Homologs in group_1874

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13610 FBDBKF_13610 92.9 Morganella morganii S1 bcp thioredoxin-dependent thiol peroxidase
EHELCC_08485 EHELCC_08485 92.9 Morganella morganii S2 bcp thioredoxin-dependent thiol peroxidase
NLDBIP_08810 NLDBIP_08810 92.9 Morganella morganii S4 bcp thioredoxin-dependent thiol peroxidase
LHKJJB_05455 LHKJJB_05455 92.9 Morganella morganii S3 bcp thioredoxin-dependent thiol peroxidase
HKOGLL_05460 HKOGLL_05460 92.9 Morganella morganii S5 bcp thioredoxin-dependent thiol peroxidase
PMI_RS07630 PMI_RS07630 78.8 Proteus mirabilis HI4320 bcp thioredoxin-dependent thiol peroxidase

Distribution of the homologs in the orthogroup group_1874

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1874

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE55 8.52e-92 266 79 0 156 3 bcp Putative peroxiredoxin bcp Shigella flexneri
P0AE52 8.52e-92 266 79 0 156 1 bcp Peroxiredoxin Bcp Escherichia coli (strain K12)
P0AE53 8.52e-92 266 79 0 156 3 bcp Putative peroxiredoxin bcp Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE54 8.52e-92 266 79 0 156 3 bcp Putative peroxiredoxin bcp Escherichia coli O157:H7
P44411 4.31e-70 211 61 0 154 3 bcp Putative peroxiredoxin bcp Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9ZHF0 1.05e-62 192 58 0 155 3 bcp Putative peroxiredoxin bcp Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P9WIE1 1.95e-49 159 53 0 141 1 bcp Putative peroxiredoxin Rv2521 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE0 1.95e-49 159 53 0 141 3 bcp Putative peroxiredoxin MT2597 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q796Y8 4.28e-39 132 41 0 153 3 ygaF Peroxiredoxin Bcp Bacillus subtilis (strain 168)
Q83CY8 4.71e-37 127 44 0 149 1 bcp Putative peroxiredoxin bcp Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q9ZMU4 1.48e-29 108 37 0 152 3 bcp Putative peroxiredoxin bcp Helicobacter pylori (strain J99 / ATCC 700824)
Q75SY5 1.65e-29 110 37 3 152 2 AFP1 Peroxiredoxin Q, chloroplastic Gentiana triflora
P55979 3.5e-29 107 37 0 152 3 bcp Putative peroxiredoxin bcp Helicobacter pylori (strain ATCC 700392 / 26695)
Q6QPJ6 7.77e-29 108 38 3 152 1 PRXQ Peroxiredoxin Q, chloroplastic Populus jackii
P0C5D5 7.57e-28 105 37 3 152 2 Os06g0196300 Peroxiredoxin Q, chloroplastic Oryza sativa subsp. japonica
P0C5D4 7.57e-28 105 37 3 152 3 OsI_22010 Putative peroxiredoxin Q, chloroplastic Oryza sativa subsp. indica
Q9LU86 1.9e-27 104 37 3 152 1 PRXQ Peroxiredoxin Q, chloroplastic Arabidopsis thaliana
Q9MB35 1.96e-27 103 38 3 152 1 PRXQ Peroxiredoxin Q, chloroplastic (Fragment) Sedum lineare
Q5S1S6 4.55e-26 101 37 3 142 2 PRX1 Peroxiredoxin Q, chloroplastic Triticum aestivum
Q6UBI3 2.03e-25 99 36 3 152 2 PRXQ Peroxiredoxin Q, chloroplastic Suaeda salsa
P9WID9 5.57e-23 91 36 5 156 1 bcpB Putative peroxiredoxin Rv1608c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WID8 5.57e-23 91 36 5 156 3 bcpB Putative peroxiredoxin MT1643 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8P9V9 7.52e-21 86 31 1 149 1 bcp Peroxiredoxin Bcp Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
