Homologs in group_3128

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20035 FBDBKF_20035 42.0 Morganella morganii S1 sfaG S-fimbrial protein subunit SfaG
EHELCC_03495 EHELCC_03495 42.0 Morganella morganii S2 sfaG S-fimbrial protein subunit SfaG
NLDBIP_03495 NLDBIP_03495 42.0 Morganella morganii S4 sfaG S-fimbrial protein subunit SfaG
LHKJJB_09325 LHKJJB_09325 42.0 Morganella morganii S3 sfaG S-fimbrial protein subunit SfaG
HKOGLL_09650 HKOGLL_09650 42.0 Morganella morganii S5 sfaG S-fimbrial protein subunit SfaG

Distribution of the homologs in the orthogroup group_3128

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3128

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37926 1.99e-20 86 33 5 178 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77789 2.26e-16 75 36 4 154 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P39264 3.23e-16 75 30 3 152 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P38052 1.5e-15 73 29 3 154 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P08189 2.43e-15 73 35 4 153 1 fimF Protein FimF Escherichia coli (strain K12)
P13429 1.2e-13 68 30 2 149 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P37922 1.22e-13 68 30 4 150 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q08456 4.03e-13 67 30 4 150 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P43660 1.49e-12 65 34 8 183 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75860 1.99e-12 65 31 4 172 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
P37921 3.43e-11 62 29 8 189 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75859 1.78e-10 60 27 4 148 2 ycbU Uncharacterized fimbrial-like protein YcbU Escherichia coli (strain K12)
P62605 4.95e-10 59 27 8 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 4.95e-10 59 27 8 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P55223 5.68e-10 58 32 6 155 3 None Fimbrial subunit type 1 Salmonella typhimurium
Q8X5K5 4.3e-09 56 32 8 182 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P62532 4.86e-09 56 29 6 157 1 papK Fimbrial adapter PapK Escherichia coli
P62533 4.86e-09 56 29 6 157 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P12730 5.34e-09 56 27 6 181 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P37920 5.52e-09 56 28 8 186 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P77294 1.85e-08 54 28 6 171 3 ydeR Uncharacterized fimbrial-like protein YdeR Escherichia coli (strain K12)
P42191 4.03e-07 51 29 7 157 1 prsK Protein PrsK Escherichia coli
P21413 6.13e-06 48 25 5 171 3 fasA Fimbrial protein 987P Escherichia coli
P0ABW5 1.99e-05 46 29 5 154 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 1.99e-05 46 29 5 154 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P43664 2.37e-05 46 28 7 159 3 lpfE Protein LpfE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P39834 2.43e-05 46 24 5 177 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P37909 0.000141 44 21 4 164 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P45988 0.000149 44 25 6 192 3 hifA Major fimbrial subunit Haemophilus influenzae
P22595 0.000267 43 25 4 162 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
Q47223 0.000317 43 30 8 148 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P53521 0.001 41 23 6 184 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07085
Feature type CDS
Gene -
Product fimbrial protein
Location 1547222 - 1547779 (strand: -1)
Length 558 (nucleotides) / 185 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3128
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis		 -

Protein Sequence

MNELLHTRKIMRFLLWGMLLFSGYTVFFTKDATAELANTNIVIKANIVANTCRVSPDSLNKFVDLGVWGTKDFQQKNTTEPVKFTLNLTDCSIVTSGVKVMFSGDTDSKDSTLFKLAEKNAAQNIGIAILDKNQNKILPGKSSMIYPVETTNNISLDFYAQYIATNKDVVGGSANGEVLFSLEYL

Flanking regions ( +/- flanking 50bp)

CAAGTGGCTTTCTAAGAGTTGATTTCCCTTAATTTTAATAGGCTAATATCATGAATGAGTTATTACATACTAGAAAAATAATGCGCTTTCTATTATGGGGAATGCTACTTTTTAGCGGATATACAGTATTTTTTACTAAAGATGCAACAGCAGAATTAGCTAATACAAATATTGTTATAAAAGCGAACATTGTGGCAAATACTTGTAGAGTCAGCCCTGATTCGCTAAATAAATTTGTTGACTTAGGGGTTTGGGGAACAAAAGATTTTCAGCAAAAAAATACAACAGAGCCAGTAAAGTTTACACTTAACTTAACTGATTGCAGTATTGTTACTAGCGGTGTAAAAGTAATGTTTAGTGGTGATACTGACAGTAAGGATAGTACCTTGTTTAAGTTGGCAGAAAAAAATGCGGCTCAAAATATAGGTATTGCTATTTTAGATAAAAATCAGAATAAAATATTACCGGGAAAAAGTAGTATGATTTACCCTGTAGAGACAACTAATAATATTTCTCTCGATTTTTATGCGCAATATATCGCAACTAATAAGGACGTAGTTGGGGGAAGTGCAAATGGTGAAGTATTATTTTCTTTAGAATATCTGTAAATAACAAGGGAACTGTGTCGTTCCCTTTTAAATACATTTATAACTATTGG