Homologs in group_1032

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05820 FBDBKF_05820 86.7 Morganella morganii S1 sufC Fe-S cluster assembly ATPase SufC
EHELCC_11770 EHELCC_11770 86.7 Morganella morganii S2 sufC Fe-S cluster assembly ATPase SufC
NLDBIP_12110 NLDBIP_12110 86.7 Morganella morganii S4 sufC Fe-S cluster assembly ATPase SufC
LHKJJB_11970 LHKJJB_11970 86.7 Morganella morganii S3 sufC Fe-S cluster assembly ATPase SufC
HKOGLL_10585 HKOGLL_10585 86.7 Morganella morganii S5 sufC Fe-S cluster assembly ATPase SufC
F4V73_RS03505 F4V73_RS03505 85.1 Morganella psychrotolerans sufC Fe-S cluster assembly ATPase SufC

Distribution of the homologs in the orthogroup group_1032

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1032

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77499 2.38e-151 424 81 0 248 1 sufC Probable ATP-dependent transporter SufC Escherichia coli (strain K12)
Q55791 3.53e-101 297 59 0 244 3 slr0075 Probable ATP-dependent transporter slr0075 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P48255 1.36e-99 293 57 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Cyanophora paradoxa
Q1XDP6 3.78e-99 292 55 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Neopyropia yezoensis
P51241 4.19e-98 289 55 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Porphyra purpurea
Q00830 1.47e-97 288 55 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Trieres chinensis
O78474 2.66e-97 287 55 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Guillardia theta
Q02856 1.67e-94 280 54 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Antithamnion sp.
P80866 1.52e-91 273 52 1 243 1 sufC Vegetative protein 296 Bacillus subtilis (strain 168)
P35020 9.7e-91 271 53 2 249 3 ycf16 Probable ATP-dependent transporter ycf16 Galdieria sulphuraria
Q9A1G5 1.02e-86 261 51 2 247 3 SPy_0285 Probable ABC transporter ATP-binding protein SPy_0285/M5005_Spy0242 Streptococcus pyogenes serotype M1
Q5XDV5 1.02e-86 261 51 2 247 1 M6_Spy0273 Probable ABC transporter ATP-binding protein M6_Spy0273 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ43 1.02e-86 261 51 2 247 3 SPs0214 Probable ABC transporter ATP-binding protein SPs0214 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ42 1.02e-86 261 51 2 247 3 SpyM3_0208 Probable ABC transporter ATP-binding protein SpyM3_0208 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8P2M5 1.36e-85 258 50 2 247 3 spyM18_0273 Probable ABC transporter ATP-binding protein spyM18_0273 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q9CAF5 2.77e-84 257 52 1 243 1 ABCI6 ABC transporter I family member 6, chloroplastic Arabidopsis thaliana
Q8ILW0 1.03e-80 248 47 2 244 1 SufC Iron-sulfur cluster assembly protein SufC Plasmodium falciparum (isolate 3D7)
Q9TLX1 2.5e-80 244 46 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Cyanidium caldarium
A0A509AN56 3.5e-76 238 45 2 248 1 SufC Iron-sulfur cluster assembly protein SufC Plasmodium berghei (strain Anka)
Q60350 8.16e-40 140 35 4 230 3 MJ0035 Uncharacterized ABC transporter ATP-binding protein MJ0035 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8U3E0 2.97e-18 84 31 9 234 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q58663 7.73e-18 83 30 7 222 1 livG Probable branched-chain amino acid transport ATP-binding protein LivG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q97KD5 1.01e-16 81 29 9 247 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8T674 7.17e-16 80 29 9 234 3 abcG20 ABC transporter G family member 20 Dictyostelium discoideum
Q1DDP4 3.8e-15 77 30 12 244 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q8U242 5.59e-15 75 29 8 234 3 pstB Phosphate import ATP-binding protein PstB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P34712 7.52e-15 77 28 8 229 1 pgp-1 Multidrug resistance protein pgp-1 Caenorhabditis elegans
P34712 1.27e-08 58 24 7 233 1 pgp-1 Multidrug resistance protein pgp-1 Caenorhabditis elegans
Q2NIT5 8.05e-15 75 32 11 233 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q834B3 8.77e-15 75 29 7 231 3 pstB2 Phosphate import ATP-binding protein PstB 2 Enterococcus faecalis (strain ATCC 700802 / V583)
P39456 8.92e-15 74 30 7 217 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q834B4 9.87e-15 74 29 8 242 3 pstB1 Phosphate import ATP-binding protein PstB 1 Enterococcus faecalis (strain ATCC 700802 / V583)
A3CRB8 1.71e-14 74 28 7 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
Q58488 1.9e-14 74 27 7 226 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q88HL0 2.02e-14 74 28 8 223 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q897I2 3.1e-14 74 28 11 237 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q54BU4 5.41e-14 74 30 7 214 3 abcB1 ABC transporter B family member 1 Dictyostelium discoideum
O27764 5.66e-14 72 26 8 242 3 pstB Phosphate import ATP-binding protein PstB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O65934 9.14e-14 73 29 5 209 1 Rv1747 ABC transporter ATP-binding/permease protein Rv1747 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8E9I8 1.01e-13 72 26 7 250 3 pstB2 Phosphate import ATP-binding protein PstB 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q4K5Z7 1.01e-13 72 28 5 208 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9Y8G1 1.19e-13 73 29 11 244 1 atrD ABC multidrug transporter atrD Emericella nidulans
Q9Y8G1 7.4e-07 53 25 9 237 1 atrD ABC multidrug transporter atrD Emericella nidulans
Q9UZU7 1.26e-13 71 25 7 242 3 pstB Phosphate import ATP-binding protein PstB Pyrococcus abyssi (strain GE5 / Orsay)
Q5BAY0 1.33e-13 73 30 10 243 1 atrD ABC multidrug transporter atrD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5BAY0 7.68e-07 53 25 9 237 1 atrD ABC multidrug transporter atrD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q3Z2Z3 1.36e-13 72 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 1.36e-13 72 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q8RHL0 1.54e-13 71 32 10 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P54537 1.76e-13 71 27 8 233 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q5WET8 1.79e-13 71 26 9 236 3 pstB1 Phosphate import ATP-binding protein PstB 1 Shouchella clausii (strain KSM-K16)
Q8PM59 1.85e-13 71 27 8 230 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas axonopodis pv. citri (strain 306)
P16875 1.89e-13 73 28 8 244 3 MDR1 Multidrug resistance protein 1 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16875 1.3e-08 58 24 9 245 3 MDR1 Multidrug resistance protein 1 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q4ZRT7 1.92e-13 71 26 9 252 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas syringae pv. syringae (strain B728a)
Q880A6 1.92e-13 71 26 9 252 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5H002 1.93e-13 71 27 8 230 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P2Y5 1.93e-13 71 27 8 230 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BV68 1.98e-13 71 27 8 230 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q6LR20 2.22e-13 72 29 5 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q32EY4 2.43e-13 72 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
