Homologs in group_1099

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05820 FBDBKF_05820 96.0 Morganella morganii S1 sufC Fe-S cluster assembly ATPase SufC
EHELCC_11770 EHELCC_11770 96.0 Morganella morganii S2 sufC Fe-S cluster assembly ATPase SufC
NLDBIP_12110 NLDBIP_12110 96.0 Morganella morganii S4 sufC Fe-S cluster assembly ATPase SufC
LHKJJB_11970 LHKJJB_11970 96.0 Morganella morganii S3 sufC Fe-S cluster assembly ATPase SufC
HKOGLL_10585 HKOGLL_10585 96.0 Morganella morganii S5 sufC Fe-S cluster assembly ATPase SufC
PMI_RS06840 PMI_RS06840 85.1 Proteus mirabilis HI4320 sufC Fe-S cluster assembly ATPase SufC

Distribution of the homologs in the orthogroup group_1099

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1099

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77499 5.66e-153 428 81 0 248 1 sufC Probable ATP-dependent transporter SufC Escherichia coli (strain K12)
Q55791 2.56e-102 300 58 0 247 3 slr0075 Probable ATP-dependent transporter slr0075 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P51241 2.19e-101 298 57 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Porphyra purpurea
P48255 9.1e-100 294 58 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Cyanophora paradoxa
Q1XDP6 4.31e-99 292 56 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Neopyropia yezoensis
O78474 3.13e-97 287 55 0 247 3 ycf16 Probable ATP-dependent transporter ycf16 Guillardia theta
Q00830 3.9e-96 284 55 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Trieres chinensis
Q02856 4.46e-95 281 54 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Antithamnion sp.
P80866 6.61e-93 276 52 1 243 1 sufC Vegetative protein 296 Bacillus subtilis (strain 168)
P35020 6.85e-89 266 52 2 249 3 ycf16 Probable ATP-dependent transporter ycf16 Galdieria sulphuraria
Q9CAF5 1.14e-88 268 53 1 243 1 ABCI6 ABC transporter I family member 6, chloroplastic Arabidopsis thaliana
Q9A1G5 3.3e-86 259 50 2 247 3 SPy_0285 Probable ABC transporter ATP-binding protein SPy_0285/M5005_Spy0242 Streptococcus pyogenes serotype M1
Q5XDV5 3.3e-86 259 50 2 247 1 M6_Spy0273 Probable ABC transporter ATP-binding protein M6_Spy0273 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ43 3.3e-86 259 50 2 247 3 SPs0214 Probable ABC transporter ATP-binding protein SPs0214 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ42 3.3e-86 259 50 2 247 3 SpyM3_0208 Probable ABC transporter ATP-binding protein SpyM3_0208 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8P2M5 3.72e-86 259 50 2 247 3 spyM18_0273 Probable ABC transporter ATP-binding protein spyM18_0273 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q8ILW0 1.25e-83 256 48 2 249 1 SufC Iron-sulfur cluster assembly protein SufC Plasmodium falciparum (isolate 3D7)
A0A509AN56 9.21e-79 244 46 2 249 1 SufC Iron-sulfur cluster assembly protein SufC Plasmodium berghei (strain Anka)
Q9TLX1 1.59e-78 240 45 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Cyanidium caldarium
Q60350 7.19e-42 146 36 4 230 3 MJ0035 Uncharacterized ABC transporter ATP-binding protein MJ0035 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8U3E0 1.24e-16 80 30 7 230 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q7XA72 1.07e-15 79 33 8 224 2 ABCG21 ABC transporter G family member 21 Arabidopsis thaliana
O65934 1.14e-15 79 29 5 212 1 Rv1747 ABC transporter ATP-binding/permease protein Rv1747 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9K6J9 2e-15 78 28 4 205 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K6J9 2.57e-06 51 27 5 191 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q97KD5 3.39e-15 77 27 6 233 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P0DTT6 3.78e-15 75 25 4 228 1 xylG Xylose/arabinose import ATP-binding protein XylG Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P34712 8.75e-15 77 27 8 237 1 pgp-1 Multidrug resistance protein pgp-1 Caenorhabditis elegans
Q2NHA1 1.36e-14 74 28 7 235 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q8T674 1.36e-14 76 29 7 231 3 abcG20 ABC transporter G family member 20 Dictyostelium discoideum
Q8U242 2.14e-14 73 30 10 239 3 pstB Phosphate import ATP-binding protein PstB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q1DDP4 2.55e-14 74 30 10 231 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q9X196 2.98e-14 74 30 8 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q50294 3.01e-14 73 31 6 214 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8E9I8 3.67e-14 73 26 6 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8ES39 3.71e-14 74 31 5 209 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 0.000124 46 26 4 161 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q834B4 3.78e-14 73 29 6 215 3 pstB1 Phosphate import ATP-binding protein PstB 1 Enterococcus faecalis (strain ATCC 700802 / V583)
