Homologs in group_271

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05350 FBDBKF_05350 75.8 Morganella morganii S1 wcaG Nucleoside-diphosphate-sugar epimerase
EHELCC_12240 EHELCC_12240 75.8 Morganella morganii S2 wcaG Nucleoside-diphosphate-sugar epimerase
NLDBIP_12580 NLDBIP_12580 75.8 Morganella morganii S4 wcaG Nucleoside-diphosphate-sugar epimerase
LHKJJB_12440 LHKJJB_12440 75.8 Morganella morganii S3 wcaG Nucleoside-diphosphate-sugar epimerase
HKOGLL_11055 HKOGLL_11055 75.8 Morganella morganii S5 wcaG Nucleoside-diphosphate-sugar epimerase
F4V73_RS05805 F4V73_RS05805 74.6 Morganella psychrotolerans - NAD-dependent epimerase
PMI_RS15765 PMI_RS15765 66.0 Proteus mirabilis HI4320 - NAD-dependent epimerase

Distribution of the homologs in the orthogroup group_271

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_271

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q04871 8.59e-161 455 63 1 334 3 None Uncharacterized 37.6 kDa protein in cld 5'region Escherichia coli O111:H-
P39858 4e-145 416 57 1 335 3 capI Protein CapI Staphylococcus aureus
O54067 2.83e-118 347 49 1 336 3 lspL Probable UDP-glucuronate 4-epimerase Rhizobium meliloti (strain 1021)
B9J8R3 4.57e-114 337 48 1 334 1 lpsL UDP-glucuronate 4-epimerase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q58455 1.9e-109 325 48 2 331 3 MJ1055 Uncharacterized protein MJ1055 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O81312 2.77e-100 305 45 5 336 2 GAE3 UDP-glucuronate 4-epimerase 3 Arabidopsis thaliana
Q9LPC1 3.06e-100 305 45 5 340 2 GAE2 UDP-glucuronate 4-epimerase 2 Arabidopsis thaliana
Q9M0B6 7.78e-100 303 46 5 338 1 GAE1 UDP-glucuronate 4-epimerase 1 Arabidopsis thaliana
O22141 6.89e-99 301 46 5 338 1 GAE4 UDP-glucuronate 4-epimerase 4 Arabidopsis thaliana
Q9LIS3 1.02e-90 281 44 5 338 1 GAE6 UDP-glucuronate 4-epimerase 6 Arabidopsis thaliana
Q9STI6 3.82e-89 276 44 5 338 2 GAE5 UDP-glucuronate 4-epimerase 5 Arabidopsis thaliana
F8C4X8 2.89e-81 253 40 3 326 1 TOPB45_0660 UDP-glucuronate 4-epimerase Thermodesulfobacterium geofontis (strain OPF15)
O34886 4.13e-46 162 33 8 336 3 ytcB Uncharacterized UDP-glucose epimerase YtcB Bacillus subtilis (strain 168)
Q04973 1.11e-39 145 29 7 341 3 vipB Vi polysaccharide biosynthesis protein VipB/TviC Salmonella typhi
Q7BJX9 1.05e-38 143 30 7 341 1 wbgU UDP-N-acetylglucosamine 4-epimerase Plesiomonas shigelloides
P27830 1.71e-34 132 30 8 352 1 rffG dTDP-glucose 4,6-dehydratase 2 Escherichia coli (strain K12)
A0R5C5 2.67e-33 128 30 6 338 1 MSMEG_6142 UDP-glucose 4-epimerase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P37777 1.76e-32 127 27 8 357 3 rfbB dTDP-glucose 4,6-dehydratase Shigella flexneri
Q57664 5.9e-32 124 29 9 331 3 MJ0211 Putative UDP-glucose 4-epimerase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P37759 9.61e-32 125 27 8 357 3 rfbB dTDP-glucose 4,6-dehydratase 1 Escherichia coli (strain K12)
Q8LNZ3 3.13e-31 123 27 7 341 2 UGE-1 UDP-glucose 4-epimerase 1 Oryza sativa subsp. japonica
Q43070 1.05e-30 122 28 8 342 2 GALE UDP-glucose 4-epimerase Pisum sativum
B0M3E8 1.4e-30 121 28 9 343 1 UGE1 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 Pisum sativum
P26391 1.71e-30 121 26 9 357 1 rfbB dTDP-glucose 4,6-dehydratase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6ZDJ7 2.75e-30 122 28 5 306 2 UGE-2 UDP-glucose 4-epimerase 2 Oryza sativa subsp. japonica
P0C7J0 6.98e-30 120 28 6 346 3 rfbB dTDP-glucose 4,6-dehydratase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P55293 1.69e-29 119 27 9 359 3 rfbB dTDP-glucose 4,6-dehydratase Escherichia coli
Q9FI17 2.64e-29 119 29 12 344 3 At5g44480 Putative UDP-arabinose 4-epimerase 4 Arabidopsis thaliana
B0RVL0 4.63e-29 117 28 6 346 3 rfbB dTDP-glucose 4,6-dehydratase Xanthomonas campestris pv. campestris (strain B100)
Q8LDN8 1.05e-28 116 26 7 345 1 UGE3 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 Arabidopsis thaliana
Q42605 1.1e-28 116 27 8 346 1 UGE1 Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 Arabidopsis thaliana
O06485 2.35e-28 115 24 9 340 3 yfnG Putative sugar dehydratase/epimerase YfnG Bacillus subtilis (strain 168)
P9WN67 2.44e-28 115 29 8 336 1 galE1 UDP-glucose 4-epimerase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN66 2.44e-28 115 29 8 336 3 galE1 UDP-glucose 4-epimerase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6E7F4 3.79e-28 115 26 7 362 1 rmlB dTDP-glucose 4,6-dehydratase Escherichia coli
Q9W0P5 4.2e-28 115 25 9 348 1 Gale UDP-glucose 4-epimerase Drosophila melanogaster
Q2SYH7 5.5e-28 115 25 7 364 1 wbiB dTDP-L-rhamnose 4-epimerase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q564Q1 7.23e-28 114 25 8 354 1 gale-1 UDP-glucose 4-epimerase Caenorhabditis elegans
Q6K2E1 2.07e-27 113 27 7 313 2 UGE-4 UDP-glucose 4-epimerase 4 Oryza sativa subsp. japonica
Q9SN58 2.17e-27 113 25 7 339 1 UGE5 UDP-glucose 4-epimerase 5 Arabidopsis thaliana
Q57301 4.06e-27 112 28 10 329 3 galE UDP-glucose 4-epimerase Yersinia enterocolitica
Q54WS6 5.18e-27 113 31 3 238 3 tgds dTDP-D-glucose 4,6-dehydratase Dictyostelium discoideum
Q8H930 7.52e-27 112 27 10 333 2 UEL-1 Probable UDP-arabinose 4-epimerase 1 Oryza sativa subsp. japonica
Q9SA77 7.96e-27 112 27 9 330 1 MUR4 UDP-arabinose 4-epimerase 1 Arabidopsis thaliana
Q9S642 8.99e-27 111 27 10 353 3 rfbB1 dTDP-glucose 4,6-dehydratase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
O95455 1.07e-26 111 26 8 340 1 TGDS dTDP-D-glucose 4,6-dehydratase Homo sapiens
Q9SUN3 1.25e-26 112 27 9 333 2 At4g20460 Probable UDP-arabinose 4-epimerase 3 Arabidopsis thaliana
Q9T0A7 1.5e-26 110 23 6 344 1 UGE2 UDP-glucose 4-epimerase 2 Arabidopsis thaliana
Q8VDR7 2.35e-26 110 26 8 337 2 Tgds dTDP-D-glucose 4,6-dehydratase Mus musculus
Q9SYM5 2.37e-26 113 27 9 338 1 RHM1 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 Arabidopsis thaliana
P55294 2.7e-26 110 26 9 353 3 rfbB1 dTDP-glucose 4,6-dehydratase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P55462 4.69e-26 109 27 10 349 3 NGR_a03580 Probable dTDP-glucose 4,6-dehydratase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6QLW2 5.37e-26 109 25 7 336 2 TGDS dTDP-D-glucose 4,6-dehydratase Bos taurus
