Homologs in group_1950

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14640 FBDBKF_14640 65.7 Morganella morganii S1 hisC Histidinol-phosphate/aromatic aminotransferase or cobyric acid decarboxylase
EHELCC_15445 EHELCC_15445 65.7 Morganella morganii S2 hisC Histidinol-phosphate/aromatic aminotransferase or cobyric acid decarboxylase
NLDBIP_15975 NLDBIP_15975 65.7 Morganella morganii S4 hisC Histidinol-phosphate/aromatic aminotransferase or cobyric acid decarboxylase
LHKJJB_15865 LHKJJB_15865 65.7 Morganella morganii S3 hisC Histidinol-phosphate/aromatic aminotransferase or cobyric acid decarboxylase
HKOGLL_14985 HKOGLL_14985 65.7 Morganella morganii S5 hisC Histidinol-phosphate/aromatic aminotransferase or cobyric acid decarboxylase
F4V73_RS07435 F4V73_RS07435 62.6 Morganella psychrotolerans - aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme

Distribution of the homologs in the orthogroup group_1950

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1950

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q2RL44 2.4e-53 184 32 7 368 3 hisC Histidinol-phosphate aminotransferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
C0ZCE7 3.9e-48 170 32 6 351 3 hisC Histidinol-phosphate aminotransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q9KCA8 5.06e-43 156 30 8 349 3 hisC Histidinol-phosphate aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A7Z614 1.11e-42 155 31 8 352 3 hisC Histidinol-phosphate aminotransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q3JEN8 2.23e-42 155 34 9 341 3 hisC1 Histidinol-phosphate aminotransferase 1 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q8Y0Y8 2.75e-41 152 32 6 334 3 hisC2 Histidinol-phosphate aminotransferase 2 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q82XE0 3.61e-41 152 30 6 352 3 hisC2 Histidinol-phosphate aminotransferase 2 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q31GD4 4.98e-41 151 33 10 341 3 hisC2 Histidinol-phosphate aminotransferase 2 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A7HCR6 6.01e-40 148 32 6 335 3 hisC Histidinol-phosphate aminotransferase Anaeromyxobacter sp. (strain Fw109-5)
Q2Y6Y6 1.54e-39 148 31 7 336 3 hisC2 Histidinol-phosphate aminotransferase 2 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q5QZ49 1.95e-39 147 30 9 356 3 hisC1 Histidinol-phosphate aminotransferase 1 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B1HTD4 1.15e-38 145 31 9 320 3 hisC Histidinol-phosphate aminotransferase Lysinibacillus sphaericus (strain C3-41)
Q0BVW4 1.6e-38 144 29 7 351 3 hisC Histidinol-phosphate aminotransferase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
P17731 1.68e-38 144 30 7 336 3 hisC Histidinol-phosphate aminotransferase Bacillus subtilis (strain 168)
Q8KZ92 1.75e-38 144 30 7 336 3 hisC Histidinol-phosphate aminotransferase Bacillus subtilis subsp. natto
Q7VIJ3 2.68e-38 144 31 2 288 3 hisC Histidinol-phosphate aminotransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
P60998 1.22e-37 142 31 7 330 3 hisC Histidinol-phosphate aminotransferase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q46Y48 1.98e-37 142 31 6 335 3 hisC1 Histidinol-phosphate aminotransferase 1 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A8FEJ6 2.21e-37 141 28 6 335 3 hisC Histidinol-phosphate aminotransferase Bacillus pumilus (strain SAFR-032)
O07131 1.93e-36 139 30 6 333 3 hisC Histidinol-phosphate aminotransferase Methylobacillus flagellatus
A4XMY1 2.67e-36 138 28 5 348 3 hisC Histidinol-phosphate aminotransferase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q9CMI7 2.92e-36 138 29 7 334 3 hisC2 Histidinol-phosphate aminotransferase 2 Pasteurella multocida (strain Pm70)
P34037 2.97e-36 138 31 8 335 1 hisC Histidinol-phosphate aminotransferase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q65I37 4.8e-36 138 30 6 346 3 hisC Histidinol-phosphate aminotransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q57004 1.13e-35 137 27 6 336 3 hisC2 Histidinol-phosphate aminotransferase 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QLD1 1.19e-35 137 27 6 336 3 hisC2 Histidinol-phosphate aminotransferase 2 Haemophilus influenzae (strain 86-028NP)
Q47GP2 1.43e-35 136 30 9 334 3 hisC1 Histidinol-phosphate aminotransferase 1 Dechloromonas aromatica (strain RCB)
Q03VY3 1.61e-35 136 30 12 355 3 hisC Histidinol-phosphate aminotransferase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q3K8U2 6.02e-35 135 31 9 341 3 hisC2 Histidinol-phosphate aminotransferase 2 Pseudomonas fluorescens (strain Pf0-1)
Q73AX7 8.63e-35 134 29 8 334 3 hisC1 Histidinol-phosphate aminotransferase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q5WGR9 1.01e-34 134 30 7 349 3 hisC Histidinol-phosphate aminotransferase Shouchella clausii (strain KSM-K16)
B9KDN6 2.72e-34 133 29 6 329 3 hisC Histidinol-phosphate aminotransferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A8MEH2 3.92e-34 133 28 7 340 3 hisC Histidinol-phosphate aminotransferase Alkaliphilus oremlandii (strain OhILAs)
Q49VS0 5.55e-34 132 29 7 331 3 hisC Histidinol-phosphate aminotransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q81SV5 7.34e-34 132 29 8 334 3 hisC1 Histidinol-phosphate aminotransferase 1 Bacillus anthracis
Q6HL37 7.96e-34 132 29 8 334 3 hisC1 Histidinol-phosphate aminotransferase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
A7H084 8.72e-34 132 32 7 295 3 hisC Histidinol-phosphate aminotransferase Campylobacter curvus (strain 525.92)
B6IYQ0 1.24e-33 131 30 7 343 3 hisC Histidinol-phosphate aminotransferase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q6GIR8 2.26e-33 130 29 7 332 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain MRSA252)
Q5HR08 2.8e-33 130 28 7 332 3 hisC Histidinol-phosphate aminotransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CTG8 2.95e-33 130 28 7 332 3 hisC Histidinol-phosphate aminotransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q2YSI3 3.07e-33 130 30 7 332 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q63DL4 3.13e-33 130 28 8 334 3 hisC1 Histidinol-phosphate aminotransferase 1 Bacillus cereus (strain ZK / E33L)
Q4L4E7 3.14e-33 130 30 8 335 3 hisC Histidinol-phosphate aminotransferase Staphylococcus haemolyticus (strain JCSC1435)
B3DXN2 7.54e-33 129 30 6 323 3 hisC Histidinol-phosphate aminotransferase Methylacidiphilum infernorum (isolate V4)
A8YZZ5 9.28e-33 129 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain USA300 / TCH1516)
P67725 9.28e-33 129 30 8 333 1 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain N315)
P67724 9.28e-33 129 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QF32 9.28e-33 129 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain Newman)
Q5HHU9 9.28e-33 129 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain COL)
A5IQS7 9.28e-33 129 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain JH9)
Q2G087 9.28e-33 129 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIR7 9.28e-33 129 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain USA300)
A6TZK2 9.28e-33 129 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain JH1)
A7WZL0 9.28e-33 129 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B2GBR8 9.42e-33 129 29 9 338 3 hisC Histidinol-phosphate aminotransferase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q736A5 1.17e-32 129 28 9 331 3 hisC2 Histidinol-phosphate aminotransferase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8NXN3 1.2e-32 128 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain MW2)
Q6GBA6 1.2e-32 128 30 8 333 3 hisC Histidinol-phosphate aminotransferase Staphylococcus aureus (strain MSSA476)