P16875 4.44e-14 75 29 7 237 3 MDR1 Multidrug resistance protein 1 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16875 1.22e-08 58 25 8 230 3 MDR1 Multidrug resistance protein 1 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q8RHL0 5.16e-14 72 31 7 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q93YS4 5.72e-14 74 34 5 188 1 ABCG22 ABC transporter G family member 22 Arabidopsis thaliana
Q58488 6.19e-14 72 27 6 234 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8YYE2 6.5e-14 72 28 7 211 3 pstB2 Phosphate import ATP-binding protein PstB 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3M4H5 6.56e-14 72 28 7 211 3 pstB5 Phosphate import ATP-binding protein PstB 5 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q7UX73 6.87e-14 72 28 8 242 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q54BU4 7.66e-14 74 27 6 220 3 abcB1 ABC transporter B family member 1 Dictyostelium discoideum
P54537 8.82e-14 72 27 5 230 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
A3CRB8 9.67e-14 72 28 7 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
Q8ZX91 1.07e-13 71 28 9 239 3 pstB Phosphate import ATP-binding protein PstB Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
O27764 1.55e-13 71 28 9 240 3 pstB Phosphate import ATP-binding protein PstB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q5HQ70 1.7e-13 72 28 8 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q97ZT9 1.73e-13 71 27 9 236 3 pstB Phosphate import ATP-binding protein PstB Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A0A348AXX9 2.1e-13 72 27 8 235 2 kk1G ABC-type transporter kk1G Curvularia clavata
A0A348AXX9 0.00051 44 28 3 98 2 kk1G ABC-type transporter kk1G Curvularia clavata
A3CVD3 3.19e-13 70 30 8 232 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q55DA0 3.78e-13 72 28 6 242 2 abcG22 ABC transporter G family member 22 Dictyostelium discoideum
Q6YRJ4 4.36e-13 71 27 8 236 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
F2T1C4 4.74e-13 72 30 7 216 1 MDR2 ABC multidrug transporter MDR2 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
Q7NC40 5.21e-13 70 25 7 230 3 pstB Phosphate import ATP-binding protein PstB Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q83GE8 5.69e-13 70 27 5 208 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain Twist)
Q839D5 5.7e-13 70 29 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q834B3 8.17e-13 69 27 7 232 3 pstB2 Phosphate import ATP-binding protein PstB 2 Enterococcus faecalis (strain ATCC 700802 / V583)
A0A059JJ46 8.72e-13 71 30 7 216 2 MDR2 ABC multidrug transporter MDR2 Trichophyton interdigitale (strain MR816)
Q9ZU35 9.2e-13 70 29 4 220 2 ABCG7 ABC transporter G family member 7 Arabidopsis thaliana
Q3ABN1 9.86e-13 69 31 8 224 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9Y8G1 1.02e-12 70 30 9 222 1 atrD ABC multidrug transporter atrD Emericella nidulans
Q9Y8G1 7.6e-08 56 28 12 245 1 atrD ABC multidrug transporter atrD Emericella nidulans
A1TXH7 1.05e-12 70 28 7 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q3SJQ8 1.07e-12 69 27 6 214 3 pstB Phosphate import ATP-binding protein PstB Thiobacillus denitrificans (strain ATCC 25259)
Q8CPN0 1.1e-12 70 27 8 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5BAY0 1.14e-12 70 30 9 222 1 atrD ABC multidrug transporter atrD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5BAY0 8.25e-08 56 28 12 245 1 atrD ABC multidrug transporter atrD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q2SJY7 1.17e-12 70 26 5 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q8F6L8 1.21e-12 68 25 9 250 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q9UZU7 1.22e-12 68 24 8 238 3 pstB Phosphate import ATP-binding protein PstB Pyrococcus abyssi (strain GE5 / Orsay)
Q08D64 1.28e-12 70 28 8 229 2 abcb6 ATP-binding cassette sub-family B member 6 Xenopus tropicalis
Q72PP0 1.31e-12 68 25 9 250 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q0SIB7 1.41e-12 69 26 4 247 3 hmuV Hemin import ATP-binding protein HmuV Rhodococcus jostii (strain RHA1)
Q8FVN0 1.61e-12 68 30 10 226 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q81J16 1.66e-12 68 29 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
O31339 1.75e-12 69 28 8 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q88XV2 1.81e-12 68 30 6 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P21449 1.87e-12 70 31 9 220 2 PGY2 Multidrug resistance protein 2 Cricetulus griseus
P21449 1.07e-11 67 27 9 243 2 PGY2 Multidrug resistance protein 2 Cricetulus griseus
F2RP52 1.9e-12 70 29 7 216 2 MDR2 ABC multidrug transporter MDR2 Trichophyton tonsurans (strain CBS 112818)