Q48HD9 2.51e-13 70 26 9 252 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q97ZT9 2.6e-13 70 25 8 238 3 pstB Phosphate import ATP-binding protein PstB Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P21449 2.82e-13 72 27 9 243 2 PGY2 Multidrug resistance protein 2 Cricetulus griseus
P21449 5.81e-11 65 28 9 226 2 PGY2 Multidrug resistance protein 2 Cricetulus griseus
P69877 2.86e-13 72 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 2.86e-13 72 27 6 232 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 2.86e-13 72 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 2.86e-13 72 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 2.86e-13 72 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q8Z7H7 2.94e-13 72 29 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q7NC40 3.12e-13 71 27 9 238 3 pstB Phosphate import ATP-binding protein PstB Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q1RD28 3.2e-13 71 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 3.2e-13 71 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
Q50801 3.22e-13 70 29 7 230 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q5PMK1 3.3e-13 71 29 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P40790 3.52e-13 71 29 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 3.52e-13 71 29 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
Q8PAG0 3.56e-13 70 27 8 230 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UT63 3.56e-13 70 27 8 230 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas campestris pv. campestris (strain 8004)
P77268 3.94e-13 71 26 10 242 2 ddpD Probable D,D-dipeptide transport ATP-binding protein DdpD Escherichia coli (strain K12)
Q0T5R2 4.3e-13 71 27 5 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
Q9YG51 5.37e-13 70 26 9 236 3 pstB Phosphate import ATP-binding protein PstB Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q2NHA1 6.41e-13 70 27 8 247 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q729H7 6.81e-13 69 30 5 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q73KK2 7.03e-13 70 27 5 237 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P21448 7.68e-13 71 27 9 243 1 ABCB1 ATP-dependent translocase ABCB1 Cricetulus griseus
P21448 5.92e-11 65 28 9 226 1 ABCB1 ATP-dependent translocase ABCB1 Cricetulus griseus
O26236 7.88e-13 69 27 7 230 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8RCU0 9.02e-13 68 26 7 231 3 pstB1 Phosphate import ATP-binding protein PstB 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8FVN0 1e-12 69 30 10 226 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
A0A348AXX9 1e-12 70 27 9 232 2 kk1G ABC-type transporter kk1G Curvularia clavata
A0A348AXX9 0.000209 45 52 0 42 2 kk1G ABC-type transporter kk1G Curvularia clavata
A0A348AXX9 0.000322 45 28 2 108 2 kk1G ABC-type transporter kk1G Curvularia clavata
Q5KUX3 1.13e-12 70 27 7 231 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q5KUX3 0.000311 45 24 7 219 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
B2GUP8 1.19e-12 70 28 8 242 2 abcb8 Mitochondrial potassium channel ATP-binding subunit Xenopus tropicalis
Q8ZX91 1.32e-12 68 26 8 238 3 pstB Phosphate import ATP-binding protein PstB Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q83GE8 1.32e-12 68 26 5 208 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain Twist)
K3VYH8 1.33e-12 70 27 7 231 3 FPSE_09185 ABC transporter FPSE_09185 Fusarium pseudograminearum (strain CS3096)
K3VYH8 0.000763 44 29 2 103 3 FPSE_09185 ABC transporter FPSE_09185 Fusarium pseudograminearum (strain CS3096)
Q73R11 1.42e-12 70 28 7 225 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
O28881 1.5e-12 68 25 5 232 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q6LX68 1.55e-12 68 30 8 236 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P54954 1.62e-12 68 28 8 236 1 yxeO Probable amino-acid import ATP-binding protein YxeO Bacillus subtilis (strain 168)
O28912 1.72e-12 68 30 13 242 3 pstB Phosphate import ATP-binding protein PstB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q6F0V4 1.74e-12 69 26 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q8YCN7 1.86e-12 68 30 10 226 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 1.86e-12 68 30 10 226 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 1.86e-12 68 30 10 226 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q7VNG4 1.91e-12 69 28 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A1TXH7 1.99e-12 69 27 7 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q30YR3 2.3e-12 68 27 9 227 3 pstB Phosphate import ATP-binding protein PstB Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q0A9K1 2.47e-12 68 27 10 254 3 pstB Phosphate import ATP-binding protein PstB Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q8TSC8 2.62e-12 69 29 10 237 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TSC8 4.16e-09 60 28 9 232 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8DWR4 2.63e-12 68 26 9 240 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 2.63e-12 68 26 9 240 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 2.63e-12 68 26 9 240 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B5X0E4 2.89e-12 69 27 8 242 2 Abcb5 ATP-binding cassette sub-family B member 5 Mus musculus
B5X0E4 4.43e-07 53 25 5 214 2 Abcb5 ATP-binding cassette sub-family B member 5 Mus musculus
Q4L5B3 2.96e-12 68 27 8 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q46ZA5 3.07e-12 67 28 8 237 3 pstB Phosphate import ATP-binding protein PstB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q5QVB0 3.3e-12 67 29 9 241 3 pstB Phosphate import ATP-binding protein PstB Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0SIB7 3.38e-12 68 27 4 243 3 hmuV Hemin import ATP-binding protein HmuV Rhodococcus jostii (strain RHA1)
Q8PVG9 3.65e-12 68 28 9 235 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PVG9 6.79e-06 50 28 5 163 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q1WSB9 3.89e-12 67 29 7 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q1LLB5 3.92e-12 67 27 7 237 3 pstB Phosphate import ATP-binding protein PstB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3M4H5 4.37e-12 67 28 6 209 3 pstB5 Phosphate import ATP-binding protein PstB 5 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8YYE2 4.41e-12 67 28 6 209 3 pstB2 Phosphate import ATP-binding protein PstB 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1QX69 4.51e-12 68 28 5 221 3 msbA ATP-dependent lipid A-core flippase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9X196 4.52e-12 68 29 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q7NZI7 4.95e-12 67 27 10 255 3 pstB Phosphate import ATP-binding protein PstB Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9CIS8 5.48e-12 67 27 7 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
