Homologs in group_1874

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13610 FBDBKF_13610 80.8 Morganella morganii S1 bcp thioredoxin-dependent thiol peroxidase
EHELCC_08485 EHELCC_08485 80.8 Morganella morganii S2 bcp thioredoxin-dependent thiol peroxidase
NLDBIP_08810 NLDBIP_08810 80.8 Morganella morganii S4 bcp thioredoxin-dependent thiol peroxidase
LHKJJB_05455 LHKJJB_05455 80.8 Morganella morganii S3 bcp thioredoxin-dependent thiol peroxidase
HKOGLL_05460 HKOGLL_05460 80.8 Morganella morganii S5 bcp thioredoxin-dependent thiol peroxidase
F4V73_RS03155 F4V73_RS03155 78.8 Morganella psychrotolerans bcp thioredoxin-dependent thiol peroxidase

Distribution of the homologs in the orthogroup group_1874

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1874

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE55 3.42e-94 272 81 0 155 3 bcp Putative peroxiredoxin bcp Shigella flexneri
P0AE52 3.42e-94 272 81 0 155 1 bcp Peroxiredoxin Bcp Escherichia coli (strain K12)
P0AE53 3.42e-94 272 81 0 155 3 bcp Putative peroxiredoxin bcp Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE54 3.42e-94 272 81 0 155 3 bcp Putative peroxiredoxin bcp Escherichia coli O157:H7
P44411 4.56e-71 213 61 0 154 3 bcp Putative peroxiredoxin bcp Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9ZHF0 1.18e-62 192 56 0 154 3 bcp Putative peroxiredoxin bcp Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P9WIE1 6.86e-46 150 49 0 141 1 bcp Putative peroxiredoxin Rv2521 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE0 6.86e-46 150 49 0 141 3 bcp Putative peroxiredoxin MT2597 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q83CY8 8.93e-45 147 48 0 149 1 bcp Putative peroxiredoxin bcp Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q796Y8 1.5e-39 134 43 0 141 3 ygaF Peroxiredoxin Bcp Bacillus subtilis (strain 168)
Q9MB35 9.38e-36 125 47 3 139 1 PRXQ Peroxiredoxin Q, chloroplastic (Fragment) Sedum lineare
P0C5D5 1.28e-35 125 46 3 139 2 Os06g0196300 Peroxiredoxin Q, chloroplastic Oryza sativa subsp. japonica
P0C5D4 1.28e-35 125 46 3 139 3 OsI_22010 Putative peroxiredoxin Q, chloroplastic Oryza sativa subsp. indica
Q5S1S6 5.36e-34 121 44 3 139 2 PRX1 Peroxiredoxin Q, chloroplastic Triticum aestivum
Q75SY5 9.51e-34 120 41 3 149 2 AFP1 Peroxiredoxin Q, chloroplastic Gentiana triflora
Q9ZMU4 1.56e-33 118 40 0 152 3 bcp Putative peroxiredoxin bcp Helicobacter pylori (strain J99 / ATCC 700824)
Q6QPJ6 2.08e-33 120 43 3 139 1 PRXQ Peroxiredoxin Q, chloroplastic Populus jackii
Q9LU86 4.78e-33 119 41 3 149 1 PRXQ Peroxiredoxin Q, chloroplastic Arabidopsis thaliana
Q6UBI3 9.56e-33 118 42 3 149 2 PRXQ Peroxiredoxin Q, chloroplastic Suaeda salsa
P55979 1.1e-32 116 39 0 152 3 bcp Putative peroxiredoxin bcp Helicobacter pylori (strain ATCC 700392 / 26695)
P9WID9 1.39e-24 95 37 4 153 1 bcpB Putative peroxiredoxin Rv1608c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WID8 1.39e-24 95 37 4 153 3 bcpB Putative peroxiredoxin MT1643 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8P9V9 2.14e-22 90 33 1 148 1 bcp Peroxiredoxin Bcp Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
O94561 1.63e-20 86 40 2 114 1 bcp1 Peroxiredoxin bcp1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P40553 1.81e-16 76 41 4 112 1 DOT5 Peroxiredoxin DOT5 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P91883 3.45e-14 69 32 4 145 2 None Thioredoxin peroxidase Fasciola hepatica
Q9NL98 1.09e-12 65 29 5 154 2 None Peroxiredoxin Ascaris suum
Q96291 1.59e-12 66 32 5 141 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Arabidopsis thaliana
O24364 1.69e-12 66 32 5 141 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Spinacia oleracea
P80602 3.95e-12 64 32 5 140 1 TSA 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Triticum aestivum
Q96468 4.11e-12 64 32 5 140 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Hordeum vulgare
A0A2Z5VKM8 5.14e-12 63 30 6 145 1 None 2-cysteine peroxiredoxin, chloroplastic Chattonella marina var. antiqua
Q6ER94 5.69e-12 64 32 5 140 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Oryza sativa subsp. japonica
Q9C5R8 5.95e-12 64 31 5 141 2 At5g06290 2-Cys peroxiredoxin BAS1-like, chloroplastic Arabidopsis thaliana
P0CB50 2.86e-11 62 29 5 148 1 PRDX1 Peroxiredoxin-1 Gallus gallus