F2PRR1 1.9e-12 70 29 7 216 2 MDR2 ABC multidrug transporter MDR2 Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
Q4WSI1 1.95e-12 70 28 9 217 2 mdr4 ABC multidrug transporter mdr4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q2NIT5 1.96e-12 68 29 9 230 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
A0A125QXJ1 2.24e-12 69 27 8 230 2 ABCB6 ATP-binding cassette sub-family B member 6 Mesocricetus auratus
Q8YCN7 2.41e-12 68 30 10 226 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 2.41e-12 68 30 10 226 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 2.41e-12 68 30 10 226 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q5KUX3 2.61e-12 69 25 6 231 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q5KUX3 4.96e-05 47 22 8 222 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q9DC29 2.92e-12 69 27 8 230 1 Abcb6 ATP-binding cassette sub-family B member 6 Mus musculus
A3DJK5 2.93e-12 68 30 11 236 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q00449 3.19e-12 69 28 7 225 2 Mdr49 Multidrug resistance protein homolog 49 Drosophila melanogaster
Q00449 2.16e-09 60 28 6 217 2 Mdr49 Multidrug resistance protein homolog 49 Drosophila melanogaster
Q0A9K1 3.28e-12 68 27 10 257 3 pstB Phosphate import ATP-binding protein PstB Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q5HDY6 3.5e-12 67 30 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 3.5e-12 67 30 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 3.5e-12 67 30 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q9FWX7 3.56e-12 69 29 9 253 2 ABCB11 ABC transporter B family member 11 Arabidopsis thaliana
Q9FWX7 1.37e-07 55 24 6 233 2 ABCB11 ABC transporter B family member 11 Arabidopsis thaliana
Q7A470 3.6e-12 67 30 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 3.6e-12 67 30 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YYM4 3.64e-12 67 30 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q1WSB8 3.88e-12 67 29 5 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
Q03ZQ0 3.96e-12 68 27 11 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q48KI4 4.47e-12 67 31 10 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q6GEL3 4.56e-12 67 30 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
Q2RWU0 4.6e-12 67 25 11 260 3 pstB Phosphate import ATP-binding protein PstB Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q9MAG3 4.61e-12 68 28 4 191 2 ABCG24 ABC transporter G family member 24 Arabidopsis thaliana
Q8G838 5.02e-12 68 30 6 216 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 1.31e-07 55 26 4 196 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
P39456 5.22e-12 67 26 6 214 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q9WY65 5.44e-12 67 30 7 213 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O70595 5.55e-12 68 27 8 230 1 Abcb6 ATP-binding cassette sub-family B member 6 Rattus norvegicus
Q89A97 5.6e-12 68 25 7 239 3 mdlA Multidrug resistance-like ATP-binding protein MdlA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P23174 5.69e-12 68 32 9 220 2 ABCB4 Phosphatidylcholine translocator ABCB4 Cricetulus griseus
P23174 8.59e-11 65 27 8 239 2 ABCB4 Phosphatidylcholine translocator ABCB4 Cricetulus griseus
Q8PAG0 5.71e-12 67 26 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UT63 5.71e-12 67 26 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas campestris pv. campestris (strain 8004)
Q50801 5.81e-12 67 29 7 231 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q9M1Q9 5.92e-12 68 28 8 237 1 ABCB21 ABC transporter B family member 21 Arabidopsis thaliana
Q9M1Q9 2.1e-07 55 26 8 236 1 ABCB21 ABC transporter B family member 21 Arabidopsis thaliana
Q8NVB5 5.94e-12 67 30 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 5.94e-12 67 30 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
Q8TTN2 5.96e-12 68 28 6 230 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q1WSB9 5.97e-12 67 28 9 219 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q73R11 6.09e-12 68 26 7 227 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73F67 6.15e-12 67 28 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8R9I2 6.51e-12 67 26 6 233 3 pstB2 Phosphate import ATP-binding protein PstB 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A0R6H8 6.68e-12 68 27 5 213 1 irtA Mycobactin import ATP-binding/permease protein IrtA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8PVG9 6.89e-12 68 26 8 235 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PVG9 5.94e-08 56 26 9 231 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q93DX8 7.01e-12 67 28 6 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q9SZR9 7.13e-12 68 30 6 209 1 ABCG9 ABC transporter G family member 9 Arabidopsis thaliana