Q4K8N0 2.43e-32 128 30 8 333 3 hisC2 Histidinol-phosphate aminotransferase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B7GHJ8 2.5e-32 128 27 7 346 3 hisC Histidinol-phosphate aminotransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A7ZCF3 3.08e-32 127 28 8 359 3 hisC Histidinol-phosphate aminotransferase Campylobacter concisus (strain 13826)
P17736 4.05e-32 127 31 9 314 3 hisC Histidinol-phosphate aminotransferase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q3AAT6 4.3e-32 127 29 6 331 3 hisC2 Histidinol-phosphate aminotransferase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A7GN55 4.48e-32 127 27 5 329 3 hisC Histidinol-phosphate aminotransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2RP86 5.04e-32 127 28 8 353 3 hisC Histidinol-phosphate aminotransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q4FP52 6.11e-32 127 27 7 368 3 hisC Histidinol-phosphate aminotransferase Pelagibacter ubique (strain HTCC1062)
B9DK21 1.05e-31 126 28 6 331 3 hisC Histidinol-phosphate aminotransferase Staphylococcus carnosus (strain TM300)
Q5LNM6 1.6e-31 125 30 8 345 3 hisC Histidinol-phosphate aminotransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B1MFC0 1.67e-31 125 31 11 316 3 pat Putative phenylalanine aminotransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q930J0 1.77e-31 125 29 8 345 3 hisC3 Histidinol-phosphate aminotransferase 3 Rhizobium meliloti (strain 1021)
Q1GP30 1.89e-31 125 32 12 352 3 hisC Histidinol-phosphate aminotransferase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q89GX0 2.01e-31 125 29 12 344 3 hisC1 Histidinol-phosphate aminotransferase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2N7G6 2.23e-31 125 29 7 342 3 hisC Histidinol-phosphate aminotransferase Erythrobacter litoralis (strain HTCC2594)
C1KWM5 2.81e-31 125 28 9 341 3 hisC Histidinol-phosphate aminotransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
B1JBC0 3.43e-31 124 31 13 330 3 hisC Histidinol-phosphate aminotransferase Pseudomonas putida (strain W619)
Q2W047 3.6e-31 124 30 8 344 3 hisC Histidinol-phosphate aminotransferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q67KI2 4.34e-31 124 29 6 337 3 hisC Histidinol-phosphate aminotransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q2GAI1 5.15e-31 124 30 9 343 3 hisC Histidinol-phosphate aminotransferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
P45358 7.53e-31 124 30 10 342 3 hisC Histidinol-phosphate aminotransferase Acetobacter pasteurianus
A5FVN2 8.08e-31 124 27 7 340 3 hisC Histidinol-phosphate aminotransferase Acidiphilium cryptum (strain JF-5)
P9WML5 8.31e-31 123 28 9 346 1 pat Putative phenylalanine aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WML4 8.31e-31 123 28 9 346 3 pat Putative phenylalanine aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9A1 8.31e-31 123 28 9 346 3 pat Putative phenylalanine aminotransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q8EQB9 8.41e-31 124 28 6 334 3 hisC2 Histidinol-phosphate aminotransferase 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C1AIM6 8.57e-31 123 28 9 346 3 pat Putative phenylalanine aminotransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KQA5 8.57e-31 123 28 9 346 3 pat Putative phenylalanine aminotransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7TVQ0 8.57e-31 123 28 9 346 3 pat Putative phenylalanine aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q81C43 8.62e-31 124 27 9 345 3 hisC2 Histidinol-phosphate aminotransferase 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B0KQJ6 1.08e-30 123 29 10 329 3 hisC Histidinol-phosphate aminotransferase Pseudomonas putida (strain GB-1)
Q88P86 1.19e-30 123 30 12 330 3 hisC Histidinol-phosphate aminotransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q65S79 1.35e-30 123 28 6 325 3 hisC1 Histidinol-phosphate aminotransferase 1 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q163G3 1.77e-30 122 28 8 351 3 hisC Histidinol-phosphate aminotransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q71Y90 1.82e-30 122 28 9 341 3 hisC Histidinol-phosphate aminotransferase Listeria monocytogenes serotype 4b (strain F2365)
Q6ABU3 2.1e-30 122 26 5 344 3 pat Putative phenylalanine aminotransferase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q9HZ68 3.25e-30 122 30 9 334 3 hisC2 Histidinol-phosphate aminotransferase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9A671 3.71e-30 122 29 10 351 3 hisC1 Histidinol-phosphate aminotransferase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9HQS0 3.86e-30 122 30 15 349 3 hisC Histidinol-phosphate aminotransferase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4Q4 3.86e-30 122 30 15 349 3 hisC Histidinol-phosphate aminotransferase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q58365 6.3e-30 121 27 10 347 3 hisC Histidinol-phosphate aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A5VZ57 6.54e-30 121 30 12 330 3 hisC Histidinol-phosphate aminotransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q63A05 6.59e-30 121 28 12 347 3 hisC2 Histidinol-phosphate aminotransferase 2 Bacillus cereus (strain ZK / E33L)
A6UTL8 6.95e-30 121 26 8 347 3 hisC Histidinol-phosphate aminotransferase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
P55683 7.24e-30 121 28 11 343 3 hisC Histidinol-phosphate aminotransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B8DC01 7.29e-30 121 28 9 341 3 hisC Histidinol-phosphate aminotransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q92L21 7.87e-30 120 30 10 340 3 hisC2 Histidinol-phosphate aminotransferase 2 Rhizobium meliloti (strain 1021)
Q82FJ1 8.69e-30 120 28 6 338 3 pat Putative phenylalanine aminotransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A0Q9F3 9.63e-30 120 29 8 334 3 pat Putative phenylalanine aminotransferase Mycobacterium avium (strain 104)
Q311Z4 1.34e-29 120 27 7 339 3 hisC Histidinol-phosphate aminotransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q92A83 1.51e-29 120 28 10 342 1 hisC Histidinol-phosphate aminotransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
C5D3D2 2.07e-29 120 30 13 342 3 hisC Histidinol-phosphate aminotransferase Geobacillus sp. (strain WCH70)
Q8Y5X8 2.13e-29 120 28 10 342 3 hisC Histidinol-phosphate aminotransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A5CZ78 2.29e-29 119 30 9 337 3 hisC Histidinol-phosphate aminotransferase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
P61003 2.33e-29 120 26 8 350 3 hisC Histidinol-phosphate aminotransferase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q2JPM4 3.33e-29 119 31 12 312 3 hisC Histidinol-phosphate aminotransferase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q6HHF6 3.56e-29 119 27 12 347 3 hisC2 Histidinol-phosphate aminotransferase 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
B2UPR9 3.74e-29 119 29 4 341 3 hisC Histidinol-phosphate aminotransferase Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q1IE97 4.09e-29 119 30 11 330 3 hisC Histidinol-phosphate aminotransferase Pseudomonas entomophila (strain L48)
Q81P62 4.86e-29 119 28 12 347 3 hisC2 Histidinol-phosphate aminotransferase 2 Bacillus anthracis
P61005 5.65e-29 118 29 8 334 3 pat Putative phenylalanine aminotransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9RI00 5.71e-29 119 29 9 341 3 hisC Histidinol-phosphate aminotransferase Stutzerimonas stutzeri
Q98B00 6.83e-29 118 29 11 334 3 hisC3 Histidinol-phosphate aminotransferase 3 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B9EAC1 7.09e-29 118 29 11 337 3 hisC Histidinol-phosphate aminotransferase Macrococcus caseolyticus (strain JCSC5402)