Q5E947 3.3e-11 62 29 5 151 2 PRDX1 Peroxiredoxin-1 Bos taurus
Q89AS1 3.41e-11 62 31 5 138 3 bbp_171 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P9WIE3 4.78e-11 60 28 3 133 1 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE2 4.78e-11 60 28 3 133 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65689 4.78e-11 60 28 3 133 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q979N7 9.1e-11 60 30 6 141 3 TV1123 Peroxiredoxin Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q1XDL4 1.6e-10 60 26 6 173 3 ycf42 Putative peroxiredoxin ycf42 Neopyropia yezoensis
Q9BGI3 1.73e-10 60 31 6 144 2 PRDX2 Peroxiredoxin-2 Bos taurus
Q63716 2.39e-10 59 29 5 151 1 Prdx1 Peroxiredoxin-1 Rattus norvegicus
Q6DV14 2.51e-10 59 29 5 148 2 PRDX1 Peroxiredoxin-1 Gekko japonicus
Q6B4U9 2.67e-10 59 29 5 151 1 PRDX1 Peroxiredoxin-1 Myotis lucifugus
Q06830 2.84e-10 59 29 5 151 1 PRDX1 Peroxiredoxin-1 Homo sapiens
P35700 2.99e-10 59 29 5 151 1 Prdx1 Peroxiredoxin-1 Mus musculus
P51272 3.56e-10 58 27 6 173 3 ycf42 Putative peroxiredoxin ycf42 Porphyra purpurea
Q2PFZ3 4.98e-10 58 29 6 147 2 PRDX2 Peroxiredoxin-2 Macaca fascicularis
P32119 4.98e-10 58 29 6 147 1 PRDX2 Peroxiredoxin-2 Homo sapiens
Q8T6C4 5.32e-10 58 29 6 144 2 TPX Thioredoxin peroxidase Echinococcus granulosus
Q6L140 6.55e-10 58 28 5 140 3 PTO0727 Peroxiredoxin 2 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q5RC63 9.83e-10 57 29 6 147 2 PRDX2 Peroxiredoxin-2 Pongo abelii
Q8K3U7 1.9e-09 57 29 6 145 2 PRDX2 Peroxiredoxin-2 Cricetulus griseus
Q58146 2.37e-09 57 28 6 141 3 MJ0736 Peroxiredoxin Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A2BJD9 2.64e-09 57 26 4 143 3 Hbut_0228 Peroxiredoxin Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
Q9HJL3 2.84e-09 56 29 5 135 3 Ta0954 Peroxiredoxin 2 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q61171 3.66e-09 56 30 6 145 1 Prdx2 Peroxiredoxin-2 Mus musculus
P35704 3.74e-09 56 30 6 145 1 Prdx2 Peroxiredoxin-2 Rattus norvegicus
O67024 4.76e-09 56 28 4 136 1 aq_858 Peroxiredoxin Aquifex aeolicus (strain VF5)
Q9JKY1 4.98e-09 55 28 5 151 1 PRDX1 Peroxiredoxin-1 Cricetulus griseus
A3DKL1 6.95e-09 56 27 3 135 3 Smar_0058 Peroxiredoxin Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
P48822 8.4e-09 55 27 5 151 2 TSA1 Peroxiredoxin 1 Brugia malayi
Q9Z0V6 8.73e-09 55 28 3 125 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Rattus norvegicus
Q55624 9.28e-09 55 25 5 147 3 sll0755 Putative peroxiredoxin sll0755 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A5IIX7 9.76e-09 55 25 3 135 3 Tpet_0121 Peroxiredoxin Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A4IQF5 1.33e-08 54 26 3 134 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus thermodenitrificans (strain NG80-2)
Q21824 1.63e-08 55 26 5 153 3 prdx-3 Probable peroxiredoxin prdx-3 Caenorhabditis elegans
P20108 1.68e-08 55 28 3 125 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Mus musculus
A0A0K3AUJ9 2.03e-08 54 28 6 145 1 prdx-2 Peroxiredoxin prdx-2 Caenorhabditis elegans
O29969 2.23e-08 54 26 4 142 3 AF_0270 Peroxiredoxin Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P35705 4e-08 53 28 3 125 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Bos taurus
P30048 4.09e-08 53 28 3 125 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Homo sapiens
Q5REY3 4.13e-08 53 28 3 125 2 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Pongo abelii
Q9WZR4 4.51e-08 53 24 3 135 3 TM_0807 Peroxiredoxin Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q5KXL9 5.08e-08 52 27 3 134 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus kaustophilus (strain HTA426)
O74887 5.53e-08 53 28 4 145 1 tpx1 Peroxiredoxin tpx1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9BGI2 5.95e-08 53 26 3 123 2 PRDX4 Peroxiredoxin-4 Bos taurus
Q9L3Q5 7.71e-08 52 28 6 142 1 prxU Selenocysteine-containing peroxiredoxin PrxU Peptoclostridium acidaminophilum
Q17172 8.87e-08 52 27 6 145 2 tsa-2 Peroxiredoxin 2 Brugia malayi
Q9Z0V5 1.43e-07 52 27 4 128 2 Prdx4 Peroxiredoxin-4 Rattus norvegicus
O08807 1.47e-07 52 27 4 128 1 Prdx4 Peroxiredoxin-4 Mus musculus
Q13162 1.58e-07 52 26 5 134 1 PRDX4 Peroxiredoxin-4 Homo sapiens
P52570 1.6e-07 52 23 2 148 2 TSA 1-Cys peroxiredoxin Onchocerca volvulus