Q38UT9 7.48e-12 67 29 7 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q6LR20 7.58e-12 67 28 6 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q6LX68 7.71e-12 67 29 8 236 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q9YG51 7.74e-12 66 26 7 234 3 pstB Phosphate import ATP-binding protein PstB Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q81GU1 8.51e-12 67 28 6 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5WC31 9.03e-12 67 29 6 199 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q668K6 9.04e-12 67 30 8 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
P94440 9.2e-12 67 25 6 233 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
Q38YC1 9.32e-12 66 27 8 211 3 pstB2 Phosphate import ATP-binding protein PstB 2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8Z8W8 9.96e-12 67 28 7 202 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
O34946 1.01e-11 65 28 8 211 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
Q4WTT9 1.02e-11 67 29 8 221 2 mdr1 ABC multidrug transporter mdr1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P21448 1.04e-11 67 30 9 220 1 ABCB1 ATP-dependent translocase ABCB1 Cricetulus griseus
P21448 2.39e-11 67 27 9 243 1 ABCB1 ATP-dependent translocase ABCB1 Cricetulus griseus
Q5PFQ7 1.04e-11 67 28 7 202 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8F6Z1 1.06e-11 67 31 9 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 1.06e-11 67 31 9 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q7MFH3 1.08e-11 67 28 9 220 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q89UD2 1.09e-11 67 32 7 193 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q83HT1 1.1e-11 66 26 5 208 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain TW08/27)
Q830W6 1.14e-11 67 28 10 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q6HPN0 1.15e-11 66 28 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 1.15e-11 66 28 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 1.15e-11 66 28 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q6KHL1 1.15e-11 66 31 7 214 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q48TC3 1.17e-11 66 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J6D2 1.17e-11 66 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGL3 1.17e-11 66 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q897I2 1.2e-11 67 28 10 241 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
P0CZ37 1.2e-11 66 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P63377 1.2e-11 66 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0CZ36 1.2e-11 66 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P63375 1.2e-11 66 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M1
Q7N6Z2 1.22e-11 67 29 6 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q63H62 1.23e-11 66 28 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q88DY1 1.23e-11 66 27 8 208 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1JLH7 1.29e-11 65 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBJ5 1.29e-11 65 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P72479 1.31e-11 66 24 8 229 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P16877 1.35e-11 67 28 8 236 3 MDR4 Multidrug resistance protein 4 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16877 1.38e-06 52 25 9 230 3 MDR4 Multidrug resistance protein 4 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
B2GUP8 1.37e-11 67 27 5 219 2 abcb8 Mitochondrial potassium channel ATP-binding subunit Xenopus tropicalis
O28881 1.39e-11 65 25 5 232 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q5WET8 1.39e-11 65 27 10 235 3 pstB1 Phosphate import ATP-binding protein PstB 1 Shouchella clausii (strain KSM-K16)
Q8D0W8 1.49e-11 66 30 8 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
P63396 1.53e-11 67 27 10 243 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63396 0.000138 46 25 8 219 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ5 1.53e-11 67 27 10 243 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ5 0.000138 46 25 8 219 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ4 1.53e-11 67 27 10 243 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQJ4 0.000138 46 25 8 219 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q11ID5 1.55e-11 65 27 4 189 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q7UC29 1.56e-11 66 29 8 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
P16676 1.65e-11 66 29 8 227 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8XBJ8 1.67e-11 66 29 8 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q9GTN7 1.76e-11 67 27 8 217 1 tagA Serine protease/ABC transporter B family protein tagA Dictyostelium discoideum