A2RI02 5.7e-12 67 27 7 219 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q81CT8 6.04e-12 68 29 10 229 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q3SJQ8 6.1e-12 67 29 7 231 3 pstB Phosphate import ATP-binding protein PstB Thiobacillus denitrificans (strain ATCC 25259)
Q3ILC5 6.29e-12 67 26 9 252 3 pstB Phosphate import ATP-binding protein PstB Pseudoalteromonas translucida (strain TAC 125)
Q8TUR7 6.37e-12 67 30 10 230 3 pstB Phosphate import ATP-binding protein PstB Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q9GTN7 6.49e-12 68 28 8 215 1 tagA Serine protease/ABC transporter B family protein tagA Dictyostelium discoideum
Q8D3Z9 7.74e-12 68 32 8 180 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q88DY1 7.84e-12 66 28 8 208 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A0A0H2ZGN6 7.84e-12 67 29 8 243 1 dppD Di/tripeptide transport ATP-binding protein DppD Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6D4E2 8.07e-12 67 25 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9X0Y8 8.35e-12 66 26 10 238 3 pstB Phosphate import ATP-binding protein PstB Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9K6J9 8.53e-12 67 25 4 205 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K6J9 0.000449 44 24 8 234 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2SUW7 8.98e-12 67 27 7 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63V79 8.98e-12 67 27 7 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia pseudomallei (strain K96243)
Q3JTS8 8.98e-12 67 27 7 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia pseudomallei (strain 1710b)
Q62L74 9e-12 66 27 7 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia mallei (strain ATCC 23344)
P21447 9.07e-12 68 26 9 243 1 Abcb1a ATP-dependent translocase ABCB1 Mus musculus
P21447 2.16e-10 63 30 9 225 1 Abcb1a ATP-dependent translocase ABCB1 Mus musculus
P23174 9.08e-12 68 27 10 250 2 ABCB4 Phosphatidylcholine translocator ABCB4 Cricetulus griseus
P23174 6.28e-10 62 28 9 226 2 ABCB4 Phosphatidylcholine translocator ABCB4 Cricetulus griseus
P72479 9.47e-12 67 25 11 250 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q609Q1 9.54e-12 67 27 7 229 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6FCW7 1.04e-11 67 30 9 218 3 pstB Phosphate import ATP-binding protein PstB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8PUE7 1.09e-11 67 26 10 246 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 2.63e-07 54 27 7 229 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
F2T1C4 1.11e-11 67 29 8 217 1 MDR2 ABC multidrug transporter MDR2 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
P45022 1.14e-11 66 27 6 235 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9PDN2 1.18e-11 67 28 6 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q8DGZ3 1.31e-11 66 27 8 240 3 pstB Phosphate import ATP-binding protein PstB Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q49WM4 1.31e-11 67 27 8 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q0I3Y9 1.36e-11 67 26 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
P06795 1.41e-11 67 26 9 243 1 Abcb1b ATP-dependent translocase ABCB1 Mus musculus
P06795 8.67e-11 65 28 9 226 1 Abcb1b ATP-dependent translocase ABCB1 Mus musculus
A2RI77 1.43e-11 66 25 6 253 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
Q4WTT9 1.46e-11 67 29 5 213 2 mdr1 ABC multidrug transporter mdr1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WTT9 2.37e-05 48 25 9 238 2 mdr1 ABC multidrug transporter mdr1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q3ABN1 1.55e-11 65 30 8 234 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q890D1 1.59e-11 65 30 5 197 2 larO Nickel import ATP-binding protein LarO Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q87DT9 1.61e-11 66 28 6 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8Y4E9 1.64e-11 65 27 10 253 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q13W55 1.67e-11 66 28 8 239 3 pstB Phosphate import ATP-binding protein PstB Paraburkholderia xenovorans (strain LB400)
Q71WT2 1.69e-11 65 27 9 239 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria monocytogenes serotype 4b (strain F2365)
Q927Z7 1.71e-11 65 27 10 253 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
O31339 1.72e-11 66 27 7 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
P45171 1.91e-11 66 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P24693 1.96e-11 65 25 4 204 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Acidithiobacillus ferridurans
Q87G59 2.08e-11 65 27 9 255 3 pstB2 Phosphate import ATP-binding protein PstB 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4QK57 2.12e-11 66 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q8ES39 2.17e-11 66 29 6 209 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5JEP9 2.21e-11 65 27 9 244 3 pstB Phosphate import ATP-binding protein PstB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
A0A059JJ46 2.22e-11 67 29 8 217 2 MDR2 ABC multidrug transporter MDR2 Trichophyton interdigitale (strain MR816)
Q38UT9 2.22e-11 65 28 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q83HT1 2.24e-11 65 26 5 208 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain TW08/27)
Q58967 2.27e-11 65 30 7 223 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A6TEB8 2.34e-11 66 25 5 233 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9G4F5 2.4e-11 66 28 7 208 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q8DU23 2.43e-11 65 26 7 239 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q97IE0 2.48e-11 65 28 11 240 3 pstB Phosphate import ATP-binding protein PstB Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P21440 2.6e-11 66 27 9 251 1 Abcb4 Phosphatidylcholine translocator ABCB4 Mus musculus
P21440 1.36e-09 61 28 9 226 1 Abcb4 Phosphatidylcholine translocator ABCB4 Mus musculus
Q9CP06 2.75e-11 65 26 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
P21439 2.81e-11 66 26 9 251 1 ABCB4 Phosphatidylcholine translocator ABCB4 Homo sapiens
P21439 2.25e-07 55 27 10 234 1 ABCB4 Phosphatidylcholine translocator ABCB4 Homo sapiens
Q9JI39 2.94e-11 66 25 8 235 1 Abcb10 ATP-binding cassette sub-family B member 10, mitochondrial Mus musculus
Q7MKU3 2.95e-11 65 29 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 2.95e-11 65 29 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q2RM86 2.97e-11 65 28 9 221 3 pstB Phosphate import ATP-binding protein PstB Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
O85818 3.01e-11 65 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
P08007 3.21e-11 65 27 8 216 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q032H3 3.29e-11 65 27 7 219 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
Q7MFH3 3.3e-11 66 31 8 179 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q2NHW1 3.51e-11 64 26 7 240 3 pstB Phosphate import ATP-binding protein PstB Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