C0R1Z0 7.22e-29 118 28 12 368 3 hisC Histidinol-phosphate aminotransferase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q4FSH2 8.63e-29 118 27 6 339 3 hisC1 Histidinol-phosphate aminotransferase 1 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q6AQK2 9.49e-29 118 28 10 338 3 hisC Histidinol-phosphate aminotransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q88UE6 1.06e-28 117 28 9 345 3 hisC Histidinol-phosphate aminotransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9ZBY8 1.07e-28 118 27 6 354 3 pat Putative phenylalanine aminotransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A9AA96 1.37e-28 117 27 8 348 3 hisC Histidinol-phosphate aminotransferase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Q18F03 1.5e-28 117 30 10 308 3 hisC Histidinol-phosphate aminotransferase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q3MAX6 1.51e-28 118 29 12 347 3 hisC2 Histidinol-phosphate aminotransferase 2 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A4WUN9 1.61e-28 117 28 9 349 3 hisC Histidinol-phosphate aminotransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q8YMG7 1.64e-28 117 29 14 348 3 hisC2 Histidinol-phosphate aminotransferase 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A0AK37 1.72e-28 117 27 10 345 3 hisC Histidinol-phosphate aminotransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A6LUF3 1.76e-28 117 29 10 340 3 hisC Histidinol-phosphate aminotransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q608S3 1.97e-28 117 28 8 336 3 hisC2 Histidinol-phosphate aminotransferase 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q28TL1 2.08e-28 117 28 8 340 3 hisC Histidinol-phosphate aminotransferase Jannaschia sp. (strain CCS1)
A0R5X8 2.13e-28 117 27 8 327 1 pat Putative phenylalanine aminotransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q31PF9 2.53e-28 117 27 13 352 3 hisC Histidinol-phosphate aminotransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5P791 2.63e-28 117 29 13 346 3 hisC Histidinol-phosphate aminotransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q987C8 2.65e-28 117 26 7 337 3 hisC1 Histidinol-phosphate aminotransferase 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A4FWW1 2.79e-28 117 26 8 348 3 hisC Histidinol-phosphate aminotransferase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q5N4R3 2.8e-28 117 27 13 352 3 hisC Histidinol-phosphate aminotransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
A1VEW4 2.91e-28 117 26 7 335 3 hisC Histidinol-phosphate aminotransferase Nitratidesulfovibrio vulgaris (strain DP4)
A8FKA6 3.25e-28 116 26 6 329 3 hisC Histidinol-phosphate aminotransferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q0AM22 3.77e-28 116 30 6 290 3 hisC Histidinol-phosphate aminotransferase Maricaulis maris (strain MCS10)
B9KPH4 3.9e-28 116 27 9 349 3 hisC Histidinol-phosphate aminotransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q5HWF4 4.18e-28 116 26 6 329 3 hisC Histidinol-phosphate aminotransferase Campylobacter jejuni (strain RM1221)
Q1AY33 4.3e-28 116 31 8 338 3 hisC Histidinol-phosphate aminotransferase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q2JTG5 4.63e-28 116 30 12 316 3 hisC Histidinol-phosphate aminotransferase Synechococcus sp. (strain JA-3-3Ab)
Q11DR9 4.67e-28 116 29 8 351 3 hisC Histidinol-phosphate aminotransferase Chelativorans sp. (strain BNC1)
Q3J445 4.72e-28 116 27 9 349 3 hisC Histidinol-phosphate aminotransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B1N009 5.99e-28 115 28 11 350 3 hisC Histidinol-phosphate aminotransferase Leuconostoc citreum (strain KM20)
Q5KXV3 6.03e-28 115 32 7 282 3 hisC Histidinol-phosphate aminotransferase Geobacillus kaustophilus (strain HTA426)
Q3SI68 6.42e-28 115 30 15 372 3 hisC2 Histidinol-phosphate aminotransferase 2 Thiobacillus denitrificans (strain ATCC 25259)
B7I6C5 7.05e-28 115 29 14 351 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain AB0057)
B7GZI3 7.05e-28 115 29 14 351 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain AB307-0294)
B0VV21 7.2e-28 115 29 14 351 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain SDF)
Q4ZNW0 9.08e-28 115 29 12 341 3 hisC Histidinol-phosphate aminotransferase Pseudomonas syringae pv. syringae (strain B728a)
A0RMN9 9.91e-28 115 26 6 335 3 hisC Histidinol-phosphate aminotransferase Campylobacter fetus subsp. fetus (strain 82-40)
Q5FRR4 9.91e-28 116 25 6 343 3 hisC1 Histidinol-phosphate aminotransferase 1 Gluconobacter oxydans (strain 621H)
Q8TH25 1.13e-27 114 28 11 340 3 hisC Histidinol-phosphate aminotransferase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q62FC0 1.23e-27 115 31 13 349 3 hisC2 Histidinol-phosphate aminotransferase 2 Burkholderia mallei (strain ATCC 23344)
Q97ES6 1.24e-27 115 28 11 341 3 hisC Histidinol-phosphate aminotransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A1VY36 1.26e-27 115 26 6 329 3 hisC Histidinol-phosphate aminotransferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q5Z3C0 1.36e-27 115 27 5 308 3 pat Putative phenylalanine aminotransferase Nocardia farcinica (strain IFM 10152)
Q63XM1 1.72e-27 114 31 13 349 3 hisC1 Histidinol-phosphate aminotransferase 1 Burkholderia pseudomallei (strain K96243)
Q3JW89 1.72e-27 114 31 13 349 3 hisC1 Histidinol-phosphate aminotransferase 1 Burkholderia pseudomallei (strain 1710b)
Q72DA0 1.84e-27 114 26 7 335 1 hisC Histidinol-phosphate aminotransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q2NEQ0 1.93e-27 114 26 13 358 3 hisC Histidinol-phosphate aminotransferase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
A4IQ80 1.95e-27 114 29 10 343 3 hisC Histidinol-phosphate aminotransferase Geobacillus thermodenitrificans (strain NG80-2)
A3PIA4 2.33e-27 114 27 9 349 3 hisC Histidinol-phosphate aminotransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q1R089 2.35e-27 114 28 13 350 3 hisC Histidinol-phosphate aminotransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A6Q1Z5 2.62e-27 114 26 5 342 3 hisC Histidinol-phosphate aminotransferase Nitratiruptor sp. (strain SB155-2)
P61000 2.77e-27 114 28 9 339 3 hisC Histidinol-phosphate aminotransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8DTQ4 2.78e-27 114 29 12 344 3 hisC Histidinol-phosphate aminotransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A6VUD3 3.18e-27 114 30 13 342 3 hisC Histidinol-phosphate aminotransferase Marinomonas sp. (strain MWYL1)
Q46E46 3.29e-27 114 32 10 290 3 hisC Histidinol-phosphate aminotransferase Methanosarcina barkeri (strain Fusaro / DSM 804)
A1TGS6 3.84e-27 113 26 9 338 3 pat Putative phenylalanine aminotransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A8EWM9 4.13e-27 114 25 7 347 3 hisC Histidinol-phosphate aminotransferase Aliarcobacter butzleri (strain RM4018)
Q5WV43 4.94e-27 113 27 5 333 3 hisC2 Histidinol-phosphate aminotransferase 2 Legionella pneumophila (strain Lens)