O65780 6.34e-26 109 27 6 339 2 None UDP-glucose 4-epimerase GEPI42 Cyamopsis tetragonoloba
P35673 6.6e-26 108 26 7 323 3 galE UDP-glucose 4-epimerase Erwinia amylovora
Q9C7W7 1.05e-25 108 25 7 339 1 UGE4 UDP-glucose 4-epimerase 4 Arabidopsis thaliana
Q8R059 1.24e-25 108 25 8 351 1 Gale UDP-glucose 4-epimerase Mus musculus
O65781 1.34e-25 108 25 7 312 2 None UDP-glucose 4-epimerase GEPI48 Cyamopsis tetragonoloba
Q3T105 1.54e-25 108 25 8 351 2 GALE UDP-glucose 4-epimerase Bos taurus
Q5R8D0 1.61e-25 108 26 10 353 2 GALE UDP-glucose 4-epimerase Pongo abelii
P39630 1.87e-25 107 26 8 330 1 rfbB dTDP-glucose 4,6-dehydratase Bacillus subtilis (strain 168)
Q7WTB1 4.33e-25 106 26 8 335 2 galE UDP-glucose 4-epimerase Lactobacillus helveticus
O64749 5.84e-25 107 26 10 353 2 At2g34850 Putative UDP-arabinose 4-epimerase 2 Arabidopsis thaliana
P24325 7.13e-25 105 24 6 347 3 galE UDP-glucose 4-epimerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q14376 8.37e-25 105 26 10 353 1 GALE UDP-glucose 4-epimerase Homo sapiens
Q9LH76 9e-25 108 26 9 339 2 RHM3 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 Arabidopsis thaliana
P44914 1.01e-24 105 26 10 358 3 rffG dTDP-glucose 4,6-dehydratase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9HDU3 1.07e-24 108 26 9 353 3 gal10 Bifunctional protein gal10 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9F7D4 1.09e-24 105 28 8 327 3 galE UDP-glucose 4-epimerase Yersinia pestis
Q56093 1.46e-24 105 26 7 324 3 galE UDP-glucose 4-epimerase Salmonella typhi
P22715 1.52e-24 105 26 7 324 3 galE UDP-glucose 4-epimerase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9LPG6 2.19e-24 107 26 8 338 1 RHM2 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 Arabidopsis thaliana
Q05026 2.51e-24 104 24 7 348 3 galE UDP-glucose 4-epimerase Neisseria gonorrhoeae
Q652A8 3.72e-24 104 25 7 343 2 UGE-3 UDP-glucose 4-epimerase 3 Oryza sativa subsp. japonica
Q6T1X6 1.04e-23 102 26 10 340 1 rmd GDP-6-deoxy-D-mannose reductase Aneurinibacillus thermoaerophilus
Q8H0B6 1.37e-23 103 26 8 326 2 UEL-2 Probable UDP-arabinose 4-epimerase 2 Oryza sativa subsp. japonica
P37761 1.42e-23 102 26 11 354 3 rfbB dTDP-glucose 4,6-dehydratase Neisseria gonorrhoeae
Q8H0B2 2.1e-23 103 27 9 329 2 UEL-3 Probable UDP-arabinose 4-epimerase 3 Oryza sativa subsp. japonica
P33119 2.15e-23 101 25 6 329 3 galE UDP-glucose 4-epimerase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q9KDV3 3.21e-23 101 25 9 348 3 galE UDP-glucose 4-epimerase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5PQX0 4.92e-23 102 25 10 338 1 Uxs1 UDP-glucuronic acid decarboxylase 1 Rattus norvegicus
Q5R885 5.07e-23 102 25 10 338 2 UXS1 UDP-glucuronic acid decarboxylase 1 Pongo abelii
Q91XL3 5.07e-23 102 25 10 338 1 Uxs1 UDP-glucuronic acid decarboxylase 1 Mus musculus
Q8NBZ7 5.27e-23 102 25 10 338 1 UXS1 UDP-glucuronic acid decarboxylase 1 Homo sapiens
Q8S8T4 5.63e-23 102 25 12 344 2 UXS4 UDP-glucuronic acid decarboxylase 4 Arabidopsis thaliana
E8MF10 7.19e-23 100 24 7 345 1 lnpD UDP-glucose 4-epimerase Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b)
P18645 7.76e-23 100 24 9 354 2 Gale UDP-glucose 4-epimerase Rattus norvegicus
Q45291 8.89e-23 100 24 7 331 3 galE UDP-glucose 4-epimerase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P09609 4.23e-22 100 28 10 325 2 GAL10 Bifunctional protein GAL10 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
P09147 4.79e-22 98 24 8 325 1 galE UDP-glucose 4-epimerase Escherichia coli (strain K12)
Q9RR28 5.95e-22 97 25 6 333 3 oleE dTDP-glucose 4,6-dehydratase Streptomyces antibioticus
Q6GMI9 9.18e-22 98 24 10 337 1 uxs1 UDP-glucuronic acid decarboxylase 1 Danio rerio
Q9ZAE8 1.4e-21 96 25 6 337 3 acbB dTDP-glucose 4,6-dehydratase Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110)
Q9CNY5 1.53e-21 96 26 7 321 3 galE UDP-glucose 4-epimerase Pasteurella multocida (strain Pm70)
P56986 1.78e-21 96 27 9 325 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup C
P55180 1.84e-21 96 24 9 338 3 galE UDP-glucose 4-epimerase Bacillus subtilis (strain 168)
Q59678 2.61e-21 96 24 8 347 3 galE UDP-glucose 4-epimerase Mannheimia haemolytica
Q6DF08 2.73e-21 97 24 10 338 2 uxs1 UDP-glucuronic acid decarboxylase 1 Xenopus tropicalis
P56985 3.6e-21 95 26 6 322 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9L9E8 4.43e-21 95 25 7 338 3 novT dTDP-glucose 4,6-dehydratase Streptomyces niveus
P26503 6.95e-21 94 25 7 329 3 exoB UDP-glucose 4-epimerase Rhizobium meliloti (strain 1021)
Q9LZI2 7.21e-21 96 24 12 344 1 UXS2 UDP-glucuronic acid decarboxylase 2 Arabidopsis thaliana
P04397 1.08e-20 96 26 10 350 1 GAL10 Bifunctional protein GAL10 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P14169 1.45e-20 94 24 9 356 1 rfbE CDP-paratose 2-epimerase Salmonella typhi
P56997 1.86e-20 94 26 8 323 3 galE UDP-glucose 4-epimerase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
D4GU72 6.53e-20 91 25 9 332 3 agl12 Low-salt glycan biosynthesis protein Agl12 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q9FIE8 7.19e-20 92 25 10 329 1 UXS3 UDP-glucuronic acid decarboxylase 3 Arabidopsis thaliana
Q9Y7X5 1e-19 92 26 11 324 1 uge1 UDP-glucose 4-epimerase uge1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0QSK6 1.5e-19 91 27 11 337 1 rmlB dTDP-glucose 4,6-dehydratase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WN65 1.59e-19 90 29 6 237 1 rmlB dTDP-glucose 4,6-dehydratase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN64 1.59e-19 90 29 6 237 3 rmlB dTDP-glucose 4,6-dehydratase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5UR12 1.76e-19 90 31 4 233 1 MIMI_R141 Putative dTDP-D-glucose 4,6-dehydratase Acanthamoeba polyphaga mimivirus
Q59745 3.31e-19 90 22 8 352 3 exoB UDP-glucose 4-epimerase Rhizobium leguminosarum bv. trifolii
P56600 4.05e-19 85 40 2 130 3 GAL10 Bifunctional protein GAL10 (Fragment) Candida maltosa
Q331Q7 4.14e-19 89 24 8 337 1 gerKI dTDP-4-dehydro-6-deoxy-D-allose reductase Streptomyces sp.
O84903 4.53e-19 89 24 9 332 3 galE UDP-glucose 4-epimerase Lacticaseibacillus casei
Q553X7 7.12e-19 89 25 8 329 1 galE UDP-glucose 4-epimerase Dictyostelium discoideum
