Homologs in group_1836

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13610 FBDBKF_13610 100.0 Morganella morganii S1 bcp thioredoxin-dependent thiol peroxidase
EHELCC_08485 EHELCC_08485 100.0 Morganella morganii S2 bcp thioredoxin-dependent thiol peroxidase
NLDBIP_08810 NLDBIP_08810 100.0 Morganella morganii S4 bcp thioredoxin-dependent thiol peroxidase
LHKJJB_05455 LHKJJB_05455 100.0 Morganella morganii S3 bcp thioredoxin-dependent thiol peroxidase
F4V73_RS03155 F4V73_RS03155 92.9 Morganella psychrotolerans bcp thioredoxin-dependent thiol peroxidase
PMI_RS07630 PMI_RS07630 80.8 Proteus mirabilis HI4320 bcp thioredoxin-dependent thiol peroxidase

Distribution of the homologs in the orthogroup group_1836

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1836

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE55 7.62e-94 271 82 0 156 3 bcp Putative peroxiredoxin bcp Shigella flexneri
P0AE52 7.62e-94 271 82 0 156 1 bcp Peroxiredoxin Bcp Escherichia coli (strain K12)
P0AE53 7.62e-94 271 82 0 156 3 bcp Putative peroxiredoxin bcp Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE54 7.62e-94 271 82 0 156 3 bcp Putative peroxiredoxin bcp Escherichia coli O157:H7
P44411 3.95e-70 211 61 0 154 3 bcp Putative peroxiredoxin bcp Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9ZHF0 6.58e-62 190 57 0 154 3 bcp Putative peroxiredoxin bcp Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P9WIE1 5.5e-48 155 52 0 141 1 bcp Putative peroxiredoxin Rv2521 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE0 5.5e-48 155 52 0 141 3 bcp Putative peroxiredoxin MT2597 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q83CY8 2.32e-39 133 47 0 141 1 bcp Putative peroxiredoxin bcp Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q796Y8 4.57e-39 132 42 0 153 3 ygaF Peroxiredoxin Bcp Bacillus subtilis (strain 168)
Q9ZMU4 5.9e-30 109 38 0 152 3 bcp Putative peroxiredoxin bcp Helicobacter pylori (strain J99 / ATCC 700824)
P55979 1.69e-29 108 38 0 152 3 bcp Putative peroxiredoxin bcp Helicobacter pylori (strain ATCC 700392 / 26695)
Q6QPJ6 3.24e-28 106 37 3 152 1 PRXQ Peroxiredoxin Q, chloroplastic Populus jackii
Q75SY5 4.42e-28 106 36 3 152 2 AFP1 Peroxiredoxin Q, chloroplastic Gentiana triflora
Q9LU86 1.84e-27 104 38 3 152 1 PRXQ Peroxiredoxin Q, chloroplastic Arabidopsis thaliana
Q9MB35 6.27e-27 102 37 3 152 1 PRXQ Peroxiredoxin Q, chloroplastic (Fragment) Sedum lineare
P0C5D5 8.92e-27 103 36 3 152 2 Os06g0196300 Peroxiredoxin Q, chloroplastic Oryza sativa subsp. japonica
P0C5D4 8.92e-27 103 36 3 152 3 OsI_22010 Putative peroxiredoxin Q, chloroplastic Oryza sativa subsp. indica
Q5S1S6 2.86e-25 99 35 3 151 2 PRX1 Peroxiredoxin Q, chloroplastic Triticum aestivum
Q6UBI3 4.57e-25 98 35 3 152 2 PRXQ Peroxiredoxin Q, chloroplastic Suaeda salsa
Q8P9V9 8.71e-25 96 35 1 149 1 bcp Peroxiredoxin Bcp Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P9WID9 1.65e-22 90 37 5 156 1 bcpB Putative peroxiredoxin Rv1608c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WID8 1.65e-22 90 37 5 156 3 bcpB Putative peroxiredoxin MT1643 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O94561 1.06e-19 84 41 2 116 1 bcp1 Peroxiredoxin bcp1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P40553 1.76e-18 81 41 7 141 1 DOT5 Peroxiredoxin DOT5 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P91883 4.97e-13 66 33 4 136 2 None Thioredoxin peroxidase Fasciola hepatica
Q9NL98 2.48e-11 62 30 5 149 2 None Peroxiredoxin Ascaris suum
P9WIE3 4e-11 60 32 3 133 1 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE2 4e-11 60 32 3 133 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65689 4e-11 60 32 3 133 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5E947 1.83e-10 60 33 4 121 2 PRDX1 Peroxiredoxin-1 Bos taurus
Q96291 4.7e-10 59 30 5 140 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Arabidopsis thaliana
O24364 5.42e-10 59 30 5 140 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Spinacia oleracea
Q96468 1.17e-09 57 29 5 139 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Hordeum vulgare
P80602 1.18e-09 57 29 5 139 1 TSA 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Triticum aestivum
A0A2Z5VKM8 1.48e-09 57 29 6 145 1 None 2-cysteine peroxiredoxin, chloroplastic Chattonella marina var. antiqua
P48822 1.97e-09 57 28 5 147 2 TSA1 Peroxiredoxin 1 Brugia malayi