O94561 7.82e-21 87 42 2 116 1 bcp1 Peroxiredoxin bcp1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P40553 1.07e-18 82 39 7 146 1 DOT5 Peroxiredoxin DOT5 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P91883 8.59e-14 68 34 4 136 2 None Thioredoxin peroxidase Fasciola hepatica
Q9NL98 8.59e-13 66 30 5 149 2 None Peroxiredoxin Ascaris suum
Q5E947 1.48e-11 62 33 4 121 2 PRDX1 Peroxiredoxin-1 Bos taurus
P9WIE3 2e-11 61 31 3 133 1 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE2 2e-11 61 31 3 133 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65689 2e-11 61 31 3 133 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A0K3AUJ9 5.93e-11 61 30 4 135 1 prdx-2 Peroxiredoxin prdx-2 Caenorhabditis elegans
P48822 1.31e-10 60 28 5 147 2 TSA1 Peroxiredoxin 1 Brugia malayi
A0A2Z5VKM8 2.24e-10 59 29 6 145 1 None 2-cysteine peroxiredoxin, chloroplastic Chattonella marina var. antiqua
Q6L140 3.93e-10 58 31 4 126 3 PTO0727 Peroxiredoxin 2 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q96291 6.34e-10 59 29 5 140 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Arabidopsis thaliana
O24364 7.38e-10 58 29 5 140 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Spinacia oleracea
Q06830 1e-09 57 32 4 121 1 PRDX1 Peroxiredoxin-1 Homo sapiens
Q63716 1.07e-09 57 32 4 121 1 Prdx1 Peroxiredoxin-1 Rattus norvegicus
Q6B4U9 1.08e-09 57 32 4 121 1 PRDX1 Peroxiredoxin-1 Myotis lucifugus
P35700 1.22e-09 57 32 4 121 1 Prdx1 Peroxiredoxin-1 Mus musculus
P80602 1.54e-09 57 28 5 139 1 TSA 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Triticum aestivum
Q96468 1.54e-09 57 28 5 139 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Hordeum vulgare
Q6ER94 1.94e-09 57 30 7 146 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Oryza sativa subsp. japonica
Q979N7 2.27e-09 57 28 4 131 3 TV1123 Peroxiredoxin Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
P0CB50 2.49e-09 57 28 5 145 1 PRDX1 Peroxiredoxin-1 Gallus gallus
Q9C5R8 2.76e-09 57 28 5 140 2 At5g06290 2-Cys peroxiredoxin BAS1-like, chloroplastic Arabidopsis thaliana
Q6DV14 4.78e-09 56 27 6 151 2 PRDX1 Peroxiredoxin-1 Gekko japonicus
Q55624 7.8e-09 55 28 4 114 3 sll0755 Putative peroxiredoxin sll0755 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q61171 1.35e-08 54 28 5 142 1 Prdx2 Peroxiredoxin-2 Mus musculus
Q8T6C4 1.57e-08 54 29 3 115 2 TPX Thioredoxin peroxidase Echinococcus granulosus
P35704 1.6e-08 54 28 5 142 1 Prdx2 Peroxiredoxin-2 Rattus norvegicus
P51272 2.36e-08 54 28 2 112 3 ycf42 Putative peroxiredoxin ycf42 Porphyra purpurea
Q9JKY1 2.58e-08 53 30 4 121 1 PRDX1 Peroxiredoxin-1 Cricetulus griseus
Q9BGI3 7.18e-08 52 27 5 144 2 PRDX2 Peroxiredoxin-2 Bos taurus
Q92BC5 1.16e-07 51 29 4 141 3 tpx Thiol peroxidase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q58146 1.16e-07 52 26 6 141 3 MJ0736 Peroxiredoxin Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9KCJ4 1.19e-07 52 28 2 101 3 resA Thiol-disulfide oxidoreductase ResA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9HJL3 1.21e-07 52 29 4 122 3 Ta0954 Peroxiredoxin 2 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q8K3U7 1.35e-07 52 27 5 143 2 PRDX2 Peroxiredoxin-2 Cricetulus griseus