Q8R844 2.1e-07 51 23 3 138 3 TTE2186 Peroxiredoxin 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9VEJ0 2.18e-07 52 25 4 142 1 Prx3 Thioredoxin-dependent peroxide reductase, mitochondrial Drosophila melanogaster
Q92BC5 2.35e-07 50 30 4 130 3 tpx Thiol peroxidase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q90384 2.41e-07 51 24 5 143 2 None Peroxiredoxin Cynops pyrrhogaster
P23161 3.09e-07 50 23 4 142 3 None Putative peroxiredoxin in rubredoxin operon Clostridium pasteurianum
P80239 3.2e-07 50 27 4 130 1 ahpC Alkyl hydroperoxide reductase C Bacillus subtilis (strain 168)
Q71Z84 3.92e-07 50 30 4 130 3 tpx Thiol peroxidase Listeria monocytogenes serotype 4b (strain F2365)
A8A9P0 4.14e-07 51 26 4 138 3 Igni_0459 Peroxiredoxin Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Q555L5 4.51e-07 51 29 5 125 1 prdx4 Peroxiredoxin-4 Dictyostelium discoideum
Q8Y6U8 4.81e-07 50 30 4 130 3 tpx Thiol peroxidase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P57279 5.37e-07 50 26 5 138 3 BU182 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P95895 6.43e-07 50 22 3 136 3 SSO2121 Peroxiredoxin Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A5F3A2 7.28e-07 49 27 5 133 3 tpx Thiol peroxidase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9V3P0 8.71e-07 49 29 4 117 1 Prx2 Peroxiredoxin 2 Drosophila melanogaster
P19476 9.71e-07 50 27 5 141 1 None Putative peroxiredoxin Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
O58966 1.04e-06 49 24 5 138 1 ahpC Peroxiredoxin Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9UZV4 1.15e-06 49 26 6 138 3 PYRAB10420 Peroxiredoxin Pyrococcus abyssi (strain GE5 / Orsay)
Q8RCY5 1.19e-06 49 25 3 135 3 TTE0270 Peroxiredoxin 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q91191 1.33e-06 49 24 3 145 2 None Peroxiredoxin Oncorhynchus mykiss
Q73RS4 1.74e-06 49 26 5 136 3 TDE_0011 Peroxiredoxin Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P34760 1.83e-06 48 26 3 123 1 TSA1 Peroxiredoxin TSA1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8DUK3 2.28e-06 48 28 4 135 3 tpx Thiol peroxidase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8PYP6 3.5e-06 48 25 4 142 3 MM_0814 Peroxiredoxin Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
K0J4Q8 3.51e-06 48 26 2 117 1 ahpC Alkyl hydroperoxide reductase C Amphibacillus xylanus (strain ATCC 51415 / DSM 6626 / JCM 7361 / LMG 17667 / NBRC 15112 / Ep01)
Q04120 3.98e-06 48 26 4 140 1 TSA2 Peroxiredoxin TSA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5JF30 4.3e-06 48 23 5 138 1 TK0537 Peroxiredoxin Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8U218 4.51e-06 48 26 6 138 3 PF1033 Peroxiredoxin Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8K9W0 4.56e-06 47 25 5 144 3 BUsg_176 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O17433 4.59e-06 48 26 2 119 1 None 1-Cys peroxiredoxin Dirofilaria immitis
Q6L240 5.44e-06 47 24 3 141 3 PTO0377 Peroxiredoxin 1 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q9KCJ4 5.66e-06 47 26 2 102 3 resA Thiol-disulfide oxidoreductase ResA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q65HX8 6.08e-06 47 26 3 133 3 resA Thiol-disulfide oxidoreductase ResA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P0A4M6 7.74e-06 46 29 4 134 3 tpx Thiol peroxidase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0C2J8 7.74e-06 46 29 4 134 1 tpx Thiol peroxidase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JB8 7.74e-06 46 29 4 134 3 tpx Thiol peroxidase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q26695 7.87e-06 47 23 4 135 2 None Thioredoxin peroxidase Trypanosoma brucei rhodesiense
Q96XS5 8.26e-06 47 22 3 135 3 STK_24420 Peroxiredoxin 2 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q74NC6 8.47e-06 47 25 4 134 3 NEQ191 Peroxiredoxin Nanoarchaeum equitans (strain Kin4-M)
Q54SE2 9.08e-06 47 28 1 110 3 DDB_G0282517 1-Cys peroxiredoxin Dictyostelium discoideum
Q49YE4 1.1e-05 46 28 4 128 3 tpx Thiol peroxidase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0C6P9 1.12e-05 46 27 5 133 3 tpx Thiol peroxidase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O31820 1.46e-05 46 30 6 142 3 yneN Thioredoxin-like protein YneN Bacillus subtilis (strain 168)
Q8XVP0 1.48e-05 46 32 3 101 3 tpx Thiol peroxidase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6UPH7 1.78e-05 46 25 5 139 3 Mevan_0492 Peroxiredoxin Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q55060 1.96e-05 46 29 4 109 3 None Peroxiredoxin 1 Sulfuracidifex metallicus