G5EG61 3.53e-11 66 29 9 234 2 pgp-14 P-glycoprotein 14 Caenorhabditis elegans
G5EG61 4.98e-07 53 24 8 237 2 pgp-14 P-glycoprotein 14 Caenorhabditis elegans
Q89A97 3.91e-11 65 24 7 239 3 mdlA Multidrug resistance-like ATP-binding protein MdlA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P43245 3.93e-11 66 26 9 243 2 Abcb1 ATP-dependent translocase ABCB1 Rattus norvegicus
P43245 4.89e-08 57 25 8 225 2 Abcb1 ATP-dependent translocase ABCB1 Rattus norvegicus
P0DTT6 4.02e-11 64 23 4 228 1 xylG Xylose/arabinose import ATP-binding protein XylG Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q9KS33 4.21e-11 65 27 6 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P08183 4.27e-11 66 26 9 243 1 ABCB1 ATP-dependent translocase ABCB1 Homo sapiens
P08183 2.48e-09 60 27 9 226 1 ABCB1 ATP-dependent translocase ABCB1 Homo sapiens
P16876 4.45e-11 65 27 8 248 3 MDR3 Multidrug resistance protein 3 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16876 6.32e-07 53 26 9 230 3 MDR3 Multidrug resistance protein 3 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q2S081 4.65e-11 64 26 9 233 3 pstB Phosphate import ATP-binding protein PstB Salinibacter ruber (strain DSM 13855 / M31)
Q9HPH7 4.79e-11 64 29 11 249 3 VNG_1631G Putative ABC transporter ATP-binding protein VNG_1631G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q8ETV7 4.98e-11 64 29 8 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2SSS4 5.04e-11 65 24 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q6MU19 5.49e-11 65 24 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q89UD2 5.5e-11 65 30 6 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P25885 5.6e-11 64 26 7 225 3 R00382 Uncharacterized ABC transporter ATP-binding protein R00382 Rhizobium meliloti (strain 1021)
O51587 5.67e-11 65 28 10 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q1WUX1 6.01e-11 64 27 9 241 3 pstB2 Phosphate import ATP-binding protein PstB 2 Ligilactobacillus salivarius (strain UCC118)
Q87PH3 6.09e-11 65 29 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8G838 6.18e-11 65 29 6 217 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 0.000127 46 24 5 196 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
P77737 6.31e-11 64 29 10 224 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
Q1WSB8 6.31e-11 64 31 7 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
Q8RD43 6.35e-11 65 26 6 236 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9RKQ4 6.45e-11 64 28 9 246 3 hmuV Hemin import ATP-binding protein HmuV Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q65UE1 6.49e-11 65 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q12L15 6.65e-11 64 26 9 252 3 pstB Phosphate import ATP-binding protein PstB Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q03AH0 6.76e-11 64 24 7 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8DRS0 6.97e-11 64 25 7 224 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q0SML1 6.98e-11 64 27 10 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q827Y0 7.46e-11 64 29 13 249 3 metN Methionine import ATP-binding protein MetN Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A4WER4 7.79e-11 65 24 6 236 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Enterobacter sp. (strain 638)
Q08201 8.05e-11 65 27 9 242 1 Abcb4 Phosphatidylcholine translocator ABCB4 Rattus norvegicus
Q08201 1.22e-09 61 28 9 226 1 Abcb4 Phosphatidylcholine translocator ABCB4 Rattus norvegicus
Q6KHL1 8.05e-11 63 30 8 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q8UBN2 8.08e-11 65 25 7 237 3 Atu2819 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q035B3 8.48e-11 63 28 8 213 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q660M8 9.19e-11 64 27 10 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q81J16 9.32e-11 63 28 8 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P36947 9.37e-11 64 24 8 237 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
Q9HMZ4 9.37e-11 63 29 7 231 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P63370 9.85e-11 63 27 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63369 9.85e-11 63 27 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus agalactiae serotype III (strain NEM316)
Q3K198 9.85e-11 63 27 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q82VR4 9.96e-11 63 27 9 236 3 pstB Phosphate import ATP-binding protein PstB Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P94440 1.04e-10 63 24 6 240 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
Q1BXC3 1.11e-10 63 27 7 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia orbicola (strain AU 1054)
Q9PQU3 1.18e-10 63 30 8 225 3 pstB Phosphate import ATP-binding protein PstB Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q3JDJ6 1.19e-10 63 29 9 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
P16877 1.22e-10 64 28 8 236 3 MDR4 Multidrug resistance protein 4 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16877 1.75e-07 55 26 9 230 3 MDR4 Multidrug resistance protein 4 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q38VW6 1.23e-10 63 26 8 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q82JY6 1.23e-10 63 28 8 231 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q00449 1.24e-10 64 27 8 225 2 Mdr49 Multidrug resistance protein homolog 49 Drosophila melanogaster
Q00449 9.69e-06 50 26 5 214 2 Mdr49 Multidrug resistance protein homolog 49 Drosophila melanogaster
Q5E3B8 1.25e-10 63 27 8 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Aliivibrio fischeri (strain ATCC 700601 / ES114)
P36879 1.28e-10 63 29 6 202 1 yadG Uncharacterized ABC transporter ATP-binding protein YadG Escherichia coli (strain K12)
P33982 1.39e-10 63 25 5 225 3 AZC_3926 Probable ABC transporter ATP-binding protein AZC_3926 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8XZ72 1.42e-10 63 27 7 237 3 pstB Phosphate import ATP-binding protein PstB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2W7J9 1.42e-10 63 27 11 254 3 pstB2 Phosphate import ATP-binding protein PstB 2 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q9KAG5 1.44e-10 64 27 8 235 3 BH2322 Putative ribose/galactose/methyl galactoside import ATP-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8PNN4 1.47e-10 63 26 5 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
O27739 1.48e-10 63 27 7 236 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O34946 1.48e-10 62 27 7 210 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
Q2IF17 1.6e-10 62 29 8 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Anaeromyxobacter dehalogenans (strain 2CP-C)
Q0SVB6 1.66e-10 62 28 11 213 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain SM101 / Type A)
Q8XMP8 1.66e-10 62 28 11 213 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain 13 / Type A)
Q0TTG6 1.66e-10 62 28 11 213 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