Q6ER94 2.02e-09 57 30 7 146 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Oryza sativa subsp. japonica
Q9C5R8 2.05e-09 57 29 5 140 2 At5g06290 2-Cys peroxiredoxin BAS1-like, chloroplastic Arabidopsis thaliana
Q63716 2.2e-09 57 32 4 121 1 Prdx1 Peroxiredoxin-1 Rattus norvegicus
Q06830 2.96e-09 56 32 4 121 1 PRDX1 Peroxiredoxin-1 Homo sapiens
Q6B4U9 3.05e-09 56 32 4 121 1 PRDX1 Peroxiredoxin-1 Myotis lucifugus
P0CB50 3.45e-09 56 28 5 145 1 PRDX1 Peroxiredoxin-1 Gallus gallus
P35700 3.59e-09 56 32 4 121 1 Prdx1 Peroxiredoxin-1 Mus musculus
Q6DV14 3.98e-09 56 28 6 151 2 PRDX1 Peroxiredoxin-1 Gekko japonicus
A0A0K3AUJ9 7.58e-09 55 29 4 135 1 prdx-2 Peroxiredoxin prdx-2 Caenorhabditis elegans
Q92BC5 1.08e-08 54 31 4 141 3 tpx Thiol peroxidase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q71Z84 1.75e-08 53 31 4 141 3 tpx Thiol peroxidase Listeria monocytogenes serotype 4b (strain F2365)
Q8Y6U8 1.94e-08 53 31 4 141 3 tpx Thiol peroxidase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8NW51 5.25e-08 52 34 5 131 3 tpx Thiol peroxidase Staphylococcus aureus (strain MW2)
Q6G8L4 5.25e-08 52 34 5 131 3 tpx Thiol peroxidase Staphylococcus aureus (strain MSSA476)
Q5HF61 5.25e-08 52 34 5 131 3 tpx Thiol peroxidase Staphylococcus aureus (strain COL)
Q9JKY1 1.14e-07 52 30 4 121 1 PRDX1 Peroxiredoxin-1 Cricetulus griseus
Q6GFZ4 1.17e-07 51 32 5 138 3 tpx Thiol peroxidase Staphylococcus aureus (strain MRSA252)
Q8DUK3 1.28e-07 51 31 4 135 3 tpx Thiol peroxidase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P52570 1.32e-07 52 24 2 149 2 TSA 1-Cys peroxiredoxin Onchocerca volvulus
Q8XVP0 1.65e-07 51 35 3 101 3 tpx Thiol peroxidase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q979N7 1.74e-07 52 27 4 131 3 TV1123 Peroxiredoxin Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q8T6C4 1.76e-07 51 29 3 115 2 TPX Thioredoxin peroxidase Echinococcus granulosus
Q9BGI3 2.69e-07 51 28 5 144 2 PRDX2 Peroxiredoxin-2 Bos taurus
Q9KCJ4 2.72e-07 50 29 2 102 3 resA Thiol-disulfide oxidoreductase ResA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8K3U7 2.8e-07 51 27 5 143 2 PRDX2 Peroxiredoxin-2 Cricetulus griseus
Q61171 2.94e-07 51 28 5 142 1 Prdx2 Peroxiredoxin-2 Mus musculus
Q6L140 3.35e-07 50 29 4 126 3 PTO0727 Peroxiredoxin 2 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q21824 3.45e-07 51 26 5 148 3 prdx-3 Probable peroxiredoxin prdx-3 Caenorhabditis elegans
P35704 3.56e-07 50 28 5 142 1 Prdx2 Peroxiredoxin-2 Rattus norvegicus
Q55624 3.78e-07 50 28 4 114 3 sll0755 Putative peroxiredoxin sll0755 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P99146 4.07e-07 50 31 5 138 1 tpx Thiol peroxidase Staphylococcus aureus (strain N315)
P66954 4.07e-07 50 31 5 138 3 tpx Thiol peroxidase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q26695 4.76e-07 50 26 4 126 2 None Thioredoxin peroxidase Trypanosoma brucei rhodesiense
A4IQF5 5.69e-07 50 26 3 149 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus thermodenitrificans (strain NG80-2)
Q17172 6.76e-07 50 28 5 128 2 tsa-2 Peroxiredoxin 2 Brugia malayi
Q58146 1.74e-06 49 27 5 134 3 MJ0736 Peroxiredoxin Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P51272 2.51e-06 48 32 1 73 3 ycf42 Putative peroxiredoxin ycf42 Porphyra purpurea
Q2PFZ3 2.91e-06 48 27 5 143 2 PRDX2 Peroxiredoxin-2 Macaca fascicularis
P32119 2.91e-06 48 27 5 143 1 PRDX2 Peroxiredoxin-2 Homo sapiens
Q9BGI2 5.39e-06 48 25 4 125 2 PRDX4 Peroxiredoxin-4 Bos taurus
Q5RC63 6.79e-06 47 27 5 143 2 PRDX2 Peroxiredoxin-2 Pongo abelii
Q9HJL3 7.64e-06 47 28 4 122 3 Ta0954 Peroxiredoxin 2 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q1XDL4 8.95e-06 47 25 4 142 3 ycf42 Putative peroxiredoxin ycf42 Neopyropia yezoensis
Q9Z0V5 9.14e-06 47 26 4 127 2 Prdx4 Peroxiredoxin-4 Rattus norvegicus
Q5KXL9 9.15e-06 46 25 3 149 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus kaustophilus (strain HTA426)
Q9V3P0 9.39e-06 47 29 2 99 1 Prx2 Peroxiredoxin 2 Drosophila melanogaster
O08807 9.43e-06 47 26 4 127 1 Prdx4 Peroxiredoxin-4 Mus musculus
O67024 9.43e-06 47 28 3 107 1 aq_858 Peroxiredoxin Aquifex aeolicus (strain VF5)
P19476 9.82e-06 47 27 4 135 1 None Putative peroxiredoxin Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q9L3Q5 1.17e-05 46 27 5 141 1 prxU Selenocysteine-containing peroxiredoxin PrxU Peptoclostridium acidaminophilum
P31307 1.2e-05 46 29 4 136 3 tpx Thiol peroxidase Streptococcus parasanguinis