Q73B22 2.02e-05 45 24 4 134 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6HL81 2.17e-05 45 24 4 134 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q8EPB7 3.59e-05 45 25 4 152 3 tpx Thiol peroxidase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P35160 3.83e-05 45 24 3 133 1 resA Thiol-disulfide oxidoreductase ResA Bacillus subtilis (strain 168)
Q57109 4.32e-05 45 22 4 136 3 MTBMA_c06100 Peroxiredoxin Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
A4FWZ9 4.35e-05 45 24 5 139 3 MmarC5_0413 Peroxiredoxin Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
P31308 4.56e-05 44 25 5 150 1 tpx Thiol peroxidase Streptococcus sanguinis
P42366 4.65e-05 44 25 5 150 3 tpx Thiol peroxidase Streptococcus gordonii
P26830 5.16e-05 44 27 4 125 3 None Alkyl hydroperoxide reductase C (Fragment) Ferdinandcohnia aciditolerans (strain JCM 32973 / CCTCC AB 2017280 / YN-1)
Q9Y7F0 5.29e-05 44 26 5 139 2 TSA1 Peroxiredoxin TSA1-A Candida albicans (strain SC5314 / ATCC MYA-2876)
P0CU34 5.29e-05 44 26 5 139 2 TSA1B Peroxiredoxin TSA1-B Candida albicans (strain SC5314 / ATCC MYA-2876)
Q6LY19 5.71e-05 45 23 5 139 3 MMP1174 Peroxiredoxin Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P57668 6.55e-05 44 35 1 81 3 tpx Thiol peroxidase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A0B6 8.21e-05 44 23 3 121 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MW2)
Q6GC91 8.21e-05 44 23 3 121 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MSSA476)
Q6GJR7 8.21e-05 44 23 3 121 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MRSA252)
P99074 8.21e-05 44 23 3 121 1 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain N315)
P0A0B5 8.21e-05 44 23 3 121 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIR5 8.21e-05 44 23 3 121 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain COL)
Q2YVK2 8.21e-05 44 23 3 121 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain bovine RF122 / ET3-1)
P0A0B7 8.21e-05 44 23 3 121 1 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJN4 8.21e-05 44 23 3 121 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain USA300)
Q9K813 0.000105 43 26 3 145 3 tpx Thiol peroxidase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O26262 0.00012 43 21 3 136 3 MTH_159 Peroxiredoxin Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9BGI1 0.000133 43 32 3 75 2 PRDX5 Peroxiredoxin-5, mitochondrial Bos taurus
Q8CMQ2 0.000177 43 23 3 121 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRY1 0.00022 43 23 3 121 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L376 0.00025 42 23 3 121 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus haemolyticus (strain JCSC1435)
P52572 0.000278 43 23 3 113 2 PER1 1-Cys peroxiredoxin PER1 Hordeum vulgare
Q6W8Q2 0.00028 43 23 3 113 2 PER1 1-Cys peroxiredoxin PER1 Triticum aestivum
Q9GLW9 0.000323 42 33 3 71 2 PRDX5 Peroxiredoxin-5, mitochondrial Papio hamadryas
Q9GLW7 0.000326 42 33 3 71 2 PRDX5 Peroxiredoxin-5, mitochondrial Chlorocebus aethiops
P80864 0.00033 42 24 3 143 1 tpx Thiol peroxidase Bacillus subtilis (strain 168)
O34564 0.000332 42 24 3 114 3 ykuU Putative peroxiredoxin YkuU Bacillus subtilis (strain 168)
Q9HKX0 0.000342 42 20 3 140 3 Ta0473 Peroxiredoxin 1 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
P0A865 0.000353 42 27 4 155 3 tpx Thiol peroxidase Shigella flexneri
P0A866 0.000353 42 27 4 155 3 tpx Thiol peroxidase Shigella dysenteriae
P0A862 0.000353 42 27 4 155 1 tpx Thiol peroxidase Escherichia coli (strain K12)
P0A863 0.000353 42 27 4 155 3 tpx Thiol peroxidase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A864 0.000353 42 27 4 155 3 tpx Thiol peroxidase Escherichia coli O157:H7
P9WQB7 0.000502 42 25 3 111 1 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQB6 0.000502 42 25 3 111 3 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q49UT8 0.000507 42 24 4 128 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P57880 0.000629 41 27 4 133 3 tpx Thiol peroxidase Pasteurella multocida (strain Pm70)
Q8NRG3 0.000668 41 26 4 132 3 tpx Thiol peroxidase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P0C5D1 0.000669 42 26 3 113 1 Os07g0638400 1-Cys peroxiredoxin B Oryza sativa subsp. japonica