A8LK96 5.08e-27 113 30 9 335 3 hisC Histidinol-phosphate aminotransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q9A5B6 5.75e-27 113 29 9 327 3 hisC2 Histidinol-phosphate aminotransferase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q39YP6 6.24e-27 112 28 13 344 1 hisC Histidinol-phosphate aminotransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q11VM5 7.77e-27 112 28 11 353 3 hisC Histidinol-phosphate aminotransferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A7H556 7.93e-27 112 25 6 329 3 hisC Histidinol-phosphate aminotransferase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q03K75 7.94e-27 112 28 12 351 3 hisC Histidinol-phosphate aminotransferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q8R5Q4 1.1e-26 112 28 9 314 1 hisC Histidinol-phosphate aminotransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A9H311 1.16e-26 112 28 11 349 3 hisC Histidinol-phosphate aminotransferase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B2HLJ8 1.19e-26 112 29 8 330 3 pat Putative phenylalanine aminotransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q7M7Y6 1.24e-26 112 25 3 298 3 hisC Histidinol-phosphate aminotransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P61004 1.47e-26 111 28 7 306 3 pat Putative phenylalanine aminotransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q5X3Q5 1.54e-26 112 27 5 333 3 hisC2 Histidinol-phosphate aminotransferase 2 Legionella pneumophila (strain Paris)
Q2LST8 1.56e-26 112 28 13 351 3 hisC Histidinol-phosphate aminotransferase Syntrophus aciditrophicus (strain SB)
Q9PII2 1.63e-26 112 25 6 329 1 hisC Histidinol-phosphate aminotransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1R558 1.74e-26 112 31 12 346 3 hisC Histidinol-phosphate aminotransferase Paenarthrobacter aurescens (strain TC1)
A3M2I8 1.77e-26 112 29 15 352 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q07IG8 2.06e-26 111 28 9 345 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain BisA53)
Q8ESS3 2.44e-26 111 29 13 345 3 hisC1 Histidinol-phosphate aminotransferase 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q3IRT1 2.51e-26 111 27 12 350 3 hisC Histidinol-phosphate aminotransferase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q3AD52 2.68e-26 111 29 8 307 3 hisC1 Histidinol-phosphate aminotransferase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P0DI07 2.68e-26 112 27 9 343 1 HISN6B Histidinol-phosphate aminotransferase 2, chloroplastic Arabidopsis thaliana
B9DHD3 2.68e-26 112 27 9 343 1 HISN6A Histidinol-phosphate aminotransferase 1, chloroplastic Arabidopsis thaliana
Q7VQW9 2.87e-26 111 25 9 315 3 hisC Histidinol-phosphate aminotransferase Blochmanniella floridana
A6VGF6 3.18e-26 111 25 8 348 3 hisC Histidinol-phosphate aminotransferase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Q5ZU10 3.42e-26 111 27 5 333 3 hisC2 Histidinol-phosphate aminotransferase 2 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A0PVN0 4.7e-26 110 28 8 330 3 pat Putative phenylalanine aminotransferase Mycobacterium ulcerans (strain Agy99)
B0V7Q2 4.7e-26 110 30 16 352 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain AYE)
B2HTW5 4.7e-26 110 30 16 352 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baumannii (strain ACICU)
Q8U9W3 4.72e-26 110 29 7 342 3 hisC Histidinol-phosphate aminotransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8PX17 4.86e-26 110 29 12 345 3 hisC Histidinol-phosphate aminotransferase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q0S962 5.49e-26 110 30 5 329 3 pat Putative phenylalanine aminotransferase Rhodococcus jostii (strain RHA1)
B1VP97 6.03e-26 110 28 6 312 3 pat Putative phenylalanine aminotransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q6FEC7 6.16e-26 110 29 12 353 3 hisC Histidinol-phosphate aminotransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q3KHZ1 6.95e-26 110 28 10 341 3 hisC1 Histidinol-phosphate aminotransferase 1 Pseudomonas fluorescens (strain Pf0-1)
C5A7A4 7.47e-26 109 26 11 352 3 hisC Histidinol-phosphate aminotransferase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Q47KH1 7.59e-26 110 28 9 336 3 pat Putative phenylalanine aminotransferase Thermobifida fusca (strain YX)
Q30TC9 8.5e-26 110 23 8 347 3 hisC Histidinol-phosphate aminotransferase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q24QJ1 8.76e-26 110 28 11 347 3 hisC Histidinol-phosphate aminotransferase Desulfitobacterium hafniense (strain Y51)
Q4FQF9 8.9e-26 110 29 15 355 3 hisC2 Histidinol-phosphate aminotransferase 2 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q4KI72 9.1e-26 109 28 11 341 3 hisC1 Histidinol-phosphate aminotransferase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B9LNJ8 1.12e-25 109 28 14 365 3 hisC Histidinol-phosphate aminotransferase Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)
O27624 1.34e-25 109 27 10 344 3 hisC Histidinol-phosphate aminotransferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q84I53 1.65e-25 109 25 9 343 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Diuraphis noxia
Q20YH9 1.93e-25 108 27 7 342 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain BisB18)
A5UKY0 1.96e-25 108 26 13 377 3 hisC Histidinol-phosphate aminotransferase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q39CT7 2.27e-25 108 30 13 350 3 hisC2 Histidinol-phosphate aminotransferase 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q48ED0 2.44e-25 108 28 12 340 3 hisC Histidinol-phosphate aminotransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q0P8H7 2.44e-25 108 26 12 359 1 Cj1437c Dihydroxyacetone phosphate transaminase Cj1437c Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q81FQ1 2.6e-25 108 28 8 334 3 hisC1 Histidinol-phosphate aminotransferase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q87WV6 2.89e-25 108 28 12 340 3 hisC Histidinol-phosphate aminotransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7VWL5 3.04e-25 108 28 12 343 3 hisC1 Histidinol-phosphate aminotransferase 1 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8KD01 3.22e-25 108 25 9 339 3 hisC Histidinol-phosphate aminotransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A7ZNJ3 3.56e-25 108 27 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3SK85 4.43e-25 108 31 5 299 3 hisC1 Histidinol-phosphate aminotransferase 1 Thiobacillus denitrificans (strain ATCC 25259)
C6DF75 4.77e-25 107 27 8 313 3 hisC Histidinol-phosphate aminotransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q3A7R3 5.12e-25 107 26 9 346 3 hisC Histidinol-phosphate aminotransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q89UL9 6.09e-25 107 26 7 342 3 hisC2 Histidinol-phosphate aminotransferase 2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8A1P5 6.66e-25 107 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O9:H4 (strain HS)
B8FP20 8.26e-25 107 26 8 343 3 hisC Histidinol-phosphate aminotransferase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A3Q7J9 8.44e-25 107 27 13 346 3 pat Putative phenylalanine aminotransferase Mycobacterium sp. (strain JLS)
Q1B1Z8 8.61e-25 107 27 13 346 3 pat Putative phenylalanine aminotransferase Mycobacterium sp. (strain MCS)
A1UN51 8.61e-25 107 27 13 346 3 pat Putative phenylalanine aminotransferase Mycobacterium sp. (strain KMS)
B0K735 9.11e-25 107 29 9 311 3 hisC Histidinol-phosphate aminotransferase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B5XPE6 9.86e-25 107 26 8 310 3 hisC Histidinol-phosphate aminotransferase Klebsiella pneumoniae (strain 342)
B7NQG9 9.99e-25 107 27 8 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q1GET3 1.02e-24 107 27 8 341 3 hisC Histidinol-phosphate aminotransferase Ruegeria sp. (strain TM1040)
Q83KJ6 1.1e-24 107 27 7 311 3 hisC Histidinol-phosphate aminotransferase Shigella flexneri
Q0T3A6 1.1e-24 107 27 7 311 3 hisC Histidinol-phosphate aminotransferase Shigella flexneri serotype 5b (strain 8401)
B1IZ53 1.19e-24 106 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7MWU0 1.37e-24 106 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O81 (strain ED1a)
Q2IS68 1.53e-24 106 26 7 345 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain HaA2)