P54178 1.2e-05 46 26 4 149 1 ypmQ SCO1 protein homolog Bacillus subtilis (strain 168)
P57668 1.29e-05 46 33 4 107 3 tpx Thiol peroxidase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q91191 1.5e-05 46 33 1 71 2 None Peroxiredoxin Oncorhynchus mykiss
Q13162 1.51e-05 47 27 5 131 1 PRDX4 Peroxiredoxin-4 Homo sapiens
Q555L5 1.53e-05 46 29 5 124 1 prdx4 Peroxiredoxin-4 Dictyostelium discoideum
P23161 1.66e-05 46 22 4 141 3 None Putative peroxiredoxin in rubredoxin operon Clostridium pasteurianum
Q90384 1.84e-05 46 25 5 140 2 None Peroxiredoxin Cynops pyrrhogaster
Q8PYP6 2.13e-05 46 26 4 142 3 MM_0814 Peroxiredoxin Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O29969 3.4e-05 45 27 3 111 3 AF_0270 Peroxiredoxin Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A8A9P0 4.64e-05 45 25 4 138 3 Igni_0459 Peroxiredoxin Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
A5IIX7 4.79e-05 45 27 0 68 3 Tpet_0121 Peroxiredoxin Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q65HX8 6.83e-05 44 26 3 131 3 resA Thiol-disulfide oxidoreductase ResA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P0A865 7.4e-05 44 32 2 102 3 tpx Thiol peroxidase Shigella flexneri
P0A866 7.4e-05 44 32 2 102 3 tpx Thiol peroxidase Shigella dysenteriae
P0A862 7.4e-05 44 32 2 102 1 tpx Thiol peroxidase Escherichia coli (strain K12)
P0A863 7.4e-05 44 32 2 102 3 tpx Thiol peroxidase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A864 7.4e-05 44 32 2 102 3 tpx Thiol peroxidase Escherichia coli O157:H7
P49537 7.52e-05 44 25 4 120 3 ycf42 Putative peroxiredoxin ycf42 Trieres chinensis
Q8RCY5 9.21e-05 44 30 0 68 3 TTE0270 Peroxiredoxin 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P0A4M6 0.000105 43 29 4 134 3 tpx Thiol peroxidase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0C2J8 0.000105 43 29 4 134 1 tpx Thiol peroxidase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JB8 0.000105 43 29 4 134 3 tpx Thiol peroxidase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
O74887 0.000108 43 27 4 142 1 tpx1 Peroxiredoxin tpx1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q49YE4 0.000125 43 32 3 110 3 tpx Thiol peroxidase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P35705 0.000128 44 27 4 123 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Bos taurus
Q4L754 0.000163 43 33 3 110 3 tpx Thiol peroxidase Staphylococcus haemolyticus (strain JCSC1435)
P0C6P9 0.000178 43 29 3 102 3 tpx Thiol peroxidase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P57279 0.000179 43 25 4 133 3 BU182 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O34564 0.000186 43 23 5 147 3 ykuU Putative peroxiredoxin YkuU Bacillus subtilis (strain 168)
Q9WZR4 0.000201 43 25 0 68 3 TM_0807 Peroxiredoxin Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8ZP65 0.000213 42 31 2 102 3 tpx Thiol peroxidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z7A8 0.00025 42 34 2 89 3 tpx Thiol peroxidase Salmonella typhi
Q9VEJ0 0.000297 43 31 0 57 1 Prx3 Thioredoxin-dependent peroxide reductase, mitochondrial Drosophila melanogaster
Q8FQH8 0.00032 42 29 5 139 3 tpx Thiol peroxidase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8ZE42 0.000379 42 34 3 101 3 tpx Thiol peroxidase Yersinia pestis
P80864 0.000414 42 28 3 131 1 tpx Thiol peroxidase Bacillus subtilis (strain 168)
P34760 0.000428 42 27 5 137 1 TSA1 Peroxiredoxin TSA1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A5F3A2 0.000449 42 28 3 102 3 tpx Thiol peroxidase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q74NC6 0.000459 42 25 4 134 3 NEQ191 Peroxiredoxin Nanoarchaeum equitans (strain Kin4-M)
Q9K813 0.000564 41 27 4 143 3 tpx Thiol peroxidase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A3DKL1 0.000573 42 28 4 106 3 Smar_0058 Peroxiredoxin Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
P31308 0.000702 41 29 3 104 1 tpx Thiol peroxidase Streptococcus sanguinis
P42366 0.00073 41 29 3 104 3 tpx Thiol peroxidase Streptococcus gordonii
O58966 0.00076 41 25 3 108 1 ahpC Peroxiredoxin Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q04120 0.000839 41 27 4 122 1 TSA2 Peroxiredoxin TSA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P9WQB7 0.000843 41 23 3 119 1 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQB6 0.000843 41 23 3 119 3 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O17433 0.000883 41 22 2 147 1 None 1-Cys peroxiredoxin Dirofilaria immitis