P42065 1.75e-10 63 28 9 225 3 appF Oligopeptide transport ATP-binding protein AppF Bacillus subtilis (strain 168)
C0SP98 1.77e-10 63 27 8 220 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
Q138A9 1.82e-10 62 29 12 226 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
Q818I7 1.93e-10 62 27 7 192 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q04G50 1.97e-10 63 25 8 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q9C7F8 2.09e-10 63 27 7 217 3 ABCB13 ABC transporter B family member 13 Arabidopsis thaliana
Q9C7F8 6.28e-09 59 26 7 220 3 ABCB13 ABC transporter B family member 13 Arabidopsis thaliana
Q3AAA4 2.18e-10 62 26 8 214 3 pstB Phosphate import ATP-binding protein PstB Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P63402 2.23e-10 63 30 8 202 3 BQ2027_MB2593 Uncharacterized ABC transporter ATP-binding protein Mb2593 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQI5 2.23e-10 63 30 8 202 1 Rv2564 Uncharacterized ABC transporter ATP-binding protein Rv2564 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQI4 2.23e-10 63 30 8 202 3 MT2640 Uncharacterized ABC transporter ATP-binding protein MT2640 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P77279 2.26e-10 62 26 7 204 1 fetA Probable iron export ATP-binding protein FetA Escherichia coli (strain K12)
O34677 2.3e-10 62 26 4 204 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q8UBB7 2.4e-10 63 30 6 176 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
O31711 2.49e-10 62 25 7 219 1 yknY Uncharacterized ABC transporter ATP-binding protein YknY Bacillus subtilis (strain 168)
Q895Y0 2.49e-10 62 26 8 241 3 pstB Phosphate import ATP-binding protein PstB Clostridium tetani (strain Massachusetts / E88)
Q8R9L8 2.51e-10 63 26 6 220 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R9L8 0.000472 44 26 9 225 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q1LC89 2.54e-10 62 28 10 237 3 hmuV Hemin import ATP-binding protein HmuV Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q4WSI1 2.56e-10 63 25 9 225 2 mdr4 ABC multidrug transporter mdr4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q39HM4 2.58e-10 62 27 7 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q6HPN0 2.64e-10 62 28 8 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 2.64e-10 62 28 8 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 2.64e-10 62 28 8 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q4A8A2 2.71e-10 62 29 7 223 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain 7448)
Q601T5 2.71e-10 62 29 7 223 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain 232)
Q895C4 2.75e-10 62 26 7 219 3 metN Methionine import ATP-binding protein MetN Clostridium tetani (strain Massachusetts / E88)
P9WQJ9 2.76e-10 63 28 9 221 1 irtA Mycobactin import ATP-binding/permease protein IrtA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ8 2.76e-10 63 28 9 221 3 irtA Mycobactin import ATP-binding/permease protein IrtA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63392 2.76e-10 63 28 9 221 3 irtA Mycobactin import ATP-binding/permease protein IrtA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q0B1U4 2.78e-10 63 24 5 238 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8D3X4 2.8e-10 62 28 7 213 3 pstB2 Phosphate import ATP-binding protein PstB 2 Vibrio vulnificus (strain CMCP6)
Q30PC0 2.82e-10 62 25 8 236 3 pstB Phosphate import ATP-binding protein PstB Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q7A5Q8 2.88e-10 62 24 8 247 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain N315)
Q99UA2 2.88e-10 62 24 8 247 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain Mu50 / ATCC 700699)
A3DJK5 2.9e-10 62 28 12 243 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q2SJY7 2.91e-10 63 27 6 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
P45073 3.11e-10 62 24 6 230 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1I4Q5 3.18e-10 62 29 7 220 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas entomophila (strain L48)
Q2KAW9 3.24e-10 63 26 8 250 3 RHE_CH01212 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q39S52 3.24e-10 62 26 11 256 3 pstB Phosphate import ATP-binding protein PstB Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q5KX47 3.25e-10 62 25 7 230 3 pstB Phosphate import ATP-binding protein PstB Geobacillus kaustophilus (strain HTA426)
Q8NWT5 3.27e-10 62 24 8 247 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MW2)
Q63H62 3.42e-10 62 28 7 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q73F67 3.42e-10 62 28 8 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
P0A2V5 3.57e-10 62 25 8 219 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 3.57e-10 62 25 8 219 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
Q7MFE8 3.78e-10 62 28 7 213 3 pstB2 Phosphate import ATP-binding protein PstB 2 Vibrio vulnificus (strain YJ016)
Q6G9I0 3.78e-10 62 24 8 247 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MSSA476)
Q5HG40 3.78e-10 62 24 8 247 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain COL)
Q2FYQ7 3.78e-10 62 24 8 247 1 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH57 3.78e-10 62 24 8 247 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain USA300)
Q87S48 3.83e-10 62 27 10 258 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8Z2X5 3.89e-10 62 36 1 94 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhi
Q8Z2X5 0.000144 46 22 7 220 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhi
P0C886 4.04e-10 62 36 1 94 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella choleraesuis (strain SC-B67)
P0C886 0.000142 46 22 7 220 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella choleraesuis (strain SC-B67)
A3PRY1 4.07e-10 62 28 5 176 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A9MZG1 4.15e-10 62 36 1 94 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A9MZG1 0.00015 46 22 7 220 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJE7 4.15e-10 62 36 1 94 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PJE7 0.00015 46 22 7 220 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZKQ4 4.23e-10 62 36 1 94 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZKQ4 0.000115 46 22 7 220 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9M0M2 4.23e-10 63 28 9 239 3 ABCB9 ABC transporter B family member 9 Arabidopsis thaliana
Q9M0M2 0.000449 45 22 7 235 3 ABCB9 ABC transporter B family member 9 Arabidopsis thaliana
A0A1U9YI12 4.24e-10 63 28 7 216 2 verA ABC-type transmembrane transporter verA Clonostachys rogersoniana
P0CZ39 4.29e-10 62 26 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TC2 4.29e-10 62 26 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J6D1 4.29e-10 62 26 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGL2 4.29e-10 62 26 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLH6 4.29e-10 62 26 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBJ4 4.29e-10 62 26 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5XBY6 4.29e-10 62 26 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ38 4.29e-10 62 26 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P63378 4.29e-10 62 26 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pyogenes serotype M1
