-23 95 28 4 215 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 5.67e-23 95 28 4 215 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q70FH0 6.64e-23 95 31 2 217 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
Q8GP20 2.65e-22 94 28 2 213 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q9ZHD3 6.32e-22 93 31 6 227 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q1XDE4 2.55e-15 75 29 1 133 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P72781 2.59e-15 75 31 2 132 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q54SP4 5.41e-15 77 31 2 183 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
B8GZM2 1.09e-14 75 35 1 117 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 1.09e-14 75 35 1 117 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P40138 3.13e-14 74 32 2 121 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
O25918 2.14e-13 70 24 7 222 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
Q8KIY1 3.3e-13 72 36 2 116 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q05943 3.92e-13 70 32 8 169 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P55701 7.46e-13 68 26 2 181 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O05251 1.09e-12 68 34 4 126 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
T2KMF4 4.81e-12 68 28 3 154 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P51343 6.49e-12 65 30 1 121 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
E0X9C7 8.48e-12 67 34 2 116 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
Q9HV27 1.1e-11 67 33 3 127 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P43501 1.27e-11 63 31 1 116 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A5W4E3 2.92e-11 66 33 2 116 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4UU85 1.24e-10 63 30 2 132 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
Q8FW53 1.6e-10 60 32 1 119 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 1.6e-10 60 32 1 119 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 1.6e-10 60 32 1 119 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 1.6e-10 60 32 1 119 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 1.6e-10 60 32 1 119 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 1.6e-10 60 32 1 119 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 1.6e-10 60 32 1 119 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 1.6e-10 60 32 1 119 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
P0DMC5 3.02e-10 63 34 1 102 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
Q54SK5 3.27e-10 63 31 2 121 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
P38889 4.95e-10 62 31 1 104 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9KSB1 6.68e-10 62 33 4 136 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0DMC6 6.99e-10 62 34 1 102 1 rcsC Sensor histidine kinase RcsC Escherichia coli
Q5A599 1e-09 61 26 1 139 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P96602 1.1e-09 60 31 4 134 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q5A4X5 1.13e-09 61 31 1 104 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
P46384 1.33e-09 58 29 2 98 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q06065 1.4e-09 60 32 1 106 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
Q7MD16 1.57e-09 60 31 1 107 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q8D5Z6 1.6e-09 60 31 1 107 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
P48359 1.89e-09 58 31 1 82 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P24072 2.87e-09 56 28 2 119 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
A6X580 5.34e-09 56 31 1 117 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P52940 6.18e-09 58 24 8 241 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
Q54YZ9 6.99e-09 59 30 1 118 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q56128 7.81e-09 58 32 1 102 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
P58662 8.1e-09 58 32 1 102 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9KQD5 1.16e-08 55 25 2 124 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 1.16e-08 55 25 2 124 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P21649 1.61e-08 57 31 4 116 1 mrkE Protein MrkE Klebsiella pneumoniae
O25153 2.08e-08 57 29 2 113 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q8FFE0 2.12e-08 56 31 4 116 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q56312 2.19e-08 54 28 2 108 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B0R4K1 2.19e-08 54 28 1 114 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P48027 2.36e-08 57 29 3 139 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
P0AE41 2.48e-08 56 31 4 116 3 ypdB Transcriptional regulatory protein YpdB Shigella flexneri
P0AE39 2.48e-08 56 31 4 116 1 ypdB Transcriptional regulatory protein YpdB Escherichia coli (strain K12)
P0AE40 2.48e-08 56 31 4 116 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O157:H7
P30855 2.84e-08 57 34 1 101 1 evgS Sensor protein EvgS Escherichia coli (strain K12)
P0AFB8 2.98e-08 57 25 2 143 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 2.98e-08 57 25 2 143 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P58402 3.48e-08 57 34 1 101 3 evgS Sensor protein EvgS Escherichia coli O157:H7
P44845 4.3e-08 55 27 7 203 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P06628 4.45e-08 53 33 3 116 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
G0SB31 4.87e-08 56 27 2 104 1 SKN7 Transcription factor SKN7 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