Q59083 1.85e-18 88 24 10 331 3 exoB UDP-glucose 4-epimerase Azospirillum brasilense
A3QJB2 3.71e-18 87 27 15 343 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P45602 7.28e-18 82 33 2 141 3 galE UDP-glucose 4-epimerase (Fragment) Klebsiella pneumoniae
Q9SN95 8.31e-18 86 24 10 329 2 UXS5 UDP-glucuronic acid decarboxylase 5 Arabidopsis thaliana
P29782 8.53e-18 86 23 7 330 1 strE dTDP-glucose 4,6-dehydratase Streptomyces griseus
Q13VD0 1.9e-17 85 26 16 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia xenovorans (strain LB400)
B2T625 2.44e-17 84 26 16 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q8VZC0 2.47e-17 85 23 10 345 1 UXS1 UDP-glucuronic acid decarboxylase 1 Arabidopsis thaliana
Q07W60 6.65e-17 83 26 15 344 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella frigidimarina (strain NCIMB 400)
Q9ZV36 1.69e-16 82 25 11 329 2 UXS6 UDP-glucuronic acid decarboxylase 6 Arabidopsis thaliana
P96995 5.11e-16 81 23 8 336 3 galE UDP-glucose 4-epimerase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5SFA6 5.51e-16 80 22 8 339 1 chmD dTDP-4-dehydro-6-deoxy-D-allose reductase Streptomyces bikiniensis
A0A0U3AP28 5.89e-16 80 26 8 298 1 HS5.17 CDP-6-D-glucitol synthase Campylobacter jejuni
A2Z7B3 1.15e-15 80 27 8 250 2 OsI_032456 GDP-mannose 3,5-epimerase 1 Oryza sativa subsp. indica
P21977 1.99e-15 79 29 4 186 3 galE UDP-glucose 4-epimerase Streptococcus thermophilus
P13226 2.07e-15 79 23 8 342 3 galE UDP-glucose 4-epimerase Streptomyces lividans
Q5HIC2 3.13e-15 78 27 7 236 3 SACOL0599 Uncharacterized epimerase/dehydratase SACOL0599 Staphylococcus aureus (strain COL)
Q99W56 3.13e-15 78 27 7 236 3 SAV0553 Uncharacterized epimerase/dehydratase SAV0553 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FJ87 3.13e-15 78 27 7 236 3 SAUSA300_0538 Uncharacterized epimerase/dehydratase SAUSA300_0538 Staphylococcus aureus (strain USA300)
Q2G0M5 3.13e-15 78 27 7 236 3 SAOUHSC_00535 Uncharacterized epimerase/dehydratase SAOUHSC_00535 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GBT4 3.13e-15 78 27 7 236 3 SAS0511 Uncharacterized epimerase/dehydratase SAS0511 Staphylococcus aureus (strain MSSA476)
Q7A788 3.13e-15 78 27 7 236 1 SA0511 Uncharacterized epimerase/dehydratase SA0511 Staphylococcus aureus (strain N315)
Q7A1Q7 3.13e-15 78 27 7 236 3 MW0508 Uncharacterized epimerase/dehydratase MW0508 Staphylococcus aureus (strain MW2)
P35675 4e-15 75 35 5 167 3 None Uncharacterized protein in galE 3'region (Fragment) Erwinia amylovora
Q2YSA8 4.09e-15 78 27 7 236 3 SAB0504 Uncharacterized epimerase/dehydratase SAB0504 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A3C4S4 4.56e-15 79 26 8 250 1 GME-1 GDP-mannose 3,5-epimerase 1 Oryza sativa subsp. japonica
Q6GJB5 4.77e-15 78 27 7 237 3 SAR0558 Uncharacterized epimerase/dehydratase SAR0558 Staphylococcus aureus (strain MRSA252)
C0QZ84 8.07e-15 77 26 14 298 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A9ADU8 1.61e-14 76 25 16 361 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia multivorans (strain ATCC 17616 / 249)
P47364 1.85e-14 76 23 12 355 3 galE UDP-glucose 4-epimerase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
B2JF12 1.89e-14 76 25 15 359 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q2R1V8 2.12e-14 76 26 8 250 2 GME-2 GDP-mannose 3,5-epimerase 2 Oryza sativa subsp. japonica
Q12CM2 2.17e-14 76 25 14 309 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polaromonas sp. (strain JS666 / ATCC BAA-500)
B8CVJ3 2.2e-14 76 26 19 352 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q9HDU4 3.12e-14 76 23 12 365 3 SPBPB2B2.11 Uncharacterized protein PB2B2.11 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B2U894 3.89e-14 75 25 17 359 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Ralstonia pickettii (strain 12J)
Q3A8K5 4.95e-14 75 27 18 347 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A4JCI2 5.58e-14 75 25 17 364 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q93VR3 7.68e-14 75 27 8 247 1 At5g28840 GDP-mannose 3,5-epimerase Arabidopsis thaliana
Q47GJ3 1.22e-13 74 24 17 366 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Dechloromonas aromatica (strain RCB)
Q0BH85 1.38e-13 73 25 17 364 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YV41 1.4e-13 73 25 17 364 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia ambifaria (strain MC40-6)
Q1BY20 1.46e-13 73 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia orbicola (strain AU 1054)
B1JXS7 1.46e-13 73 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia orbicola (strain MC0-3)
A0K5M9 1.46e-13 73 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia cenocepacia (strain HI2424)
P40801 2.22e-13 74 25 9 349 2 GAL10 Bifunctional protein GAL10 Pachysolen tannophilus
P45048 3.23e-13 72 25 15 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UIN9 3.35e-13 72 25 15 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain PittGG)
Q4QLI0 3.41e-13 72 25 15 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus influenzae (strain 86-028NP)
Q39IF3 4.89e-13 72 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EB34 8.2e-13 71 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q2SY18 8.27e-13 71 24 14 359 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q21Y60 9.29e-13 71 22 16 366 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q46Y59 1.06e-12 71 26 17 370 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7VZF5 1.09e-12 71 26 16 358 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
C4K8I6 1.28e-12 70 25 19 348 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q31FG4 3.27e-12 69 25 15 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P75517 3.42e-12 70 23 13 356 3 galE UDP-glucose 4-epimerase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A3NC24 7.05e-12 68 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 668)
Q3JPY8 7.05e-12 68 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1710b)
A3NXW3 7.05e-12 68 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1106a)
A1V6L4 7.05e-12 68 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain SAVP1)
Q62M34 7.05e-12 68 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain ATCC 23344)