Q65T42 4.35e-10 62 26 7 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9FWX7 4.37e-10 63 25 8 253 2 ABCB11 ABC transporter B family member 11 Arabidopsis thaliana
Q9FWX7 3.15e-09 60 26 7 234 2 ABCB11 ABC transporter B family member 11 Arabidopsis thaliana
Q9M1Q9 4.38e-10 63 27 8 237 1 ABCB21 ABC transporter B family member 21 Arabidopsis thaliana
Q9M1Q9 2.26e-07 55 25 6 232 1 ABCB21 ABC transporter B family member 21 Arabidopsis thaliana
Q9PBK0 4.46e-10 62 26 8 233 3 pstB Phosphate import ATP-binding protein PstB Xylella fastidiosa (strain 9a5c)
Q58664 4.57e-10 61 25 7 220 3 livF Probable branched-chain amino acid transport ATP-binding protein LivF Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q18CJ0 4.64e-10 62 30 9 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
Q9JZW0 4.72e-10 62 26 6 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P72477 4.76e-10 61 26 7 235 3 abcX Putative ABC transporter ATP-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q7VZ66 4.86e-10 61 26 7 236 3 pstB Phosphate import ATP-binding protein PstB Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2M3G0 4.97e-10 62 30 8 216 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q2M3G0 4.04e-09 60 28 8 218 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q9KN92 5.02e-10 61 27 8 217 3 pstB2 Phosphate import ATP-binding protein PstB 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q74DN5 5.17e-10 61 27 7 205 3 GSU1281 Putative ABC transporter ATP-binding protein GSU1281 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q1BG93 5.18e-10 62 24 6 236 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
A0KE53 5.18e-10 62 24 6 236 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
Q7W8Q6 5.31e-10 61 26 7 236 3 pstB Phosphate import ATP-binding protein PstB Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WMC3 5.31e-10 61 26 7 236 3 pstB Phosphate import ATP-binding protein PstB Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7MNI7 5.79e-10 61 24 8 265 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain YJ016)
Q8DEW5 5.79e-10 61 24 8 265 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain CMCP6)
Q2YJJ8 5.9e-10 62 27 9 231 3 BAB2_1053 Putative peptide import ATP-binding protein BAB2_1053 Brucella abortus (strain 2308)
Q8VQK7 5.9e-10 62 27 9 231 3 BruAb2_1034 Putative peptide import ATP-binding protein BruAb2_1034 Brucella abortus biovar 1 (strain 9-941)
Q72PP0 5.9e-10 61 24 6 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8P0V3 5.96e-10 61 26 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q7MLE6 6.33e-10 61 30 11 231 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio vulnificus (strain YJ016)
Q5PFQ7 6.41e-10 62 29 6 174 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q03ZQ0 6.46e-10 62 25 6 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q8F6L8 6.5e-10 60 24 6 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q8Z8W8 6.54e-10 62 29 6 174 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
Q8TQ05 6.6e-10 62 27 10 246 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 1.6e-05 49 28 7 237 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9JUX4 6.88e-10 62 26 6 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P45052 7.07e-10 61 28 12 246 3 oppD Oligopeptide transport ATP-binding protein OppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8RI39 7.17e-10 62 26 7 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q0SFY5 7.44e-10 61 26 8 232 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
Q6LSC4 7.47e-10 61 28 7 214 3 pstB2 Phosphate import ATP-binding protein PstB 2 Photobacterium profundum (strain SS9)
Q8R9I2 7.55e-10 60 26 9 238 3 pstB2 Phosphate import ATP-binding protein PstB 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A2RI78 7.59e-10 61 26 11 268 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
P40735 7.64e-10 61 31 10 222 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
Q31VE6 7.94e-10 61 26 9 227 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q11ID5 8.04e-10 60 27 4 195 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q3J8J2 8.05e-10 61 29 12 248 3 pstB2 Phosphate import ATP-binding protein PstB 2 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0IAC3 8.19e-10 61 29 11 215 3 pstB Phosphate import ATP-binding protein PstB Synechococcus sp. (strain CC9311)
Q8G7F4 8.19e-10 60 27 6 200 3 pstB Phosphate import ATP-binding protein PstB Bifidobacterium longum (strain NCC 2705)
Q1QQH1 8.27e-10 61 26 10 235 3 pstB Phosphate import ATP-binding protein PstB Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q97Q34 8.51e-10 60 27 8 235 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q81GU1 8.53e-10 61 27 5 200 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2ULH4 8.74e-10 62 28 9 225 3 atm1 Iron-sulfur clusters transporter atm1, mitochondrial Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q4AA75 8.93e-10 60 28 7 223 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q4A5A5 8.94e-10 60 28 8 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q8YM92 9.08e-10 61 24 8 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8Z4V6 9.21e-10 61 27 6 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q4A5A4 9.22e-10 61 28 7 229 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis synoviae (strain 53)
P40860 9.32e-10 61 27 6 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q88C57 9.44e-10 60 32 12 216 3 pstB2 Phosphate import ATP-binding protein PstB 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q58418 9.61e-10 60 28 9 256 3 pstB Phosphate import ATP-binding protein PstB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q2L0H5 9.66e-10 61 28 6 177 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella avium (strain 197N)
Q98QH5 9.67e-10 60 28 10 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q08D64 1e-09 62 25 7 231 2 abcb6 ATP-binding cassette sub-family B member 6 Xenopus tropicalis
Q5ZWE4 1.01e-09 61 25 6 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P07821 1.02e-09 60 28 9 230 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
P73788 1.05e-09 60 29 9 210 3 pstB3 Phosphate import ATP-binding protein PstB 3 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A2U9 1.06e-09 61 25 7 238 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 1.06e-09 61 25 7 238 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
O83658 1.07e-09 61 27 7 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Treponema pallidum (strain Nichols)