P39486 4.9e-08 55 30 5 124 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
P52942 5.23e-08 53 33 4 118 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
O14283 5.55e-08 56 28 1 101 1 prr1 Transcription factor prr1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P41789 7.14e-08 55 25 2 143 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q87GU5 7.94e-08 55 33 1 104 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D0P1 1.02e-07 52 23 2 105 3 cheY Chemotaxis protein CheY Yersinia pestis
Q9F8D7 1.13e-07 55 29 3 122 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P26319 1.14e-07 53 23 8 212 3 fimZ Fimbriae Z protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P52941 1.31e-07 54 28 3 124 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q93P00 1.32e-07 52 23 2 105 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
P0AEC5 1.82e-07 55 28 5 152 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 1.82e-07 55 28 5 152 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 1.82e-07 55 28 5 152 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
P59342 1.85e-07 54 27 5 154 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
P0AE69 1.98e-07 52 24 2 105 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 1.98e-07 52 24 2 105 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 1.98e-07 52 24 2 105 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
P66797 2.07e-07 53 29 2 106 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 2.07e-07 53 29 2 106 3 uvrY Response regulator UvrY Escherichia coli O157:H7
Q31HL9 2.13e-07 54 30 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P03029 2.15e-07 54 27 2 141 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q51455 2.17e-07 51 23 2 119 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AED6 2.39e-07 53 29 2 106 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 2.39e-07 53 29 2 106 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
O07528 2.51e-07 53 27 6 172 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
P58253 2.58e-07 53 26 6 164 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P71403 2.88e-07 51 26 3 118 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZM64 2.88e-07 51 26 3 118 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
P18769 3e-07 54 28 1 111 1 frzE Gliding motility regulatory protein Myxococcus xanthus
Q9K998 3.11e-07 53 26 5 154 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q4ZSY3 3.16e-07 53 28 6 123 3 Psyr_2700 Blue-light-activated protein Pseudomonas syringae pv. syringae (strain B728a)
Q9APD9 3.3e-07 53 30 1 100 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P39048 3.46e-07 53 27 2 116 2 patA Protein PatA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8FGP6 3.8e-07 51 24 2 105 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q10WZ6 4.52e-07 53 32 4 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
P52936 5.13e-07 52 28 3 130 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
P45365 5.47e-07 53 29 1 122 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
Q54RP6 5.54e-07 53 28 4 125 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
Q9KT84 6.05e-07 53 28 1 124 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q39T95 6.53e-07 52 37 0 70 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q881J7 7.68e-07 52 27 6 123 1 PSPTO_2896 Blue-light-activated protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9KM66 7.76e-07 52 29 1 103 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A2D5 7.94e-07 50 22 2 105 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 7.94e-07 50 22 2 105 3 cheY Chemotaxis protein CheY Salmonella typhi
A1SMR4 8.8e-07 52 29 7 157 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q9FAD7 9.41e-07 50 22 2 105 3 cheY Chemotaxis protein CheY Enterobacter cloacae
Q86CZ2 1.01e-06 52 23 1 128 1 dhkK Hybrid signal transduction histidine kinase K Dictyostelium discoideum
Q86AT9 1.06e-06 52 26 2 126 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
P13632 1.15e-06 52 23 1 107 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P30198 1.21e-06 51 24 5 150 4 epiQ Putative epidermin response regulator Staphylococcus epidermidis
P96126 1.33e-06 50 29 4 124 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q1IQS9 1.42e-06 52 26 5 149 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
P62640 1.42e-06 52 35 0 73 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q9FXD6 1.43e-06 52 26 1 117 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
Q04849 1.43e-06 52 27 5 147 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P52931 1.45e-06 50 31 4 104 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
Q39WQ9 1.53e-06 51 30 3 109 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P0AEV3 1.75e-06 51 28 1 109 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 1.75e-06 51 28 1 109 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 1.75e-06 51 28 1 109 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q8TLG9 1.82e-06 51 32 3 109 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P0DOA0 1.92e-06 52 27 4 129 1 cckA Sensor kinase CckA Brucella abortus (strain 2308)
P14375 1.93e-06 51 29 1 100 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
P9WGM3 2.03e-06 50 28 3 119 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 2.03e-06 50 28 3 119 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8X613 2.1e-06 51 29 1 100 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P51586 2.12e-06 48 28 1 119 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q9UYF3 2.27e-06 51 29 3 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