A2S4R1 7.05e-12 68 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain NCTC 10229)
A3MHP7 7.05e-12 68 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia mallei (strain NCTC 10247)
Q0KDH0 7.37e-12 68 25 20 363 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P0A1P4 8.13e-12 68 21 9 334 1 rfbJ CDP-abequose synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0DMK5 8.5e-12 68 25 19 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain K96243)
I1WGR6 8.5e-12 68 24 15 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Burkholderia pseudomallei (strain 1026b)
Q4L3L8 9.52e-12 68 24 7 236 3 SH2450 Uncharacterized epimerase/dehydratase SH2450 Staphylococcus haemolyticus (strain JCSC1435)
Q1LQG2 1.16e-11 68 25 20 369 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A1VR25 1.5e-11 68 25 14 310 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polaromonas naphthalenivorans (strain CJ2)
P95780 1.55e-11 68 24 13 347 1 rmlB dTDP-glucose 4,6-dehydratase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2NQV7 1.97e-11 67 25 16 341 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Sodalis glossinidius (strain morsitans)
Q7W609 1.99e-11 67 25 16 358 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGU9 1.99e-11 67 25 16 358 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q48HZ1 2.13e-11 68 26 8 246 3 arnA Bifunctional polymyxin resistance protein ArnA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B2FI29 2.39e-11 67 27 14 285 1 oleD 2-alkyl-3-oxoalkanoate reductase Stenotrophomonas maltophilia (strain K279a)
C6DIA9 2.54e-11 67 24 17 348 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VL47 3e-11 67 26 17 340 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C5BB97 3.09e-11 67 25 20 343 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Edwardsiella ictaluri (strain 93-146)
Q49VA1 3.77e-11 66 24 7 237 3 SSP2164 Uncharacterized epimerase/dehydratase SSP2164 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B5XTK9 3.86e-11 67 25 8 249 3 arnA Bifunctional polymyxin resistance protein ArnA Klebsiella pneumoniae (strain 342)
B3R3C0 5.64e-11 66 25 20 364 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q8X7P7 5.69e-11 66 25 14 315 1 gnu N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase Escherichia coli O157:H7
Q9HTB6 6.29e-11 65 22 12 338 1 rmd GDP-6-deoxy-D-mannose reductase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3J7X9 6.95e-11 65 24 15 347 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
C3KAD2 7.55e-11 66 26 9 247 3 arnA Bifunctional polymyxin resistance protein ArnA Pseudomonas fluorescens (strain SBW25)
A1KBH4 9.14e-11 65 25 16 356 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Azoarcus sp. (strain BH72)
Q7N3Q7 9.28e-11 66 23 7 247 3 arnA Bifunctional polymyxin resistance protein ArnA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q06952 1.36e-10 65 26 3 201 3 gmd GDP-mannose 4,6-dehydratase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3KCC1 1.51e-10 65 26 9 247 3 arnA Bifunctional polymyxin resistance protein ArnA Pseudomonas fluorescens (strain Pf0-1)
Q4ZSZ2 1.66e-10 65 25 8 246 3 arnA Bifunctional polymyxin resistance protein ArnA Pseudomonas syringae pv. syringae (strain B728a)
Q4KC82 1.8e-10 65 24 8 246 3 arnA Bifunctional polymyxin resistance protein ArnA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8PDW5 2.16e-10 64 33 9 193 1 oleD 2-alkyl-3-oxoalkanoate reductase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8Y0X8 2.3e-10 64 24 20 360 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1JHX6 2.67e-10 63 24 18 354 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7LM76 3.14e-10 64 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q67ZE1 3.66e-10 64 24 7 292 1 3BETAHSD/D2 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2 Arabidopsis thaliana
A1JPN5 4e-10 64 22 8 278 3 arnA Bifunctional polymyxin resistance protein ArnA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8FRR2 4.04e-10 64 23 7 248 3 arnA Bifunctional polymyxin resistance protein ArnA Shewanella sediminis (strain HAW-EB3)
Q2L2R8 5.49e-10 63 25 11 308 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella avium (strain 197N)
Q02R25 6.29e-10 63 25 10 253 3 arnA Bifunctional polymyxin resistance protein ArnA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q7NTL6 6.4e-10 63 24 19 366 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A7MQ91 6.81e-10 62 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Cronobacter sakazakii (strain ATCC BAA-894)
Q6E7F2 7.27e-10 62 21 9 334 1 fcf1 dTDP-4-dehydro-6-deoxyglucose reductase Escherichia coli
A0A1B4XBH2 7.38e-10 63 25 7 288 3 sdnI GDP-mannose 4,6-dehydratase sdnI Sordaria araneosa
B5FNT9 7.59e-10 63 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella dublin (strain CT_02021853)
B5RCC4 8.08e-10 63 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q8Z540 8.38e-10 63 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella typhi
B5BCP6 8.38e-10 63 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella paratyphi A (strain AKU_12601)
Q5PNA6 8.38e-10 63 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q87T56 8.74e-10 62 25 16 308 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9HY63 8.78e-10 63 25 10 253 3 arnA Bifunctional polymyxin resistance protein ArnA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
C0Q069 8.93e-10 63 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella paratyphi C (strain RKS4594)
P0C0R6 9.25e-10 63 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella choleraesuis (strain SC-B67)
Q56872 9.39e-10 62 26 5 232 3 gmd GDP-mannose 4,6-dehydratase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4SYX1 9.77e-10 63 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella newport (strain SL254)
B7VBN2 9.96e-10 63 25 10 253 3 arnA Bifunctional polymyxin resistance protein ArnA Pseudomonas aeruginosa (strain LESB58)
A6V1P0 1.02e-09 63 25 10 253 3 arnA Bifunctional polymyxin resistance protein ArnA Pseudomonas aeruginosa (strain PA7)
A4SQW9 1.02e-09 63 23 8 249 3 arnA Bifunctional polymyxin resistance protein ArnA Aeromonas salmonicida (strain A449)