Q21824 1.4e-07 52 26 5 150 3 prdx-3 Probable peroxiredoxin prdx-3 Caenorhabditis elegans
Q17172 1.44e-07 52 28 5 128 2 tsa-2 Peroxiredoxin 2 Brugia malayi
A4IQF5 1.46e-07 51 24 3 153 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus thermodenitrificans (strain NG80-2)
Q71Z84 1.77e-07 51 29 4 141 3 tpx Thiol peroxidase Listeria monocytogenes serotype 4b (strain F2365)
Q8Y6U8 2.28e-07 50 29 4 141 3 tpx Thiol peroxidase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q26695 2.55e-07 51 26 4 126 2 None Thioredoxin peroxidase Trypanosoma brucei rhodesiense
O67024 2.95e-07 51 28 6 162 1 aq_858 Peroxiredoxin Aquifex aeolicus (strain VF5)
Q2PFZ3 3.12e-07 51 27 5 143 2 PRDX2 Peroxiredoxin-2 Macaca fascicularis
P32119 3.12e-07 51 27 5 143 1 PRDX2 Peroxiredoxin-2 Homo sapiens
Q1XDL4 3.67e-07 50 27 5 144 3 ycf42 Putative peroxiredoxin ycf42 Neopyropia yezoensis
Q8DUK3 5.36e-07 50 28 4 135 3 tpx Thiol peroxidase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5RC63 7.09e-07 49 27 5 143 2 PRDX2 Peroxiredoxin-2 Pongo abelii
A8A9P0 7.13e-07 50 26 4 138 3 Igni_0459 Peroxiredoxin Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
P23161 8.1e-07 49 23 2 112 3 None Putative peroxiredoxin in rubredoxin operon Clostridium pasteurianum
Q9BGI2 8.75e-07 50 25 4 125 2 PRDX4 Peroxiredoxin-4 Bos taurus
P52570 1.1e-06 50 23 2 149 2 TSA 1-Cys peroxiredoxin Onchocerca volvulus
Q9Z0V5 1.28e-06 50 26 4 127 2 Prdx4 Peroxiredoxin-4 Rattus norvegicus
O08807 1.33e-06 50 26 4 127 1 Prdx4 Peroxiredoxin-4 Mus musculus
Q90384 1.58e-06 49 25 5 140 2 None Peroxiredoxin Cynops pyrrhogaster
Q5KXL9 2.06e-06 48 24 3 153 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus kaustophilus (strain HTA426)
Q8XVP0 2.17e-06 48 34 3 101 3 tpx Thiol peroxidase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
O34564 2.25e-06 48 24 5 147 3 ykuU Putative peroxiredoxin YkuU Bacillus subtilis (strain 168)
A2BJD9 2.76e-06 48 30 5 113 3 Hbut_0228 Peroxiredoxin Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
A5IIX7 3.54e-06 48 25 2 105 3 Tpet_0121 Peroxiredoxin Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
P19476 4e-06 48 26 4 141 1 None Putative peroxiredoxin Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q9V3P0 4.49e-06 47 28 2 99 1 Prx2 Peroxiredoxin 2 Drosophila melanogaster
Q9L3Q5 5.05e-06 47 26 5 141 1 prxU Selenocysteine-containing peroxiredoxin PrxU Peptoclostridium acidaminophilum
Q555L5 5.09e-06 48 28 6 138 1 prdx4 Peroxiredoxin-4 Dictyostelium discoideum
Q8PYP6 5.61e-06 47 25 4 142 3 MM_0814 Peroxiredoxin Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9Z0V6 5.62e-06 48 25 5 139 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Rattus norvegicus
P0A865 6.78e-06 47 35 3 103 3 tpx Thiol peroxidase Shigella flexneri
P0A866 6.78e-06 47 35 3 103 3 tpx Thiol peroxidase Shigella dysenteriae
P0A862 6.78e-06 47 35 3 103 1 tpx Thiol peroxidase Escherichia coli (strain K12)
P0A863 6.78e-06 47 35 3 103 3 tpx Thiol peroxidase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A864 6.78e-06 47 35 3 103 3 tpx Thiol peroxidase Escherichia coli O157:H7
Q13162 7.07e-06 47 26 5 131 1 PRDX4 Peroxiredoxin-4 Homo sapiens
Q8NW51 9.88e-06 46 30 5 133 3 tpx Thiol peroxidase Staphylococcus aureus (strain MW2)