Q54YH4 2.88e-06 51 24 1 131 1 dhkB Hybrid signal transduction histidine kinase B Dictyostelium discoideum
Q54Q69 3.29e-06 51 27 3 129 3 dhkG Hybrid signal transduction histidine kinase G Dictyostelium discoideum
Q04848 3.35e-06 50 23 1 117 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A3LP85 3.42e-06 50 32 2 108 3 SRR1 Stress response regulator protein 1 Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q8L9Y3 3.55e-06 50 29 3 131 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
P52938 3.81e-06 50 29 4 119 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q9KA55 3.91e-06 50 29 3 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P25852 4.3e-06 50 30 1 100 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A1W0A5 4.55e-06 48 30 1 68 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 4.55e-06 48 30 1 68 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 4.55e-06 48 30 1 68 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q8Z333 4.81e-06 50 30 1 100 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q2SPQ1 4.88e-06 50 27 2 111 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Hahella chejuensis (strain KCTC 2396)
Q5AHA0 5.56e-06 50 30 3 118 2 CHK1 Histidine protein kinase 1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q9KLK7 5.68e-06 50 28 1 104 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P52929 5.76e-06 49 26 3 123 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
Q2ILG8 6.09e-06 50 26 1 104 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q2KCH8 6.11e-06 49 29 4 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q5JF95 6.2e-06 49 32 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q6H805 6.97e-06 50 27 1 101 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
A2X1N2 7.1e-06 50 27 1 101 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
Q9KL96 7.9e-06 49 28 4 131 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O85128 8.27e-06 49 30 3 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5AKU6 9.02e-06 49 26 2 133 1 SSK1 Oxidative stress response two-component system protein SSK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q12YX1 9.5e-06 49 27 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q5N6V8 9.76e-06 49 28 2 118 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
Q30RX5 1.04e-05 49 30 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q87K77 1.06e-05 48 30 6 129 3 VPA0021 Uncharacterized response regulatory protein VPA0021 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O58192 1.09e-05 49 31 4 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9I6V9 1.15e-05 48 31 3 105 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9P896 1.16e-05 49 28 4 105 3 tcsA Two-component system protein A Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P62647 1.21e-05 48 30 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q6BGW4 1.56e-05 48 27 5 133 3 SRR1 Stress response regulator protein 1 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
O14002 1.68e-05 49 26 3 122 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P10576 2.05e-05 48 22 2 129 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
P23221 2.1e-05 47 21 7 220 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8D4X6 2.21e-05 48 29 3 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
Q7MBQ5 2.28e-05 48 29 3 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
A7N6S2 2.43e-05 48 23 1 109 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
P45709 2.45e-05 45 26 2 115 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
P62637 2.74e-05 48 32 3 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P87323 2.76e-05 48 23 1 131 4 mcs4 Response regulator mcs4 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q05522 3.04e-05 47 27 3 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
Q0AWZ8 3.1e-05 47 29 3 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P33394 3.26e-05 45 24 3 124 3 rrf1 Protein Rrf1 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P06534 3.29e-05 47 26 4 116 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
Q9KS59 3.53e-05 47 21 4 187 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9P7Q7 3.65e-05 48 26 2 114 3 mak1 Peroxide stress-activated histidine kinase mak1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q52883 3.81e-05 47 30 2 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q1D359 3.85e-05 47 27 2 111 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
Q00934 4.11e-05 47 26 5 175 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P74111 4.19e-05 47 23 1 120 1 cikA Circadian input-output histidine kinase CikA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q3SIG0 4.38e-05 47 28 3 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
Q9WY30 4.47e-05 47 29 3 103 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9LYP5 4.54e-05 47 24 3 110 2 ARR21 Putative two-component response regulator ARR21 Arabidopsis thaliana
P37599 4.68e-05 47 29 3 112 1 cheV Chemotaxis protein CheV Bacillus subtilis (strain 168)
Q3J653 5.18e-05 47 31 5 119 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P45671 5.38e-05 47 20 1 132 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
P52934 5.57e-05 46 29 4 104 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