B1JQW4 1.07e-09 62 24 16 345 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66GC7 1.07e-09 62 24 16 345 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSC8 1.07e-09 62 24 16 345 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis (strain Pestoides F)
Q1CD11 1.07e-09 62 24 16 345 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R683 1.07e-09 62 24 16 345 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJN4 1.07e-09 62 24 16 345 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis
B2JYP2 1.07e-09 62 24 16 345 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C276 1.07e-09 62 24 16 345 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCU3 1.07e-09 62 24 16 345 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7LVH8 1.07e-09 62 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I3J9 1.07e-09 62 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain SE11)
P67910 1.07e-09 62 24 17 342 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12)
B1X953 1.07e-09 62 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12 / DH10B)
C4ZXL1 1.07e-09 62 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4A5 1.07e-09 62 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O8 (strain IAI1)
B5YWC0 1.07e-09 62 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P67911 1.07e-09 62 24 17 342 1 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O157:H7
B7L745 1.07e-09 62 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain 55989 / EAEC)
B7ULH4 1.07e-09 62 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTH2 1.07e-09 62 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8FFM1 1.1e-09 63 24 7 249 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MXT6 1.12e-09 63 24 7 249 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O81 (strain ED1a)
A9IJJ7 1.23e-09 62 23 12 356 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B2TW38 1.28e-09 62 23 8 279 5 arnA Putative bifunctional polymyxin resistance protein ArnA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B4ETL7 1.3e-09 62 23 7 250 3 arnA Bifunctional polymyxin resistance protein ArnA Proteus mirabilis (strain HI4320)
Q0TFI7 1.34e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A6TF98 1.34e-09 62 24 8 248 3 arnA Bifunctional polymyxin resistance protein ArnA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7UFR7 1.4e-09 62 24 7 249 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q51061 1.47e-09 62 23 17 367 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria gonorrhoeae
Q1R9G0 1.48e-09 62 24 7 249 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli (strain UTI89 / UPEC)
A1ADA7 1.48e-09 62 24 7 249 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O1:K1 / APEC
B7MG22 1.48e-09 62 24 7 249 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O45:K1 (strain S88 / ExPEC)
B1LLK9 1.49e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli (strain SMS-3-5 / SECEC)
B7NNT4 1.52e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7N5M0 1.59e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1LK58 1.62e-09 61 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain SMS-3-5 / SECEC)
B6I7J8 1.65e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli (strain SE11)
B7M5T7 1.65e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O8 (strain IAI1)
B7LAS0 1.65e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli (strain 55989 / EAEC)
A7ZP73 1.65e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YZV1 1.66e-09 62 23 8 281 3 arnA Bifunctional polymyxin resistance protein ArnA Shigella sonnei (strain Ss046)
Q32DT3 1.68e-09 62 23 8 281 3 arnA Bifunctional polymyxin resistance protein ArnA Shigella dysenteriae serotype 1 (strain Sd197)
Q31YK2 1.71e-09 62 24 7 249 3 arnA Bifunctional polymyxin resistance protein ArnA Shigella boydii serotype 4 (strain Sb227)
Q9SNY3 1.71e-09 62 24 11 342 1 GMD1 GDP-mannose 4,6 dehydratase 1 Arabidopsis thaliana
B5YXP8 1.72e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XDZ3 1.72e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O157:H7
O52325 1.74e-09 62 24 9 280 1 arnA Bifunctional polymyxin resistance protein ArnA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77398 1.75e-09 62 23 8 279 1 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli (strain K12)
B1IXT2 1.75e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1X8W8 1.75e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli (strain K12 / DH10B)
C4ZU97 1.75e-09 62 23 8 279 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli (strain K12 / MC4100 / BW2952)
B4TPI2 1.77e-09 62 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella schwarzengrund (strain CVM19633)
A8A2C2 1.78e-09 62 24 7 249 3 arnA Bifunctional polymyxin resistance protein ArnA Escherichia coli O9:H4 (strain HS)
Q0A4T8 1.87e-09 61 26 18 352 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q6DAT7 1.9e-09 61 23 17 348 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B5R272 1.95e-09 62 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella enteritidis PT4 (strain P125109)
A9N5B2 2.02e-09 62 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5EZH8 2.04e-09 62 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella agona (strain SL483)
Q329N6 2.08e-09 61 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella dysenteriae serotype 1 (strain Sd197)
B4TBG6 2.12e-09 62 24 9 280 3 arnA Bifunctional polymyxin resistance protein ArnA Salmonella heidelberg (strain SL476)
A1VGB0 2.24e-09 61 25 18 352 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitratidesulfovibrio vulgaris (strain DP4)
Q8D341 2.24e-09 62 24 7 243 3 arnA Bifunctional polymyxin resistance protein ArnA Wigglesworthia glossinidia brevipalpis
Q0P8I7 2.39e-09 61 28 7 231 1 Cj1427c GDP-D-glycero-alpha-D-manno-heptose dehydrogenase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A0KGY6 2.45e-09 62 24 9 250 3 arnA Bifunctional polymyxin resistance protein ArnA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A8GLC8 2.68e-09 61 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Serratia proteamaculans (strain 568)
B5RGG8 2.75e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5E3 2.75e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella enteritidis PT4 (strain P125109)
