Homologs in group_386

Help

7 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_03495 EHELCC_03495 100.0 Morganella morganii S2 sfaG S-fimbrial protein subunit SfaG
NLDBIP_03495 NLDBIP_03495 100.0 Morganella morganii S4 sfaG S-fimbrial protein subunit SfaG
LHKJJB_09325 LHKJJB_09325 100.0 Morganella morganii S3 sfaG S-fimbrial protein subunit SfaG
HKOGLL_09650 HKOGLL_09650 100.0 Morganella morganii S5 sfaG S-fimbrial protein subunit SfaG
PMI_RS07085 PMI_RS07085 42.0 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS13460 PMI_RS13460 38.5 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS17135 PMI_RS17135 34.1 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_386

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_386

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77789 2.62e-19 83 39 3 140 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P08189 1.39e-16 76 34 4 174 1 fimF Protein FimF Escherichia coli (strain K12)
P75860 2.01e-16 75 30 4 168 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
P37926 1.41e-15 73 28 4 173 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P13429 3.6e-14 70 28 3 166 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P12730 1.58e-13 68 32 6 181 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P37921 3.02e-13 67 33 6 168 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55223 3.74e-12 65 32 5 162 3 None Fimbrial subunit type 1 Salmonella typhimurium
P62605 4.09e-12 64 30 6 180 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 4.09e-12 64 30 6 180 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P37920 7.66e-12 64 35 9 171 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P0ABW5 1.54e-11 63 33 6 164 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 1.54e-11 63 33 6 164 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P39264 3.41e-11 62 28 3 149 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P38052 8.17e-10 58 30 5 157 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P12903 1.44e-09 57 33 7 170 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P43660 3.77e-09 56 29 3 165 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P04128 3.18e-07 51 32 6 150 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
Q47223 4.14e-07 51 32 11 189 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P12266 1.29e-06 49 31 6 150 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
Q8X5K5 1.38e-06 49 29 5 169 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P21413 2.63e-06 49 23 4 162 3 fasA Fimbrial protein 987P Escherichia coli
P75859 5.43e-05 45 24 3 154 2 ycbU Uncharacterized fimbrial-like protein YcbU Escherichia coli (strain K12)
P37922 9.88e-05 44 25 8 172 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37909 0.000151 43 25 6 187 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
Q08456 0.000355 42 25 8 172 5 fimI Putative fimbrin-like protein FimI Salmonella typhi

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_20035
Feature type CDS
Gene sfaG
Product S-fimbrial protein subunit SfaG
Location 6677 - 7234 (strand: 1)
Length 558 (nucleotides) / 185 (amino acids)
In genomic island -

Contig

Accession contig_46
Length 14364 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_386
Orthogroup size 8
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07355 fimbrial-like protein - -

Protein Sequence

MNSINSKFSGTGNIKGILAFILAAVFSPAAVSDIGSINLIMKANLVSNACTITPGTMNQTVDLGTWAVKQFQETPRGVPPKQFFIELIDCGHLASGVKVKFSGTVDPVNNTLFKLDAASTATNIGISVLDRNKDVIKPNTETIVYPLRPDATNIPLVFYAQYVATANSVGAGTANSQATFTLEYL

Flanking regions ( +/- flanking 50bp)

CAGGCTTACTTACGGATTGATTTCCCGTAACTCTCCGGAGGAGACCGGTAATGAATAGTATTAACAGTAAATTTTCCGGAACAGGGAATATAAAAGGTATTTTAGCTTTTATACTGGCAGCGGTATTCAGCCCGGCAGCTGTTTCGGATATCGGCAGTATTAACTTAATTATGAAAGCTAATCTGGTTTCTAATGCCTGCACTATTACACCGGGGACAATGAATCAGACCGTTGACCTGGGAACCTGGGCAGTAAAACAATTTCAGGAAACACCGCGGGGTGTGCCGCCGAAGCAGTTTTTCATTGAGCTGATTGATTGCGGCCATCTGGCCTCGGGCGTAAAAGTGAAGTTTTCAGGTACAGTGGATCCTGTCAATAATACCTTATTTAAACTGGATGCCGCCAGTACGGCCACAAATATCGGAATTTCTGTTCTCGACAGAAATAAGGATGTTATAAAACCCAACACAGAAACAATTGTATATCCGCTGAGACCGGACGCCACCAATATTCCGCTGGTATTTTATGCGCAATATGTCGCCACCGCTAATTCTGTCGGGGCAGGAACCGCTAATTCTCAGGCAACCTTTACGCTGGAATATCTTTAATATTAATTTTTCAGGAACAACATAATGATAAAGAATAAATTACTGACAGG