P73807 1.54e-24 106 27 11 339 3 hisC Histidinol-phosphate aminotransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O28255 1.61e-24 106 27 12 340 3 hisC2 Histidinol-phosphate aminotransferase 2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
B6I848 1.62e-24 106 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain SE11)
P06986 1.62e-24 106 26 7 311 1 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain K12)
B1X6V8 1.62e-24 106 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain K12 / DH10B)
C4ZSB0 1.62e-24 106 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M400 1.62e-24 106 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O8 (strain IAI1)
A3CNT7 1.63e-24 106 27 10 348 3 hisC Histidinol-phosphate aminotransferase Streptococcus sanguinis (strain SK36)
A6GY79 1.63e-24 106 27 6 308 3 hisC Histidinol-phosphate aminotransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q8FU28 1.8e-24 105 30 10 320 3 pat Putative phenylalanine aminotransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A7I2V8 1.83e-24 106 27 6 325 3 hisC Histidinol-phosphate aminotransferase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q3SV41 1.9e-24 106 26 7 345 3 hisC Histidinol-phosphate aminotransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B0K625 1.95e-24 105 27 7 310 3 hisC Histidinol-phosphate aminotransferase Thermoanaerobacter sp. (strain X514)
Q9FEW2 1.97e-24 107 27 9 343 1 HPA Histidinol-phosphate aminotransferase, chloroplastic Nicotiana plumbaginifolia
Q3Z0G4 2.1e-24 105 27 8 311 3 hisC Histidinol-phosphate aminotransferase Shigella sonnei (strain Ss046)
Q32EF0 2.21e-24 105 26 7 311 3 hisC Histidinol-phosphate aminotransferase Shigella dysenteriae serotype 1 (strain Sd197)
A8AEK3 2.47e-24 105 27 8 311 3 hisC Histidinol-phosphate aminotransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7MDH5 2.83e-24 105 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7L9P8 2.85e-24 105 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain 55989 / EAEC)
Q1QQD5 3.23e-24 105 27 7 345 3 hisC Histidinol-phosphate aminotransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A1ACN3 3.28e-24 105 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O1:K1 / APEC
B2IDA4 3.37e-24 105 28 7 342 3 hisC Histidinol-phosphate aminotransferase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B5YU77 3.99e-24 105 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q9S5G6 3.99e-24 105 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O157:H7
Q8TVG3 4e-24 105 27 13 355 3 hisC Histidinol-phosphate aminotransferase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q8TUE9 4.33e-24 105 31 17 338 3 hisC Histidinol-phosphate aminotransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q1RA52 5.48e-24 104 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain UTI89 / UPEC)
Q8FG51 5.48e-24 104 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TG66 5.48e-24 104 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7LUF2 5.59e-24 104 25 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A6UPL6 5.62e-24 105 25 8 346 3 hisC Histidinol-phosphate aminotransferase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
O82030 5.75e-24 105 27 9 343 2 HPA Histidinol-phosphate aminotransferase, chloroplastic Nicotiana tabacum
B7UT58 5.76e-24 104 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q51687 6.24e-24 105 28 10 331 3 hisC Histidinol-phosphate aminotransferase Paracoccus denitrificans (strain Pd 1222)
A6LAM2 6.48e-24 104 26 7 352 3 hisC Histidinol-phosphate aminotransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B1LP20 6.61e-24 104 26 7 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli (strain SMS-3-5 / SECEC)
B7NC61 7.15e-24 104 27 8 311 3 hisC Histidinol-phosphate aminotransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q9ZHE5 7.63e-24 104 26 10 340 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A8AY31 8.16e-24 104 27 11 341 3 hisC Histidinol-phosphate aminotransferase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q323J1 8.29e-24 104 26 7 311 3 hisC Histidinol-phosphate aminotransferase Shigella boydii serotype 4 (strain Sb227)
B2TYF9 8.54e-24 104 27 8 311 3 hisC Histidinol-phosphate aminotransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q04Z75 8.72e-24 104 27 10 341 3 hisC Histidinol-phosphate aminotransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04QW8 8.72e-24 104 27 10 341 3 hisC Histidinol-phosphate aminotransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B8I5V1 8.87e-24 104 26 8 337 3 hisC Histidinol-phosphate aminotransferase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q131B9 1.04e-23 104 27 9 347 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain BisB5)
A0KKB7 1.14e-23 103 27 9 314 3 hisC Histidinol-phosphate aminotransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q492K2 1.23e-23 103 23 8 315 3 hisC Histidinol-phosphate aminotransferase Blochmanniella pennsylvanica (strain BPEN)
Q7UNC3 1.35e-23 103 27 9 329 3 hisC Histidinol-phosphate aminotransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A6QBY8 1.4e-23 103 26 9 325 3 hisC Histidinol-phosphate aminotransferase Sulfurovum sp. (strain NBC37-1)
Q82AA5 1.63e-23 103 25 8 353 3 hisC Histidinol-phosphate aminotransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8NTT4 2.08e-23 103 30 11 329 3 pat Probable phenylalanine aminotransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A6TBC4 2.09e-23 103 25 8 310 1 hisC Histidinol-phosphate aminotransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q609W4 2.51e-23 103 28 13 356 3 hisC1 Histidinol-phosphate aminotransferase 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A4QAL4 2.51e-23 102 33 4 226 3 pat Putative phenylalanine aminotransferase Corynebacterium glutamicum (strain R)
Q7W6Q1 2.55e-23 103 28 12 343 3 hisC1 Histidinol-phosphate aminotransferase 1 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q9HVX0 2.68e-23 102 28 11 330 3 hisC1 Histidinol-phosphate aminotransferase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7WHN5 2.87e-23 102 28 12 343 3 hisC1 Histidinol-phosphate aminotransferase 1 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8ABA8 3.07e-23 102 27 8 323 3 hisC Histidinol-phosphate aminotransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q4UU41 3.11e-23 102 27 11 344 3 hisC Histidinol-phosphate aminotransferase Xanthomonas campestris pv. campestris (strain 8004)
P58892 3.3e-23 102 27 11 344 3 hisC Histidinol-phosphate aminotransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q47AL9 3.36e-23 102 27 10 347 3 hisC2 Histidinol-phosphate aminotransferase 2 Dechloromonas aromatica (strain RCB)
B3Q8Z5 3.6e-23 102 26 7 342 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain TIE-1)
P61002 3.6e-23 102 26 7 342 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B9LZ53 3.87e-23 102 29 13 351 3 hisC Histidinol-phosphate aminotransferase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q92MG0 4.69e-23 102 29 9 346 3 hisC1 Histidinol-phosphate aminotransferase 1 Rhizobium meliloti (strain 1021)
Q47QS8 4.95e-23 102 30 9 340 3 hisC Histidinol-phosphate aminotransferase Thermobifida fusca (strain YX)
B0RSL5 5.65e-23 102 27 11 344 3 hisC Histidinol-phosphate aminotransferase Xanthomonas campestris pv. campestris (strain B100)
B8HW95 5.96e-23 102 28 9 310 3 hisC Histidinol-phosphate aminotransferase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B3PCJ2 7e-23 101 28 13 342 3 hisC Histidinol-phosphate aminotransferase Cellvibrio japonicus (strain Ueda107)
Q02YW3 7.3e-23 101 27 12 342 3 hisC Histidinol-phosphate aminotransferase Lactococcus lactis subsp. cremoris (strain SK11)