Q1GZZ0 5.72e-05 47 28 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
P54302 5.93e-05 47 29 1 104 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio harveyi
O29221 6.32e-05 47 28 2 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q63PS2 6.44e-05 47 27 3 112 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain K96243)
P94439 6.52e-05 46 23 5 186 1 lnrK Transcriptional regulatory protein LnrK Bacillus subtilis (strain 168)
Q55169 6.61e-05 45 30 3 110 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8EQQ3 6.99e-05 46 32 4 105 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q820K0 7.03e-05 46 25 6 143 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q20XK3 7.12e-05 46 27 3 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhodopseudomonas palustris (strain BisB18)
Q1IRH0 7.13e-05 46 29 5 131 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
P62639 7.52e-05 46 31 3 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q9RC52 7.79e-05 46 33 5 110 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2T8Y6 8.09e-05 46 30 2 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q67W50 8.48e-05 46 28 1 107 3 RR25 Two-component response regulator ORR25 Oryza sativa subsp. japonica
Q9I4N3 8.53e-05 46 29 4 113 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8Q009 8.59e-05 46 30 3 109 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q13SY2 8.66e-05 46 35 1 64 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Paraburkholderia xenovorans (strain LB400)
Q9SXL4 8.81e-05 47 32 1 81 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
Q6K8X6 8.86e-05 46 26 1 123 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
Q47I43 9.31e-05 46 30 3 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Dechloromonas aromatica (strain RCB)
B8AEH1 9.44e-05 46 26 1 123 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
Q39KQ1 0.000102 46 26 2 110 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
P0ACZ7 0.000113 45 26 4 122 1 evgA DNA-binding transcriptional activator EvgA Shigella flexneri
P0ACZ4 0.000113 45 26 4 122 1 evgA DNA-binding transcriptional activator EvgA Escherichia coli (strain K12)
P0ACZ5 0.000113 45 26 4 122 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACZ6 0.000113 45 26 4 122 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O157:H7
Q1BRL2 0.00012 45 35 1 64 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
Q3JY65 0.000127 45 29 3 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain 1710b)
Q62G12 0.000127 45 29 3 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia mallei (strain ATCC 23344)
Q7N5T1 0.000131 45 31 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2STS8 0.000131 45 29 3 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P0C5S5 0.000133 45 24 1 126 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 0.000133 45 24 1 126 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q7A0I0 0.000136 45 22 3 172 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 0.000136 45 22 3 172 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 0.000136 45 22 3 172 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 0.000136 45 22 3 172 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 0.000136 45 22 3 172 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 0.000136 45 22 3 172 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4UU97 0.000136 45 27 4 111 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain 8004)
Q3BUA2 0.000136 45 29 3 110 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8P9J7 0.000136 45 27 4 111 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PLB4 0.000136 45 29 3 110 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas axonopodis pv. citri (strain 306)
P0AEL8 0.000138 45 21 7 185 3 fimZ Fimbriae Z protein Escherichia coli (strain K12)
P0AEL9 0.000138 45 21 7 185 3 fimZ Fimbriae Z protein Escherichia coli O157:H7
Q65JK6 0.00014 45 25 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q9HWA4 0.000142 45 25 2 124 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07750
Feature type CDS
Gene baeR
Product two-component system response regulator BaeR
Location 1697128 - 1697835 (strand: 1)
Length 708 (nucleotides) / 235 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2187
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07664 two-component system, OmpR family, response regulator BaeR Two-component system -

Protein Sequence

MTTTTSTYSILIVEDEPKLAQLLIDYLQASDYQTQWLADGTEVIQHIKQSHYDLVLLDLMLPGKDGITLCKELRQFSDIPIIMVTAKTEEVDRLLGLEIGADDYICKPYSPREVVARVKTLLRRYYRPQDIVQNSALVIIDEQAYQIQYHNKILDLTTAEFRLIKALATQPGKVLSRDQLMDHLYDDYRIVTDRTIDSHIKNLRRKLEQLNDQIEFIRSIYGQGYRWETAAYRFR

Flanking regions ( +/- flanking 50bp)

TTATACTGAATATTATTGTCCTAATTGATAACTATTGAGCCATATAGACAATGACCACGACCACATCTACATATTCAATTTTAATCGTTGAAGATGAGCCGAAATTGGCACAATTACTTATTGATTATCTTCAAGCATCTGATTATCAAACGCAGTGGCTGGCAGATGGTACTGAGGTTATACAACATATCAAACAATCTCATTACGATTTAGTCCTGCTTGATCTGATGCTACCGGGTAAAGATGGCATTACCCTATGCAAAGAGTTACGTCAGTTCTCCGATATTCCTATTATTATGGTCACCGCAAAAACAGAAGAAGTAGACCGACTATTAGGGTTGGAAATTGGTGCTGATGATTATATTTGCAAACCTTATAGCCCTCGAGAAGTGGTTGCCCGTGTAAAAACATTATTGCGTCGCTATTATCGGCCACAGGATATTGTGCAAAATAGCGCCTTAGTTATTATTGATGAGCAGGCTTACCAAATTCAATATCATAATAAAATTCTTGATTTAACTACCGCTGAATTTCGTCTTATTAAAGCATTAGCTACACAACCGGGCAAAGTGTTAAGCCGTGACCAGTTAATGGATCATCTGTATGATGATTATCGCATCGTAACCGACCGTACTATTGATAGCCATATAAAAAACTTACGGCGCAAACTTGAGCAACTTAACGATCAAATTGAATTTATTCGTTCAATTTATGGACAAGGCTATCGTTGGGAAACCGCAGCCTATCGTTTTCGATGATATTTTTTCAGGAATACATTGAACCTCGCTACAGTTAAGCGCTAGAATCC