Q6G8L4 9.88e-06 46 30 5 133 3 tpx Thiol peroxidase Staphylococcus aureus (strain MSSA476)
Q5HF61 9.88e-06 46 30 5 133 3 tpx Thiol peroxidase Staphylococcus aureus (strain COL)
O74887 1.04e-05 46 27 4 142 1 tpx1 Peroxiredoxin tpx1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P99146 1.35e-05 46 29 5 140 1 tpx Thiol peroxidase Staphylococcus aureus (strain N315)
P66954 1.35e-05 46 29 5 140 3 tpx Thiol peroxidase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q74NC6 1.37e-05 46 26 4 134 3 NEQ191 Peroxiredoxin Nanoarchaeum equitans (strain Kin4-M)
Q91191 1.45e-05 46 32 1 71 2 None Peroxiredoxin Oncorhynchus mykiss
Q6GFZ4 1.49e-05 45 29 5 138 3 tpx Thiol peroxidase Staphylococcus aureus (strain MRSA252)
P20108 1.52e-05 46 25 5 139 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Mus musculus
Q9WZR4 1.64e-05 46 23 2 105 3 TM_0807 Peroxiredoxin Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P0A4M6 1.75e-05 45 29 4 134 3 tpx Thiol peroxidase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0C2J8 1.75e-05 45 29 4 134 1 tpx Thiol peroxidase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JB8 1.75e-05 45 29 4 134 3 tpx Thiol peroxidase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P57668 1.85e-05 45 33 4 107 3 tpx Thiol peroxidase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O29969 2.04e-05 46 25 3 111 3 AF_0270 Peroxiredoxin Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A3DKL1 2.1e-05 46 29 4 106 3 Smar_0058 Peroxiredoxin Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
A0R1V9 4.76e-05 45 22 4 155 1 MSMEG_4891 Alkyl hydroperoxide reductase C Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8ZP65 5.88e-05 44 33 3 103 3 tpx Thiol peroxidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P35705 6.41e-05 45 26 4 123 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Bos taurus
Q8Z7A8 6.57e-05 44 33 3 103 3 tpx Thiol peroxidase Salmonella typhi
P34760 6.9e-05 44 27 5 137 1 TSA1 Peroxiredoxin TSA1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O58966 7.04e-05 44 24 3 108 1 ahpC Peroxiredoxin Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8ZE42 9.13e-05 43 31 2 101 3 tpx Thiol peroxidase Yersinia pestis
P54178 9.72e-05 43 26 6 167 1 ypmQ SCO1 protein homolog Bacillus subtilis (strain 168)
P57279 9.91e-05 43 25 5 138 3 BU182 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P31307 0.000102 43 27 4 136 3 tpx Thiol peroxidase Streptococcus parasanguinis
Q04120 0.000111 43 28 5 139 1 TSA2 Peroxiredoxin TSA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9UZV4 0.000117 43 25 4 108 3 PYRAB10420 Peroxiredoxin Pyrococcus abyssi (strain GE5 / Orsay)
Q5JF30 0.000126 43 25 3 108 1 TK0537 Peroxiredoxin Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P9WQB7 0.000127 43 23 4 155 1 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQB6 0.000127 43 23 4 155 3 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8FQH8 0.000133 43 28 5 139 3 tpx Thiol peroxidase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P49537 0.000139 43 25 4 120 3 ycf42 Putative peroxiredoxin ycf42 Trieres chinensis