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07630
Feature type CDS
Gene bcp
Product thioredoxin-dependent thiol peroxidase
Location 1663820 - 1664290 (strand: 1)
Length 471 (nucleotides) / 156 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1874
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00578 AhpC/TSA family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1225 Posttranslational modification, protein turnover, chaperones (O) O Peroxiredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03564 thioredoxin-dependent peroxiredoxin [EC:1.11.1.24] - -

Protein Sequence

MNPLKAGDKAPQFSLPDQDGEIINLSDFAGQRVLVYFYPKAMTPGCTTQACGLRDEMDTLKKANVEVLGISTDKSEKLSRFAEKEMLNFTLLSDEDHKVAEQFGIWGEKQFMGKTYDGIHRTTFLIDKNGVIEHVFDNFKTSNHHQVVIDYLAAHP

Flanking regions ( +/- flanking 50bp)

TATCGTAAATAGTCTGATGATGAAACAATAAAAGAATGGAGAATTAGGTAATGAACCCATTAAAAGCCGGTGATAAGGCACCTCAATTCAGTCTGCCTGATCAAGATGGAGAAATCATTAATCTGTCTGATTTTGCTGGCCAACGTGTGCTCGTTTATTTTTATCCAAAAGCGATGACACCAGGCTGTACAACGCAAGCTTGTGGCTTACGTGATGAGATGGATACACTAAAAAAAGCCAACGTCGAGGTATTGGGAATTAGTACTGATAAGTCAGAAAAACTTTCCCGTTTTGCCGAAAAAGAGATGTTAAACTTCACCTTACTTTCTGATGAAGATCATAAAGTTGCAGAGCAATTTGGCATTTGGGGTGAAAAACAATTTATGGGGAAAACTTACGATGGTATTCATCGTACGACGTTCCTAATTGATAAAAACGGTGTGATTGAACATGTGTTTGATAATTTTAAAACCAGCAATCACCACCAAGTGGTTATCGATTATTTAGCTGCACACCCATAGTTTATGATCACAGCTTAGTGCTGATAAATAAAACAGACAGCCATTAACTA