B5FLI8 2.75e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella dublin (strain CT_02021853)
Q5P2S1 2.76e-09 61 24 11 344 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9JRN5 2.84e-09 61 26 6 235 1 gmd GDP-mannose 4,6-dehydratase Aggregatibacter actinomycetemcomitans
Q72ET7 2.98e-09 60 25 16 309 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B0BSD7 3.06e-09 60 24 16 343 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N308 3.06e-09 60 24 16 343 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B1XVP6 3.37e-09 60 23 14 360 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B5XTI2 3.46e-09 60 23 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae (strain 342)
C0Q1V2 3.49e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi C (strain RKS4594)
Q57IC3 3.49e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella choleraesuis (strain SC-B67)
P67912 3.59e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67913 3.59e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella typhi
B4TZW1 3.59e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella schwarzengrund (strain CVM19633)
B5BHZ3 3.59e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi A (strain AKU_12601)
A9MVL2 3.59e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PC05 3.59e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T9A3 3.59e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella heidelberg (strain SL476)
B5EXC5 3.59e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella agona (strain SL483)
Q02QH1 3.61e-09 60 24 17 366 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9CL97 3.65e-09 60 24 15 343 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pasteurella multocida (strain Pm70)
B1IZH2 3.76e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A683 3.76e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O9:H4 (strain HS)
B4SXC1 3.83e-09 60 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella newport (strain SL254)
Q65WA7 4.11e-09 60 25 14 303 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q3YVY3 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella sonnei (strain Ss046)
Q83PP2 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella flexneri
Q0SYE8 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella flexneri serotype 5b (strain 8401)
Q31V04 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella boydii serotype 4 (strain Sb227)
B2U5D7 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R4X2 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli (strain UTI89 / UPEC)
B7NES6 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FCA0 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBI8 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHF5 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O1:K1 / APEC
B7N1S3 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O81 (strain ED1a)
B7NPC7 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MFI2 4.35e-09 60 24 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Escherichia coli O45:K1 (strain S88 / ExPEC)
B0UWU3 4.45e-09 60 25 15 291 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Histophilus somni (strain 2336)
Q0I569 4.45e-09 60 25 15 291 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Histophilus somni (strain 129Pt)
Q9HYQ8 4.53e-09 60 24 17 366 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A8ARK8 4.64e-09 60 24 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6V291 5.06e-09 60 25 19 368 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Pseudomonas aeruginosa (strain PA7)
A8GDR7 5.1e-09 61 23 7 247 3 arnA Bifunctional polymyxin resistance protein ArnA Serratia proteamaculans (strain 568)
A6TFL4 5.9e-09 60 23 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9XCA1 6.06e-09 60 23 17 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Klebsiella pneumoniae
A7MSM1 7.01e-09 59 24 15 308 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio campbellii (strain ATCC BAA-1116)
Q9FX01 7.26e-09 60 23 7 296 1 3BETAHSD/D1 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 Arabidopsis thaliana
P55579 7.3e-09 60 23 10 294 3 NGR_a02350 Uncharacterized protein y4nG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A9M3Q7 7.43e-09 60 22 16 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup C (strain 053442)
A6VLD2 7.75e-09 59 26 12 241 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P55354 7.82e-09 60 26 3 203 3 gmd GDP-mannose 4,6-dehydratase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9ZUY6 8.06e-09 60 25 11 297 1 AXS1 UDP-D-apiose/UDP-D-xylose synthase 1 Arabidopsis thaliana
Q9SGE0 8.36e-09 60 25 11 297 2 AXS2 UDP-D-apiose/UDP-D-xylose synthase 2 Arabidopsis thaliana
A4WAM3 8.9e-09 60 23 9 279 3 arnA Bifunctional polymyxin resistance protein ArnA Enterobacter sp. (strain 638)
Q56598 1.07e-08 59 30 5 163 3 gmd GDP-mannose 4,6-dehydratase Vibrio cholerae
B4F132 1.1e-08 59 24 14 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Proteus mirabilis (strain HI4320)
Q5F9J0 1.14e-08 59 23 17 367 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9MKQ6 1.36e-08 58 23 18 346 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8CQ79 1.38e-08 58 23 7 237 3 SE_0317 Uncharacterized epimerase/dehydratase SE_0317 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRJ9 1.38e-08 58 23 7 237 3 SERP0194 Uncharacterized epimerase/dehydratase SERP0194 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O49213 1.45e-08 58 20 11 349 1 GER1 GDP-L-fucose synthase 1 Arabidopsis thaliana
C6DAW5 1.45e-08 59 23 11 256 3 arnA Bifunctional polymyxin resistance protein ArnA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q9K002 1.66e-08 58 22 16 362 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JRN7 1.77e-08 58 25 6 235 1 tld GDP-6-deoxy-D-talose 4-dehydrogenase Aggregatibacter actinomycetemcomitans
O85713 1.77e-08 58 26 3 203 3 gmd GDP-mannose 4,6-dehydratase Rhizobium fredii (strain HH103)
Q0T2M8 1.87e-08 59 23 8 281 3 arnA Bifunctional polymyxin resistance protein ArnA Shigella flexneri serotype 5b (strain 8401)