Q50294 1.12e-09 60 28 5 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q7W9U5 1.12e-09 61 28 7 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q3B3H7 1.13e-09 60 26 7 224 3 pstB Phosphate import ATP-binding protein PstB Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q72D46 1.14e-09 60 27 9 224 3 pstB Phosphate import ATP-binding protein PstB Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q7VZE5 1.14e-09 61 28 7 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q74I62 1.14e-09 61 27 6 188 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q53193 1.15e-09 61 25 7 248 3 NGR_a01410 Probable peptide ABC transporter ATP-binding protein y4tR Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8XNY7 1.15e-09 60 28 6 220 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q5HAV5 1.17e-09 60 24 8 230 3 pstB Phosphate import ATP-binding protein PstB Ehrlichia ruminantium (strain Welgevonden)
Q5FFT1 1.17e-09 60 24 8 230 3 pstB Phosphate import ATP-binding protein PstB Ehrlichia ruminantium (strain Gardel)
H6TB12 1.18e-09 61 28 9 224 1 mdr Sophorolipid transporter Starmerella bombicola
H6TB12 3e-07 54 27 11 249 1 mdr Sophorolipid transporter Starmerella bombicola
P47425 1.21e-09 60 28 8 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8F6Z1 1.24e-09 61 28 9 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 1.24e-09 61 28 9 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q9C8K2 1.25e-09 61 27 6 233 1 ABCG12 ABC transporter G family member 12 Arabidopsis thaliana
Q180A5 1.26e-09 60 26 5 189 3 pstB Phosphate import ATP-binding protein PstB Clostridioides difficile (strain 630)
Q5WC31 1.27e-09 61 26 7 210 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q3MB44 1.27e-09 61 26 6 229 3 rbsA Ribose import ATP-binding protein RbsA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P45861 1.31e-09 61 25 6 212 1 ywjA Uncharacterized ABC transporter ATP-binding protein YwjA Bacillus subtilis (strain 168)
P9WQK5 1.31e-09 60 26 6 214 1 Rv0073 Uncharacterized ABC transporter ATP-binding protein Rv0073 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQK4 1.31e-09 60 26 6 214 3 MT0079 Uncharacterized ABC transporter ATP-binding protein MT0079 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O70127 1.31e-09 61 27 11 244 1 Abcb11 Bile salt export pump Rattus norvegicus
B8K1W2 1.34e-09 61 28 11 244 1 Abcb11e Bile salt export pump Canis lupus familiaris
Q03EE4 1.39e-09 60 28 8 235 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
P0A9V4 1.43e-09 60 24 5 239 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Shigella flexneri
P0A9V1 1.43e-09 60 24 5 239 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli (strain K12)
P0A9V2 1.43e-09 60 24 5 239 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9V3 1.43e-09 60 24 5 239 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O157:H7
Q6AE21 1.45e-09 60 29 10 233 3 metN Methionine import ATP-binding protein MetN Leifsonia xyli subsp. xyli (strain CTCB07)
Q8DPB4 1.51e-09 60 27 8 235 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q5WXF0 1.53e-09 60 25 6 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q6WB63 1.53e-09 60 31 5 182 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
Q9Z411 1.58e-09 60 31 12 225 3 pstB Phosphate import ATP-binding protein PstB Pseudomonas putida
P63359 1.62e-09 61 25 8 242 1 msbA ATP-dependent lipid A-core flippase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63360 1.62e-09 61 25 8 242 3 msbA ATP-dependent lipid A-core flippase Salmonella typhi
Q57R14 1.62e-09 61 25 8 242 3 msbA ATP-dependent lipid A-core flippase Salmonella choleraesuis (strain SC-B67)
Q8DMX9 1.64e-09 60 28 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 1.64e-09 60 28 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 1.64e-09 60 28 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q0TUN8 1.64e-09 60 28 7 226 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A2RKA7 1.65e-09 61 24 9 257 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
A2RKA7 1.49e-06 52 28 11 222 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
Q6HDP8 1.67e-09 60 26 7 192 3 pstB Phosphate import ATP-binding protein PstB Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634R8 1.67e-09 60 26 7 192 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ZK / E33L)
Q730R7 1.67e-09 60 26 7 192 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81LW6 1.67e-09 60 26 7 192 3 pstB Phosphate import ATP-binding protein PstB Bacillus anthracis
Q3K4F5 1.73e-09 60 30 12 230 3 pstB Phosphate import ATP-binding protein PstB Pseudomonas fluorescens (strain Pf0-1)
Q8KDZ5 1.73e-09 60 24 8 219 3 pstB Phosphate import ATP-binding protein PstB Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8YDH1 1.74e-09 60 27 9 231 3 BMEII0205 Putative peptide import ATP-binding protein BMEII0205 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q5E586 1.74e-09 60 26 5 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q2RFS8 1.8e-09 60 28 10 221 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q73F11 1.85e-09 60 27 11 242 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8X5Q4 1.93e-09 60 26 7 237 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
Q1MCN6 1.97e-09 60 27 5 191 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q576H3 1.98e-09 60 25 6 240 3 xylG Xylose import ATP-binding protein XylG Brucella abortus biovar 1 (strain 9-941)
Q2YJE7 1.98e-09 60 25 6 240 3 xylG Xylose import ATP-binding protein XylG Brucella abortus (strain 2308)
Q9KU04 1.99e-09 60 25 7 236 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q93SH7 2e-09 60 28 5 189 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P63368 2.02e-09 59 27 6 221 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63367 2.02e-09 59 27 6 221 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype III (strain NEM316)
Q3K199 2.02e-09 59 27 6 221 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q9K7C3 2.07e-09 60 24 7 237 3 araG L-arabinose transport ATP-binding protein AraG Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3MAR5 2.08e-09 60 25 7 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q4K3K9 2.17e-09 60 31 12 225 3 pstB Phosphate import ATP-binding protein PstB Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
H9BZ66 2.19e-09 60 28 4 224 2 ABCG1 ABC transporter G family member 1 Petunia hybrida
Q8X4L6 2.22e-09 59 26 9 227 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
Q0SWH9 2.23e-09 60 28 6 220 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q1CDJ0 2.29e-09 60 26 6 230 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDJ0 0.00049 44 23 7 213 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CG00 2.29e-09 60 26 6 230 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q7CG00 0.00049 44 23 7 213 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q1C1B8 2.29e-09 60 26 6 230 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C1B8 0.00049 44 23 7 213 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q74KF8 2.3e-09 59 27 11 242 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8ST66 2.3e-09 60 27 5 218 3 abcG18 ABC transporter G family member 18 Dictyostelium discoideum