Q5LAZ9 7.5e-23 101 27 7 317 3 hisC Histidinol-phosphate aminotransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64RE8 9.87e-23 101 27 7 317 3 hisC Histidinol-phosphate aminotransferase Bacteroides fragilis (strain YCH46)
Q98G10 9.98e-23 101 27 8 342 3 hisC2 Histidinol-phosphate aminotransferase 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
C1B997 1.15e-22 101 29 5 326 3 pat Putative phenylalanine aminotransferase Rhodococcus opacus (strain B4)
Q8Z5J9 1.26e-22 101 28 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella typhi
C0ZM44 1.28e-22 101 28 7 334 3 pat Putative phenylalanine aminotransferase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q6D410 1.33e-22 100 26 8 313 3 hisC Histidinol-phosphate aminotransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8DM42 1.43e-22 101 28 12 320 3 hisC Histidinol-phosphate aminotransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q3M504 2.16e-22 100 25 9 337 3 hisC1 Histidinol-phosphate aminotransferase 1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A7MJP4 2.88e-22 100 26 8 312 3 hisC Histidinol-phosphate aminotransferase Cronobacter sakazakii (strain ATCC BAA-894)
Q02135 4.14e-22 99 27 10 317 3 hisC Histidinol-phosphate aminotransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q5V4K3 4.56e-22 99 26 12 349 3 hisC Histidinol-phosphate aminotransferase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
A9ML15 4.64e-22 99 27 9 311 3 hisC Histidinol-phosphate aminotransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5FM42 5.86e-22 99 28 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella dublin (strain CT_02021853)
A3CWS8 6.72e-22 99 29 14 340 3 hisC Histidinol-phosphate aminotransferase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q8YV89 6.94e-22 99 25 10 340 3 hisC1 Histidinol-phosphate aminotransferase 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B4S8L6 7.09e-22 99 27 7 288 3 hisC Histidinol-phosphate aminotransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q4JSJ5 7.14e-22 99 27 7 340 3 pat Putative phenylalanine aminotransferase Corynebacterium jeikeium (strain K411)
Q7NL03 9.58e-22 98 28 8 308 3 hisC Histidinol-phosphate aminotransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A8HZS2 1.16e-21 98 28 8 342 3 hisC Histidinol-phosphate aminotransferase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
C3KVX5 1.2e-21 98 25 10 344 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain 657 / Type Ba4)
Q46WL3 1.29e-21 98 29 10 310 1 hisC2 Histidinol-phosphate aminotransferase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A4WC70 1.33e-21 98 25 8 337 3 hisC Histidinol-phosphate aminotransferase Enterobacter sp. (strain 638)
A4SE60 1.39e-21 98 26 10 336 3 hisC Histidinol-phosphate aminotransferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B4TMR6 1.47e-21 98 27 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella schwarzengrund (strain CVM19633)
B5RBR3 1.47e-21 98 27 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZL3 1.47e-21 98 27 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella enteritidis PT4 (strain P125109)
B5EX40 1.47e-21 98 27 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella agona (strain SL483)
C0Q1K1 1.48e-21 98 27 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella paratyphi C (strain RKS4594)
Q2J8K9 1.55e-21 98 29 12 350 3 hisC Histidinol-phosphate aminotransferase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
P16246 1.63e-21 98 25 9 354 3 hisC Histidinol-phosphate aminotransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q57MS2 1.78e-21 97 27 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella choleraesuis (strain SC-B67)
P57202 1.96e-21 97 26 10 346 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A9MSC2 2.02e-21 97 27 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SX42 2.02e-21 97 27 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella newport (strain SL254)
C1FN41 2.07e-21 97 25 12 348 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain Kyoto / Type A2)
B4T9N5 2.5e-21 97 27 9 311 3 hisC Histidinol-phosphate aminotransferase Salmonella heidelberg (strain SL476)
B8D707 2.52e-21 97 26 10 346 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D8Q3 2.52e-21 97 26 10 346 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P10369 2.63e-21 97 27 9 311 3 hisC Histidinol-phosphate aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3BUF6 2.98e-21 97 28 10 315 3 hisC Histidinol-phosphate aminotransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5FQA6 3.8e-21 97 27 10 343 3 hisC2 Histidinol-phosphate aminotransferase 2 Gluconobacter oxydans (strain 621H)
Q8F6W9 5.39e-21 96 24 7 341 3 hisC Histidinol-phosphate aminotransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PG3 5.39e-21 96 24 7 341 3 hisC Histidinol-phosphate aminotransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A4SMP7 5.45e-21 96 26 8 312 3 hisC Histidinol-phosphate aminotransferase Aeromonas salmonicida (strain A449)
B1ILA9 7e-21 96 26 13 348 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain Okra / Type B1)
B5BFB9 7.5e-21 96 27 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella paratyphi A (strain AKU_12601)
Q5PDP4 7.5e-21 96 27 10 319 3 hisC Histidinol-phosphate aminotransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A6L2V8 9.82e-21 95 27 7 345 3 hisC Histidinol-phosphate aminotransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B0JJJ7 1.01e-20 95 25 8 336 3 hisC Histidinol-phosphate aminotransferase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A5V022 1.04e-20 95 28 12 360 3 hisC Histidinol-phosphate aminotransferase Roseiflexus sp. (strain RS-1)
Q3B3L3 1.09e-20 95 26 10 334 3 hisC Histidinol-phosphate aminotransferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A1KV06 1.12e-20 95 27 10 315 3 hisC Histidinol-phosphate aminotransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JTH8 1.12e-20 95 27 10 315 3 hisC Histidinol-phosphate aminotransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M185 1.12e-20 95 27 10 315 3 hisC Histidinol-phosphate aminotransferase Neisseria meningitidis serogroup C (strain 053442)
A5G9G1 1.13e-20 95 27 12 351 3 hisC Histidinol-phosphate aminotransferase Geotalea uraniireducens (strain Rf4)
B5E9W9 1.33e-20 95 25 11 348 3 hisC Histidinol-phosphate aminotransferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A1JTV9 1.51e-20 95 25 6 310 3 hisC Histidinol-phosphate aminotransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7N6I1 1.6e-20 97 25 8 315 3 hisCD Putative histidine biosynthesis bifunctional protein HisCD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A2RKS5 1.91e-20 94 26 11 342 3 hisC Histidinol-phosphate aminotransferase Lactococcus lactis subsp. cremoris (strain MG1363)
A0PXP5 1.93e-20 94 25 10 334 3 hisC Histidinol-phosphate aminotransferase Clostridium novyi (strain NT)
Q89AX7 2.14e-20 94 26 5 238 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q4JW58 2.26e-20 94 30 12 314 3 hisC Histidinol-phosphate aminotransferase Corynebacterium jeikeium (strain K411)
A8GC78 2.76e-20 94 27 10 318 3 hisC Histidinol-phosphate aminotransferase Serratia proteamaculans (strain 568)
Q2YAU6 2.83e-20 94 28 11 318 3 hisC1 Histidinol-phosphate aminotransferase 1 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q2SBJ7 3.1e-20 94 28 10 306 3 hisC Histidinol-phosphate aminotransferase Hahella chejuensis (strain KCTC 2396)