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_05460
Feature type CDS
Gene bcp
Product thioredoxin-dependent thiol peroxidase
Location 159580 - 160050 (strand: -1)
Length 471 (nucleotides) / 156 (amino acids)

Contig

Accession ZDB_682
Length 259781 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1836
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00578 AhpC/TSA family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1225 Posttranslational modification, protein turnover, chaperones (O) O Peroxiredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03564 thioredoxin-dependent peroxiredoxin [EC:1.11.1.24] - -

Protein Sequence

MSPLNAGDKAPLFSLPDQDGESISLADYAGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKQFNVEVLGISTDKPEKLSRFAEKELLNFTLLSDEDHAVAEAFGVWGEKQFMGKTYDGIHRISFLIGADGKIEHVFDKFKTSDHDQVVLEYLKAHS

Flanking regions ( +/- flanking 50bp)

GATGAATCATTAATGTTTGTGTTTATTATTACGTTTACGGAGAGTGTGTAATGAGCCCATTGAACGCCGGTGATAAGGCGCCCCTGTTCAGCCTTCCCGACCAGGATGGTGAATCAATCAGCCTGGCCGATTATGCCGGTCAGCGTGTGCTGGTGTATTTTTATCCCAAAGCCATGACGCCGGGCTGTACTGTCCAGGCATGCGGTCTGCGCGACAATATGGATGAACTGAAACAGTTCAATGTTGAAGTGCTGGGGATCAGTACAGACAAACCCGAAAAACTGTCTCGTTTCGCGGAAAAAGAGTTACTGAATTTTACCCTGCTGTCAGATGAAGACCACGCGGTTGCTGAAGCATTTGGCGTCTGGGGTGAAAAACAGTTTATGGGGAAAACCTATGACGGTATTCACCGCATCAGCTTCTTAATCGGCGCTGACGGTAAAATCGAGCATGTTTTTGATAAATTCAAAACCAGCGACCATGATCAGGTTGTGCTTGAATACCTCAAAGCTCACAGCTGATTTATTTGCCGGAATGATAAAAACACTATCTCCCGGTAGTGTTTTTTATA