Q12BB2 2.31e-09 59 27 7 236 3 pstB Phosphate import ATP-binding protein PstB Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q664G2 2.31e-09 60 26 6 230 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q664G2 0.000106 46 23 8 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q5X627 2.33e-09 60 25 5 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q3AJS9 2.37e-09 59 25 10 237 3 pstB Phosphate import ATP-binding protein PstB Synechococcus sp. (strain CC9605)
Q38YC1 2.41e-09 59 26 8 234 3 pstB2 Phosphate import ATP-binding protein PstB 2 Latilactobacillus sakei subsp. sakei (strain 23K)
P96605 2.41e-09 60 27 7 229 3 ydbJ Uncharacterized ABC transporter ATP-binding protein YdbJ Bacillus subtilis (strain 168)
Q2YYM4 2.41e-09 59 27 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
D4AYW0 2.44e-09 60 25 7 253 1 ARB_01379 ABC transporter G family member ARB_01379 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
Q9SYI3 2.46e-09 60 25 7 237 3 ABCB5 ABC transporter B family member 5 Arabidopsis thaliana
Q9SYI3 6.04e-07 53 25 9 255 3 ABCB5 ABC transporter B family member 5 Arabidopsis thaliana
Q8TTN2 2.51e-09 60 27 8 234 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q67RG2 2.54e-09 59 26 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q7UX73 2.55e-09 59 26 9 232 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
P9WQK9 2.56e-09 59 26 9 235 1 pstB2 Phosphate import ATP-binding protein PstB 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQK8 2.56e-09 59 26 9 235 3 pstB2 Phosphate import ATP-binding protein PstB 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7U0Z9 2.56e-09 59 26 9 235 3 pstB2 Phosphate import ATP-binding protein PstB 2 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5HDY6 2.63e-09 59 28 11 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 2.63e-09 59 28 11 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 2.63e-09 59 28 11 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q084V3 2.66e-09 59 25 9 252 3 pstB Phosphate import ATP-binding protein PstB Shewanella frigidimarina (strain NCIMB 400)
Q2KVN7 2.68e-09 59 25 7 236 3 pstB Phosphate import ATP-binding protein PstB Bordetella avium (strain 197N)
Q8PC11 2.69e-09 60 26 6 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q7A470 2.73e-09 59 27 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 2.73e-09 59 27 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q9MUN1 2.76e-09 60 28 6 197 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q8K985 2.8e-09 60 26 7 225 3 mdlA Multidrug resistance-like ATP-binding protein MdlA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q839D5 2.82e-09 59 26 7 231 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q5FM17 2.84e-09 59 25 9 236 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q57SD6 2.87e-09 60 29 6 174 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
Q92MP8 2.93e-09 60 33 3 127 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q87C88 3.04e-09 59 25 8 233 3 pstB Phosphate import ATP-binding protein PstB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q15QL7 3.08e-09 59 26 6 189 3 pstB Phosphate import ATP-binding protein PstB Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P96063 3.09e-09 60 29 6 174 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6GH27 3.11e-09 59 23 8 247 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MRSA252)
P45094 3.13e-09 59 26 8 241 3 dppF Dipeptide transport ATP-binding protein DppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0CZ27 3.19e-09 59 26 7 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 3.19e-09 59 26 7 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8ELT4 3.19e-09 59 25 7 211 3 pstB Phosphate import ATP-binding protein PstB Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5QZP7 3.19e-09 58 23 7 219 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3A6U0 3.21e-09 59 28 10 242 3 pstB Phosphate import ATP-binding protein PstB Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A3CVD3 3.21e-09 59 25 5 229 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q7WGW1 3.23e-09 59 27 7 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
O69063 3.26e-09 59 28 8 213 3 htxD Hypophosphite import ATP-binding protein HtxD Stutzerimonas stutzeri
Q8YYE3 3.27e-09 59 25 6 210 3 pstB1 Phosphate import ATP-binding protein PstB 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8TSA8 3.29e-09 59 24 7 235 3 pstB Phosphate import ATP-binding protein PstB Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TYV9 3.29e-09 59 27 7 234 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q5PGH0 3.35e-09 60 23 7 242 3 msbA ATP-dependent lipid A-core flippase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q2YXY9 3.35e-09 59 23 8 245 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NVB5 3.38e-09 59 27 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 3.38e-09 59 27 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
Q9Y8G2 3.4e-09 60 26 8 230 2 atrC ABC multidrug transporter atrC Emericella nidulans
Q9Y8G2 5.05e-07 53 27 9 238 2 atrC ABC multidrug transporter atrC Emericella nidulans

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06840
Feature type CDS
Gene sufC
Product Fe-S cluster assembly ATPase SufC
Location 1493098 - 1493844 (strand: -1)
Length 747 (nucleotides) / 248 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1032
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0396 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster assembly ATPase SufC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09013 Fe-S cluster assembly ATP-binding protein - -

Protein Sequence

MLDIKNLHVSVEGNEILKGLDLQVRAGEVHAIMGPNGSGKSTLSATLAGREEYEVDEGSVTFKNKDLLELEPEERAGEGIFMAFQYPVEIPGVSNQFFLQSSVNAVREYRGQEPLDRFDFEDFIEDKIKLLDMPQDLLTRSVNVGFSGGEKKRNDILQMAALEPELCILDETDSGLDIDALKIVANGVNSLRDGKRAFIVVTHYQRILDYIKPDYVHVLYQGKIIKSGDFSLAQKLEEQGYGWLIDPQ

Flanking regions ( +/- flanking 50bp)

GGTTAACCATTAACCAAATTCTGGGTATAAAAATACCGAAGGCATATATTATGTTAGATATTAAAAATTTACATGTCAGTGTTGAAGGCAATGAAATTCTTAAAGGATTAGATTTGCAAGTACGTGCCGGCGAAGTGCACGCTATCATGGGGCCAAACGGTTCAGGTAAAAGTACATTATCCGCAACCTTAGCAGGTCGCGAAGAGTATGAAGTTGATGAAGGTAGTGTGACTTTTAAAAACAAAGATCTACTGGAATTAGAGCCTGAAGAGCGAGCGGGTGAAGGTATCTTTATGGCATTTCAATACCCAGTAGAGATCCCCGGTGTCAGTAACCAGTTTTTCTTACAATCCTCAGTCAATGCGGTAAGAGAATATCGAGGCCAAGAGCCGTTAGATCGCTTTGATTTTGAAGATTTTATTGAAGATAAAATCAAACTATTGGATATGCCTCAAGATTTGTTAACTCGTTCTGTTAACGTAGGTTTTTCTGGTGGTGAGAAAAAACGTAACGATATTTTGCAAATGGCTGCCCTTGAACCTGAACTGTGTATCTTAGATGAAACCGACTCAGGACTTGATATCGATGCGTTAAAAATTGTCGCTAATGGTGTCAATAGCTTACGTGATGGTAAACGCGCCTTTATCGTGGTGACTCACTATCAACGTATCCTTGATTATATTAAACCTGATTATGTGCATGTGCTTTACCAAGGAAAAATCATTAAATCAGGTGATTTTTCATTAGCACAAAAATTGGAGGAACAAGGTTATGGCTGGCTTATTGACCCTCAATGAGAAACGTGAAAAACAGCATCAAGTAGAACAGCGTAATCAACAGGCATTAA