A2SE05 3.13e-20 94 29 11 312 3 hisC Histidinol-phosphate aminotransferase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q65RB2 4.25e-20 94 25 11 339 3 hisC2 Histidinol-phosphate aminotransferase 2 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A5FFY0 4.45e-20 93 26 10 332 3 hisC Histidinol-phosphate aminotransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A5I245 4.54e-20 94 25 13 349 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FU81 4.54e-20 94 25 13 349 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain ATCC 19397 / Type A)
A5FR29 4.94e-20 93 26 10 350 3 hisC Histidinol-phosphate aminotransferase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
C3LU31 5.31e-20 93 31 5 193 3 hisC Histidinol-phosphate aminotransferase Vibrio cholerae serotype O1 (strain M66-2)
A5F2A2 5.31e-20 93 31 5 193 3 hisC Histidinol-phosphate aminotransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7JUI4 5.44e-20 93 24 9 341 3 hisC Histidinol-phosphate aminotransferase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q3ZXL8 5.54e-20 93 26 10 338 3 hisC Histidinol-phosphate aminotransferase Dehalococcoides mccartyi (strain CBDB1)
A0M287 8.04e-20 93 25 7 314 3 hisC Histidinol-phosphate aminotransferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q87QL0 8.21e-20 92 32 6 193 3 hisC Histidinol-phosphate aminotransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q10VS0 8.27e-20 93 29 7 231 3 hisC Histidinol-phosphate aminotransferase Trichodesmium erythraeum (strain IMS101)
A3Q130 8.77e-20 93 27 11 339 3 hisC Histidinol-phosphate aminotransferase Mycobacterium sp. (strain JLS)
Q2NTX2 1.16e-19 92 24 7 314 3 hisC Histidinol-phosphate aminotransferase Sodalis glossinidius (strain morsitans)
Q9JYH7 1.35e-19 92 26 11 317 3 hisC Histidinol-phosphate aminotransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
C6E916 1.63e-19 92 25 11 338 3 hisC Histidinol-phosphate aminotransferase Geobacter sp. (strain M21)
Q9KSX2 2e-19 91 30 5 193 3 hisC Histidinol-phosphate aminotransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B0UN04 2.03e-19 92 28 10 346 3 hisC Histidinol-phosphate aminotransferase Methylobacterium sp. (strain 4-46)
Q84I51 2.24e-19 92 25 12 322 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Schlechtendalia chinensis
Q1B7G5 2.33e-19 92 27 11 339 3 hisC Histidinol-phosphate aminotransferase Mycobacterium sp. (strain MCS)
A1UHK7 2.33e-19 92 27 11 339 3 hisC Histidinol-phosphate aminotransferase Mycobacterium sp. (strain KMS)
Q0C348 2.76e-19 91 26 9 345 3 hisC Histidinol-phosphate aminotransferase Hyphomonas neptunium (strain ATCC 15444)
Q8FY98 2.78e-19 91 27 7 343 3 hisC Histidinol-phosphate aminotransferase Brucella suis biovar 1 (strain 1330)
A5VSV7 2.78e-19 91 27 7 343 3 hisC Histidinol-phosphate aminotransferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q57AR7 2.78e-19 91 27 7 343 3 hisC Histidinol-phosphate aminotransferase Brucella abortus biovar 1 (strain 9-941)
Q2YR81 2.78e-19 91 27 7 343 3 hisC Histidinol-phosphate aminotransferase Brucella abortus (strain 2308)
Q5H0L0 2.89e-19 91 27 10 342 3 hisC Histidinol-phosphate aminotransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P3K2 2.89e-19 91 27 10 342 3 hisC Histidinol-phosphate aminotransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q66C50 3.07e-19 91 25 9 344 3 hisC Histidinol-phosphate aminotransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2JZM8 3.07e-19 91 25 9 344 3 hisC Histidinol-phosphate aminotransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q5X5X0 3.3e-19 91 25 7 306 3 hisC1 Histidinol-phosphate aminotransferase 1 Legionella pneumophila (strain Paris)
Q87C30 4.67e-19 90 25 10 318 3 hisC Histidinol-phosphate aminotransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5Y0 4.67e-19 90 25 10 318 3 hisC Histidinol-phosphate aminotransferase Xylella fastidiosa (strain M23)
B0U3B2 4.8e-19 90 25 10 318 3 hisC Histidinol-phosphate aminotransferase Xylella fastidiosa (strain M12)
Q31I36 4.96e-19 90 25 12 362 3 hisC1 Histidinol-phosphate aminotransferase 1 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9PBC6 5.44e-19 90 26 11 318 3 hisC Histidinol-phosphate aminotransferase Xylella fastidiosa (strain 9a5c)
A5N7Q7 6.2e-19 90 25 7 300 3 hisC Histidinol-phosphate aminotransferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E168 6.2e-19 90 25 7 300 3 hisC Histidinol-phosphate aminotransferase Clostridium kluyveri (strain NBRC 12016)
Q3Z879 6.88e-19 90 25 11 360 3 hisC Histidinol-phosphate aminotransferase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q5WX92 8.2e-19 90 25 7 306 3 hisC1 Histidinol-phosphate aminotransferase 1 Legionella pneumophila (strain Lens)
Q5ZW88 8.94e-19 90 26 7 304 3 hisC1 Histidinol-phosphate aminotransferase 1 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5JFU6 9.06e-19 89 27 10 310 3 hisC Histidinol-phosphate aminotransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q7W2Y3 1e-18 90 28 10 316 3 hisC2 Histidinol-phosphate aminotransferase 2 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDY3 1.07e-18 90 28 10 316 3 hisC2 Histidinol-phosphate aminotransferase 2 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B3QP11 1.13e-18 89 24 9 337 3 hisC Histidinol-phosphate aminotransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A1BGB4 1.22e-18 89 25 10 338 3 hisC Histidinol-phosphate aminotransferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A4TKK4 1.3e-18 89 25 9 344 3 hisC Histidinol-phosphate aminotransferase Yersinia pestis (strain Pestoides F)
Q1CGX0 1.3e-18 89 25 9 344 3 hisC Histidinol-phosphate aminotransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2K5 1.3e-18 89 25 9 344 3 hisC Histidinol-phosphate aminotransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFX6 1.3e-18 89 25 9 344 3 hisC Histidinol-phosphate aminotransferase Yersinia pestis
Q1C9R1 1.3e-18 89 25 9 344 3 hisC Histidinol-phosphate aminotransferase Yersinia pestis bv. Antiqua (strain Antiqua)
B4RJ05 1.34e-18 89 27 11 300 3 hisC Histidinol-phosphate aminotransferase Neisseria gonorrhoeae (strain NCCP11945)
Q5F7D7 1.34e-18 89 27 11 300 3 hisC Histidinol-phosphate aminotransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P58891 1.35e-18 89 26 9 315 3 hisC Histidinol-phosphate aminotransferase Xanthomonas axonopodis pv. citri (strain 306)
Q8YJK3 1.36e-18 89 27 7 343 3 hisC Histidinol-phosphate aminotransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
B1JPW1 1.43e-18 89 25 9 344 3 hisC Histidinol-phosphate aminotransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B2FPM0 1.97e-18 89 25 10 337 3 hisC Histidinol-phosphate aminotransferase Stenotrophomonas maltophilia (strain K279a)
Q8D8Q1 2.01e-18 89 30 5 193 3 hisC Histidinol-phosphate aminotransferase Vibrio vulnificus (strain CMCP6)
Q3J7H2 2.39e-18 89 30 11 318 3 hisC2 Histidinol-phosphate aminotransferase 2 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q7MLS5 2.52e-18 88 30 5 193 3 hisC Histidinol-phosphate aminotransferase Vibrio vulnificus (strain YJ016)
B3ECG2 3.02e-18 88 28 6 223 3 hisC Histidinol-phosphate aminotransferase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
O67857 3.05e-18 88 27 13 343 3 hisC Histidinol-phosphate aminotransferase Aquifex aeolicus (strain VF5)
A7GDQ6 3.17e-18 88 24 11 333 3 hisC Histidinol-phosphate aminotransferase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q8XV80 3.26e-18 88 29 12 316 3 hisC1 Histidinol-phosphate aminotransferase 1 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q39K90 3.52e-18 88 29 12 304 3 hisC1 Histidinol-phosphate aminotransferase 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1LT68 3.56e-18 88 23 9 307 3 hisC Histidinol-phosphate aminotransferase Baumannia cicadellinicola subsp. Homalodisca coagulata