A8Y0L5 1.88e-08 58 25 7 247 3 CBG21737 GDP-mannose 4,6 dehydratase 1 Caenorhabditis briggsae
Q9JQX8 1.94e-08 58 22 17 367 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B8F727 2.07e-08 58 23 16 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Glaesserella parasuis serovar 5 (strain SH0165)
B3GYT6 2.23e-08 58 23 16 343 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q6D2F1 2.44e-08 58 24 9 252 3 arnA Bifunctional polymyxin resistance protein ArnA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8EG63 2.74e-08 58 27 7 195 1 oleD 2-alkyl-3-oxoalkanoate reductase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B5FFS9 3.72e-08 57 24 14 293 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aliivibrio fischeri (strain MJ11)
Q5E8J9 4.34e-08 57 24 14 293 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aliivibrio fischeri (strain ATCC 700601 / ES114)
P32055 4.64e-08 57 21 9 289 1 fcl GDP-L-fucose synthase Escherichia coli (strain K12)
A1KT78 4.77e-08 57 22 16 367 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9LMU0 4.83e-08 57 21 8 345 1 GER2 Putative GDP-L-fucose synthase 2 Arabidopsis thaliana
B1JJ30 5.69e-08 57 22 7 248 3 arnA Bifunctional polymyxin resistance protein ArnA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TIM4 5.8e-08 57 22 7 248 3 arnA Bifunctional polymyxin resistance protein ArnA Yersinia pestis (strain Pestoides F)
Q1CIH7 5.8e-08 57 22 7 248 3 arnA Bifunctional polymyxin resistance protein ArnA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R093 5.8e-08 57 22 7 248 3 arnA Bifunctional polymyxin resistance protein ArnA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX8 5.8e-08 57 22 7 248 3 arnA Bifunctional polymyxin resistance protein ArnA Yersinia pestis
Q1C742 5.8e-08 57 22 7 248 3 arnA Bifunctional polymyxin resistance protein ArnA Yersinia pestis bv. Antiqua (strain Antiqua)
Q93PD8 6.01e-08 57 22 7 248 2 arnA Bifunctional polymyxin resistance protein ArnA Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K5L3 6.01e-08 57 22 7 248 3 arnA Bifunctional polymyxin resistance protein ArnA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHH4 6.01e-08 57 22 7 248 3 arnA Bifunctional polymyxin resistance protein ArnA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A0KQV3 6.29e-08 57 24 14 342 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
O45583 8.23e-08 57 24 7 247 1 gmd-2 GDP-mannose 4,6 dehydratase 2 Caenorhabditis elegans
A1TYR6 9.61e-08 56 25 18 348 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
P93031 1.16e-07 56 24 10 345 1 MUR1 GDP-mannose 4,6 dehydratase 2 Arabidopsis thaliana
Q83QT8 1.25e-07 57 22 8 281 3 arnA Bifunctional polymyxin resistance protein ArnA Shigella flexneri
Q18801 1.39e-07 56 25 8 247 1 bre-1 GDP-mannose 4,6 dehydratase 1 Caenorhabditis elegans
Q00329 1.41e-07 55 22 11 329 3 rfbJ CDP-abequose synthase Salmonella muenchen
Q2NRV7 1.81e-07 56 24 9 249 3 arnA Bifunctional polymyxin resistance protein ArnA Sodalis glossinidius (strain morsitans)
Q7MPN6 1.96e-07 55 24 16 306 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio vulnificus (strain YJ016)
Q15738 2.03e-07 55 24 13 289 1 NSDHL Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating Homo sapiens
Q8DE09 2.07e-07 55 24 16 306 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio vulnificus (strain CMCP6)
P26397 2.41e-07 55 26 5 184 1 rfbG CDP-glucose 4,6-dehydratase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3ZBE9 2.43e-07 55 24 13 291 2 NSDHL Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating Bos taurus
O43050 3.14e-07 55 24 13 323 3 erg26 Sterol-4-alpha-carboxylate 3-dehydrogenase erg26, decarboxylating Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B2VBI9 3.5e-07 55 23 8 249 3 arnA Bifunctional polymyxin resistance protein ArnA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q8RIA5 4.38e-07 54 24 16 364 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q1R1N5 5.96e-07 53 24 17 355 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q7MY46 6.53e-07 53 23 16 347 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7CRQ0 6.87e-07 53 26 5 170 1 udh Uronate dehydrogenase Agrobacterium fabrum (strain C58 / ATCC 33970)
A4SHC0 7.3e-07 53 23 12 303 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Aeromonas salmonicida (strain A449)
P53199 1.19e-06 53 25 7 202 1 ERG26 Sterol-4-alpha-carboxylate 3-dehydrogenase ERG26, decarboxylating Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P0DX24 1.25e-06 53 22 9 284 1 MN2019_09805 3-beta-hydroxysteroid dehydrogenase Mycolicibacterium neoaurum
P0AC91 2.07e-06 52 26 3 157 3 gmd GDP-mannose 4,6-dehydratase Shigella flexneri
P0AC88 2.07e-06 52 26 3 157 1 gmd GDP-mannose 4,6-dehydratase Escherichia coli (strain K12)
P0AC89 2.07e-06 52 26 3 157 3 gmd GDP-mannose 4,6-dehydratase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC90 2.07e-06 52 26 3 157 3 gmd GDP-mannose 4,6-dehydratase Escherichia coli O157:H7
P44094 2.27e-06 52 27 9 219 1 denD D-erythronate dehydrogenase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9R1J0 2.57e-06 52 24 10 288 1 Nsdhl Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating Mus musculus
Q1ZXF7 4.04e-06 51 23 8 259 1 gmd GDP-mannose 4,6 dehydratase Dictyostelium discoideum
C3LQK1 4.27e-06 51 23 16 312 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain M66-2)
Q06963 4.27e-06 51 23 16 312 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3Z4 4.27e-06 51 23 16 312 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P9WQP7 5.14e-06 51 25 11 280 1 Rv1106c 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQP6 5.14e-06 51 25 11 280 3 MT1137 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q55C77 6.15e-06 50 20 12 348 1 ger GDP-L-fucose synthase Dictyostelium discoideum
Q7VKK8 7.31e-06 50 24 19 349 3 hldD ADP-L-glycero-D-manno-heptose-6-epimerase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q60555 7.55e-06 50 29 5 193 2 HSD3B1 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 Mesocricetus auratus
Q9RR27 7.92e-06 50 27 6 205 3 oleU Probable dTDP-4,6-dihydroxy-2-methyloxan-3-one 4-ketoreductase Streptomyces antibioticus