Q9VEJ0 0.00022 43 23 5 146 1 Prx3 Thioredoxin-dependent peroxide reductase, mitochondrial Drosophila melanogaster
P0C6P9 0.000242 42 27 2 86 3 tpx Thiol peroxidase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q65HX8 0.000261 42 25 4 148 3 resA Thiol-disulfide oxidoreductase ResA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q89AS1 0.000295 42 24 3 113 3 bbp_171 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q49YE4 0.00034 42 32 2 94 3 tpx Thiol peroxidase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6L240 0.000361 42 24 2 110 3 PTO0377 Peroxiredoxin 1 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
O17433 0.00043 42 22 2 147 1 None 1-Cys peroxiredoxin Dirofilaria immitis
Q8R844 0.000431 42 24 2 105 3 TTE2186 Peroxiredoxin 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q5R7E0 0.00049 42 25 3 138 2 PRDX6 Peroxiredoxin-6 Pongo abelii
Q96XS5 0.000492 42 26 4 106 3 STK_24420 Peroxiredoxin 2 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q4L754 0.000526 41 29 4 133 3 tpx Thiol peroxidase Staphylococcus haemolyticus (strain JCSC1435)
A5F3A2 0.000611 41 26 2 86 3 tpx Thiol peroxidase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8U218 0.000651 42 25 4 108 3 PF1033 Peroxiredoxin Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8RCY5 0.000735 41 24 1 105 3 TTE0270 Peroxiredoxin 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9Y7F0 0.00074 41 26 6 145 2 TSA1 Peroxiredoxin TSA1-A Candida albicans (strain SC5314 / ATCC MYA-2876)
P0CU34 0.00074 41 26 6 145 2 TSA1B Peroxiredoxin TSA1-B Candida albicans (strain SC5314 / ATCC MYA-2876)
P35160 0.00084 41 23 4 150 1 resA Thiol-disulfide oxidoreductase ResA Bacillus subtilis (strain 168)
Q6LY19 0.000874 41 23 6 141 3 MMP1174 Peroxiredoxin Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q8EPB7 0.001 40 27 5 151 3 tpx Thiol peroxidase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03155
Feature type CDS
Gene bcp
Product thioredoxin-dependent thiol peroxidase
Location 673850 - 674320 (strand: -1)
Length 471 (nucleotides) / 156 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1874
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00578 AhpC/TSA family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1225 Posttranslational modification, protein turnover, chaperones (O) O Peroxiredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03564 thioredoxin-dependent peroxiredoxin [EC:1.11.1.24] - -

Protein Sequence

MSPLNAGDKAPQFSLPDQDGESISLADYHGQRVLVYFYPKAMTPGCTVQACGLRDNMDDLKQFNVEVLGISTDKPEKLSRFAEKELLNFTLLSDENHEVAQAFGVWGEKQFMGKTYDGIHRISFLIGTDGKIEHVFDKFKTSDHEQVVLDYLKSRS

Flanking regions ( +/- flanking 50bp)

GATAAGTCATTAATTCTTATATTTATAATTACGTTTACGGAGAGTATGTAATGAGCCCATTGAACGCCGGTGATAAGGCGCCACAATTCAGCCTTCCTGACCAAGATGGTGAGTCAATCAGTCTTGCTGATTATCACGGTCAGCGTGTACTGGTTTATTTTTATCCTAAAGCCATGACACCGGGCTGTACCGTCCAGGCGTGTGGTCTGCGCGATAACATGGATGACCTGAAACAGTTCAACGTTGAAGTACTGGGGATCAGTACAGACAAACCTGAGAAGTTGTCCCGGTTTGCTGAAAAAGAGCTGCTGAATTTCACTTTGCTGTCAGATGAAAACCACGAAGTCGCACAAGCATTCGGCGTCTGGGGCGAGAAGCAGTTTATGGGGAAAACCTATGATGGTATCCACCGTATCAGCTTCCTAATTGGTACTGACGGAAAAATAGAACATGTGTTTGATAAATTTAAAACCAGTGATCACGAACAGGTTGTACTCGATTACCTGAAATCACGCAGTTAATTTATTCGCCAGAATTATAAAAACACTATCCCCGGATAGTGTTTTTTATA