A7MX17 4.11e-18 88 31 6 193 3 hisC Histidinol-phosphate aminotransferase Vibrio campbellii (strain ATCC BAA-1116)
A7FJH1 4.64e-18 88 25 9 344 3 hisC Histidinol-phosphate aminotransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7VSZ0 6.18e-18 87 28 10 316 3 hisC2 Histidinol-phosphate aminotransferase 2 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q39M27 6.23e-18 87 28 13 353 3 hisC3 Histidinol-phosphate aminotransferase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q47XB7 6.29e-18 87 32 7 200 3 hisC Histidinol-phosphate aminotransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q63Q87 7.55e-18 87 30 11 303 3 hisC2 Histidinol-phosphate aminotransferase 2 Burkholderia pseudomallei (strain K96243)
Q62GE0 7.55e-18 87 30 11 303 3 hisC1 Histidinol-phosphate aminotransferase 1 Burkholderia mallei (strain ATCC 23344)
Q6LT75 7.87e-18 87 27 4 193 3 hisC Histidinol-phosphate aminotransferase Photobacterium profundum (strain SS9)
A7ICA9 7.9e-18 87 27 8 343 3 hisC Histidinol-phosphate aminotransferase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q3JMZ7 7.99e-18 87 30 11 303 3 hisC2 Histidinol-phosphate aminotransferase 2 Burkholderia pseudomallei (strain 1710b)
B1WY56 9.01e-18 87 23 9 343 3 hisC Histidinol-phosphate aminotransferase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q3ARM7 9.31e-18 87 25 9 328 3 hisC Histidinol-phosphate aminotransferase Chlorobium chlorochromatii (strain CaD3)
Q12U08 1.25e-17 86 29 16 335 3 hisC Histidinol-phosphate aminotransferase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
B6EJ89 1.36e-17 86 26 4 200 3 hisC Histidinol-phosphate aminotransferase Aliivibrio salmonicida (strain LFI1238)
B0TY45 1.79e-17 86 24 5 278 3 hisC Histidinol-phosphate aminotransferase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B8IRU5 1.82e-17 86 28 9 345 3 hisC Histidinol-phosphate aminotransferase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A1VK38 1.93e-17 86 27 11 312 3 hisC Histidinol-phosphate aminotransferase Polaromonas naphthalenivorans (strain CJ2)
Q6ABX6 2.03e-17 86 26 3 282 3 pat Putative phenylalanine aminotransferase Leifsonia xyli subsp. xyli (strain CTCB07)
B4STN8 2.16e-17 86 25 9 312 3 hisC Histidinol-phosphate aminotransferase Stenotrophomonas maltophilia (strain R551-3)
Q8R5U4 2.2e-17 86 24 7 282 3 cobD Putative threonine-phosphate decarboxylase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q82WM3 2.83e-17 85 29 11 313 3 hisC1 Histidinol-phosphate aminotransferase 1 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q4QN73 2.99e-17 85 25 9 314 3 hisC1 Histidinol-phosphate aminotransferase 1 Haemophilus influenzae (strain 86-028NP)
A5UGY2 3.23e-17 85 25 9 314 3 hisC Histidinol-phosphate aminotransferase Haemophilus influenzae (strain PittGG)
A5UA19 3.48e-17 85 25 9 314 3 hisC Histidinol-phosphate aminotransferase Haemophilus influenzae (strain PittEE)
Q9CLM3 3.83e-17 85 23 8 313 3 hisC1 Histidinol-phosphate aminotransferase 1 Pasteurella multocida (strain Pm70)
P44423 3.99e-17 85 25 9 314 3 hisC1 Histidinol-phosphate aminotransferase 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B9MDV4 4.02e-17 85 27 14 348 3 hisC Histidinol-phosphate aminotransferase Acidovorax ebreus (strain TPSY)
A5CVR5 5.65e-17 84 26 10 314 3 hisC Histidinol-phosphate aminotransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
P9WML7 5.77e-17 85 26 8 341 1 hisC Histidinol-phosphate aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WML6 5.77e-17 85 26 8 341 3 hisC Histidinol-phosphate aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U2V6 5.77e-17 85 26 8 341 3 hisC Histidinol-phosphate aminotransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1ANM2 5.77e-17 85 26 8 341 3 hisC Histidinol-phosphate aminotransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KJ16 5.77e-17 85 26 8 341 3 hisC Histidinol-phosphate aminotransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A679 5.77e-17 85 26 8 341 3 hisC Histidinol-phosphate aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q845V2 5.78e-17 84 29 12 304 3 hisC Histidinol-phosphate aminotransferase Burkholderia multivorans (strain ATCC 17616 / 249)
Q8Z8H8 7.75e-17 84 26 12 315 3 cobD Threonine-phosphate decarboxylase Salmonella typhi
Q8FNZ1 8.93e-17 84 26 7 314 3 hisC Histidinol-phosphate aminotransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q5E637 9.34e-17 84 27 4 193 3 hisC Histidinol-phosphate aminotransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B4U9L1 9.34e-17 84 25 11 347 3 hisC Histidinol-phosphate aminotransferase Hydrogenobaculum sp. (strain Y04AAS1)
Q15RU8 1.01e-16 84 24 11 318 3 hisC Histidinol-phosphate aminotransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B5FDA0 1.21e-16 83 27 4 193 3 hisC Histidinol-phosphate aminotransferase Aliivibrio fischeri (strain MJ11)
Q84I52 1.56e-16 83 24 11 325 3 hisC Histidinol-phosphate aminotransferase Buchnera aphidicola subsp. Melaphis rhois
A2SSJ1 2.47e-16 82 27 13 345 3 hisC Histidinol-phosphate aminotransferase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
A1A2H6 2.47e-16 83 29 18 370 3 hisC Histidinol-phosphate aminotransferase Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
A7NFV2 2.76e-16 82 29 13 361 3 hisC Histidinol-phosphate aminotransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07080
Feature type CDS
Gene -
Product aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Location 1546004 - 1547161 (strand: 1)
Length 1158 (nucleotides) / 385 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1950
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00155 Aminotransferase class I and II

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0079 Amino acid transport and metabolism (E) E Histidinol-phosphate/aromatic aminotransferase or cobyric acid decarboxylase

Protein Sequence

MNRRSFLTSSSLVIGGLSLSSFVSAAYAAETSNPKQLFNAENPLLLNFNENSLGMSSNAKQAIIDALPHAFRYPDDARSALISALGEEFKLSDKHITLGNGSSETIQAAVQYVANKAQKAGKAAQLIVPDPTFNYAELYAEPLGVNIVKVPVDNTLAFDLTAMQKKAQAFDGISMVYLCNPNNPTAMLTPTAALTNWITSAKENVFFIIDEAYAEFVTTPEFTSAIALVAQGYKNLIVTRTFSKIYALAGLRVGYGVAVPEVISEVDSFVSIDNTNTAGAVSALASLKDHAFVAYSRKSIDVSRQMVVDTLNALNIEYAPSHANFIFHKVKGDVKTYQERMKAANIMVGREFPPALGWSRLTLGTPEEMSYFVATLKEFRTKGWI

Flanking regions ( +/- flanking 50bp)

AATCTACATAAACAATAAAAATGTAGAATAATTTACTTGGGAAACATCACATGAATCGTCGTTCATTTTTAACATCATCAAGCTTAGTGATCGGGGGACTTTCATTAAGTTCGTTTGTTAGCGCTGCCTATGCCGCAGAAACTTCAAACCCTAAACAGCTATTTAATGCAGAAAATCCTTTACTGTTAAACTTTAATGAAAACTCGCTAGGCATGTCATCCAATGCCAAACAGGCGATTATTGATGCACTTCCCCATGCTTTTCGCTATCCAGATGATGCGCGAAGCGCACTTATCAGTGCATTAGGTGAAGAATTTAAGCTATCAGACAAACACATCACTCTAGGTAATGGCTCCTCTGAAACCATACAAGCAGCCGTACAATATGTGGCTAATAAAGCGCAAAAAGCAGGTAAAGCGGCACAACTAATTGTGCCTGATCCAACGTTTAATTATGCCGAACTTTATGCTGAACCTTTAGGTGTCAATATCGTAAAAGTGCCGGTTGATAACACATTGGCTTTTGATTTAACCGCCATGCAGAAAAAAGCACAAGCATTTGATGGTATTAGCATGGTATATCTGTGCAATCCTAATAACCCAACCGCAATGCTGACACCAACAGCGGCATTAACAAATTGGATCACCTCAGCAAAAGAAAATGTCTTTTTTATTATTGATGAAGCTTACGCTGAATTTGTGACAACACCTGAATTTACCAGTGCGATAGCATTAGTTGCTCAAGGTTATAAAAACTTGATTGTTACCCGTACATTTTCAAAAATTTATGCATTAGCTGGATTAAGGGTAGGCTATGGTGTGGCAGTCCCTGAGGTAATTAGTGAAGTAGATAGTTTCGTTTCTATTGATAATACCAATACTGCCGGTGCTGTTAGCGCATTAGCCTCGTTAAAAGATCACGCTTTTGTGGCATATAGTCGCAAGTCAATTGATGTATCACGACAAATGGTGGTTGATACTTTAAACGCCTTAAATATCGAGTATGCACCTTCTCACGCCAACTTTATTTTTCATAAAGTCAAAGGTGATGTGAAAACTTATCAAGAGAGAATGAAAGCGGCAAATATTATGGTAGGACGTGAGTTTCCTCCCGCATTAGGTTGGAGCCGTTTGACCTTAGGAACCCCTGAGGAGATGAGTTATTTTGTCGCGACGTTAAAAGAGTTTAGAACTAAAGGATGGATATAATCCTCTACAACCAATAGTTATAAATGTATTTAAAAGGGAACGACACAGTT