Q51366 8.68e-06 50 25 6 230 1 gmd GDP-mannose 4,6-dehydratase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q888H1 8.68e-06 50 27 7 178 1 udh Uronate dehydrogenase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8K3X3 1.15e-05 50 22 10 338 2 GMDS GDP-mannose 4,6 dehydratase Cricetulus griseus
Q9UT59 1.29e-05 50 26 7 187 3 SPAC513.07 Putative uncharacterized oxidoreductase C513.07 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P55353 1.64e-05 49 23 4 189 3 fcl GDP-L-fucose synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8K0C9 1.64e-05 49 22 10 338 1 Gmds GDP-mannose 4,6 dehydratase Mus musculus
P14720 1.81e-05 49 29 7 145 2 DFRA Dihydroflavonol 4-reductase Petunia hybrida
Q0P9D4 1.85e-05 50 23 7 234 1 pglF UDP-N-acetyl-alpha-D-glucosamine C6 dehydratase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q67WR2 2.53e-05 48 19 10 347 2 Os06g0652400 Probable GDP-L-fucose synthase 1 Oryza sativa subsp. japonica
O46516 2.6e-05 49 29 8 201 2 HSD3B 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Equus caballus
Q67WR5 2.92e-05 48 21 9 260 3 Os06g0652300 Putative GDP-L-fucose synthase 2 Oryza sativa subsp. japonica
P0A5D2 3.24e-05 48 26 6 153 3 BQ2027_MB0513 Uncharacterized protein Mb0513 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WKT3 3.24e-05 48 26 6 153 1 Rv0501 Uncharacterized protein Rv0501 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKT2 3.24e-05 48 26 6 153 3 MT0522 Uncharacterized protein MT0522 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O60547 3.42e-05 48 21 10 338 1 GMDS GDP-mannose 4,6 dehydratase Homo sapiens
A0A059TC02 3.68e-05 48 27 5 144 1 CCR1 Cinnamoyl-CoA reductase 1 Petunia hybrida
Q5FB34 4.93e-05 48 27 5 133 1 ANR Anthocyanidin reductase ((2S)-flavan-3-ol-forming) Vitis vinifera
Q7PCC4 5.11e-05 48 27 5 133 1 ANR Anthocyanidin reductase ((2S)-flavan-3-ol-forming) Vitis vinifera
Q67477 5.27e-05 48 27 4 142 3 FPV046 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase Fowlpox virus (strain NVSL)
Q9VMW9 7.69e-05 47 22 9 296 1 Gmd GDP-mannose 4,6 dehydratase Drosophila melanogaster
Q4QQZ4 7.92e-05 47 26 5 160 2 mat2b Methionine adenosyltransferase 2 subunit beta Xenopus laevis
Q566L8 7.99e-05 47 23 16 338 2 mat2b Methionine adenosyltransferase 2 subunit beta Xenopus tropicalis
D7U6G6 8.37e-05 47 27 5 133 3 ANR Anthocyanidin reductase ((2S)-flavan-3-ol-forming) Vitis vinifera
Q5PPL3 0.000121 47 23 12 289 2 Nsdhl Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating Rattus norvegicus
Q64421 0.000138 47 32 4 133 2 HSD3B2 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 Mesocricetus auratus
Q4JBJ3 0.000168 46 21 11 341 1 agl3 UDP-sulfoquinovose synthase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
G4WJD3 0.00019 46 19 7 273 1 colC GDP-L-colitose synthase Yersinia pseudotuberculosis
Q56623 0.000191 46 23 7 269 3 galE UDP-glucose 4-epimerase Vibrio cholerae
A0QTF8 0.00036 45 25 5 160 1 rmlD dTDP-4-dehydrorhamnose reductase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9XWF0 0.000368 45 22 10 320 1 hsd-1 3beta-hydroxysteroid dehydrogenase/Delta(5)-Delta(4) isomerase 1 Caenorhabditis elegans
P83775 0.000386 45 25 5 177 1 GRP2 Putative NADPH-dependent methylglyoxal reductase GRP2 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q0KBD2 0.000459 45 28 11 221 1 denD D-erythronate dehydrogenase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q5U2R0 0.000573 45 23 15 333 2 Mat2b Methionine adenosyltransferase 2 subunit beta Rattus norvegicus
Q4R7R1 0.000583 45 21 9 308 2 SDR42E1 Short-chain dehydrogenase/reductase family 42E member 1 Macaca fascicularis
Q0P8W4 0.000638 44 27 4 160 1 pseB UDP-N-acetylglucosamine 4,6-dehydratase (inverting) Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q99LB6 0.000729 44 23 15 333 1 Mat2b Methionine adenosyltransferase 2 subunit beta Mus musculus
Q9W1X8 0.000793 44 20 13 358 1 Gmer Probable GDP-L-fucose synthase Drosophila melanogaster
O25511 0.001 44 21 6 232 1 pseB UDP-N-acetylglucosamine 4,6-dehydratase (inverting) Helicobacter pylori (strain ATCC 700392 / 26695)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07210
Feature type CDS
Gene -
Product NAD-dependent epimerase
Location 1579323 - 1580330 (strand: -1)
Length 1008 (nucleotides) / 335 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_271
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01370 NAD dependent epimerase/dehydratase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0451 Cell wall/membrane/envelope biogenesis (M) M Nucleoside-diphosphate-sugar epimerase

Kegg Ortholog Annotation(s)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG049099 NAD-dependent epimerase VF0561 Immune modulation

Protein Sequence

MKILVTGAAGFIGYHLSQRLIEMGYHVVGIDNLNDYYDVRLKEARLAKLNQLDNFQFDKIDITDSVSIAQLFADHRFDRVIHLAAQPGVRYSIENPMAYIDANIVGHINILEGCRHHNVGHLIYSSSSSVYGLNQKQPFSTEDSVDHPVSLYAATKKANELMSHSYSHLYQLPTTGLRFFTVYGPWGRPDMALFKFTKAMLAGEPIDVYNGGNMTRDFTYVDDIVSSVVRLINIIPQPNPNWTVEQGETSSSSAPYKIYNVGNGQPTKLMDFITAIEKSLNIKAKLNLMPMQDGDVLSTCADCSDLAQTTGFSPNTAVEYGVKQFVDWYVDYYQQ

Flanking regions ( +/- flanking 50bp)

ATGATAGCGTTTAGCGCAGAAATCAATTAATTGGGTTATTTGAGTATAATATGAAAATATTAGTAACAGGTGCAGCAGGATTTATTGGCTACCATTTAAGCCAGCGTTTGATAGAAATGGGTTATCATGTTGTCGGGATAGATAATCTCAATGATTATTATGATGTGCGCTTAAAAGAAGCACGATTAGCTAAACTTAATCAGTTGGATAACTTCCAATTTGATAAAATTGATATTACAGATTCAGTGAGTATTGCGCAATTATTTGCTGATCACCGTTTTGATCGAGTTATTCACTTGGCGGCTCAGCCTGGCGTTCGTTATTCAATTGAAAACCCAATGGCATATATCGATGCTAATATTGTAGGCCATATTAATATATTAGAAGGTTGTCGCCATCATAACGTTGGGCATTTGATTTATTCGTCATCAAGCTCGGTATATGGTTTAAATCAAAAGCAACCTTTCTCTACAGAAGATAGTGTTGATCATCCGGTGTCACTTTATGCTGCGACGAAAAAAGCCAACGAATTAATGTCTCATAGCTATTCTCATTTATATCAGCTACCCACAACAGGACTGCGATTTTTTACCGTATATGGTCCTTGGGGGCGTCCTGATATGGCACTATTTAAATTTACTAAAGCTATGTTAGCGGGTGAGCCTATCGATGTTTATAATGGCGGAAATATGACCCGTGATTTCACTTATGTCGATGATATTGTCAGTTCTGTGGTACGTTTAATTAATATTATTCCTCAACCCAACCCAAATTGGACCGTAGAGCAGGGGGAAACTTCATCAAGTTCTGCACCTTATAAAATATATAATGTGGGTAATGGACAGCCTACAAAGTTAATGGATTTTATTACAGCAATAGAAAAATCACTCAATATTAAAGCTAAATTGAACTTAATGCCGATGCAAGATGGTGATGTACTTTCAACCTGTGCTGATTGTAGCGATTTAGCTCAGACAACAGGTTTTTCACCCAACACTGCAGTAGAGTATGGTGTGAAGCAGTTTGTGGATTGGTATGTAGATTATTACCAGCAATAATCAGAGCATAGATATAATGCACAAGACAAAAAGGAGCCTTAAAGCTCCTT