Q8FFB3 1.84e-11 66 29 8 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6D4E2 1.85e-11 66 27 6 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q49WM4 1.9e-11 66 25 7 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P40735 1.98e-11 65 32 8 225 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
Q81CT8 2.02e-11 66 29 10 230 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8G7F4 2.12e-11 65 26 6 205 3 pstB Phosphate import ATP-binding protein PstB Bifidobacterium longum (strain NCC 2705)
Q8DRS0 2.2e-11 65 26 7 224 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P33982 2.24e-11 65 24 5 229 3 AZC_3926 Probable ABC transporter ATP-binding protein AZC_3926 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
K3VYH8 2.31e-11 67 28 8 230 3 FPSE_09185 ABC transporter FPSE_09185 Fusarium pseudograminearum (strain CS3096)
K3VYH8 4.85e-06 50 23 10 293 3 FPSE_09185 ABC transporter FPSE_09185 Fusarium pseudograminearum (strain CS3096)
Q4ZV73 2.51e-11 64 30 10 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas syringae pv. syringae (strain B728a)
O26236 2.62e-11 65 27 7 226 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P16876 2.64e-11 66 28 8 236 3 MDR3 Multidrug resistance protein 3 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16876 4.19e-06 51 25 9 230 3 MDR3 Multidrug resistance protein 3 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q8TSC8 2.64e-11 66 28 10 237 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TSC8 4.36e-08 57 27 11 241 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q6FCW7 2.64e-11 65 30 10 216 3 pstB Phosphate import ATP-binding protein PstB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8D3Z9 2.66e-11 66 28 9 220 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
A1B9Q7 2.67e-11 65 29 3 174 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Paracoccus denitrificans (strain Pd 1222)
P40860 2.76e-11 65 29 6 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q4ZRT7 2.81e-11 65 25 9 253 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas syringae pv. syringae (strain B728a)
Q880A6 2.81e-11 65 25 9 253 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q884I3 2.98e-11 64 30 10 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5L3R0 3.01e-11 65 28 7 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
P45171 3.01e-11 65 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P08007 3.06e-11 65 27 8 216 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9JI39 3.14e-11 66 27 8 234 1 Abcb10 ATP-binding cassette sub-family B member 10, mitochondrial Mus musculus
Q8Z4V6 3.17e-11 65 29 6 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q8ST66 3.23e-11 66 28 4 217 3 abcG18 ABC transporter G family member 18 Dictyostelium discoideum
Q8ST66 1.55e-05 49 24 5 215 3 abcG18 ABC transporter G family member 18 Dictyostelium discoideum
Q48HD9 3.25e-11 65 25 9 253 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4QK57 3.34e-11 65 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q8TUR7 3.41e-11 64 29 10 227 3 pstB Phosphate import ATP-binding protein PstB Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q0B1U4 3.47e-11 66 24 3 233 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8DQH4 3.51e-11 64 23 5 218 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM82 3.51e-11 64 23 5 218 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P47425 3.67e-11 65 29 6 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P45022 3.84e-11 64 27 5 231 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q180A5 3.95e-11 64 25 5 208 3 pstB Phosphate import ATP-binding protein PstB Clostridioides difficile (strain 630)
Q4KFA2 4.04e-11 64 30 10 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
D4AYW0 4.13e-11 66 27 5 234 1 ARB_01379 ABC transporter G family member ARB_01379 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
Q9HMZ4 4.22e-11 64 30 8 235 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q9FWX8 4.35e-11 66 26 8 253 2 ABCB12 ABC transporter B family member 12 Arabidopsis thaliana
Q9FWX8 7.28e-07 53 23 6 235 2 ABCB12 ABC transporter B family member 12 Arabidopsis thaliana
O85818 4.74e-11 65 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q7NZI7 4.76e-11 64 27 8 236 3 pstB Phosphate import ATP-binding protein PstB Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8X5Q4 4.89e-11 65 28 7 221 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
Q03AH0 4.91e-11 65 27 8 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
P96063 4.92e-11 65 28 7 202 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9CP06 5.13e-11 65 28 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q9SJK6 5.2e-11 65 26 4 189 1 WBC30 Putative white-brown complex homolog protein 30 Arabidopsis thaliana
Q3JDJ6 5.45e-11 64 28 9 225 3 pstB1 Phosphate import ATP-binding protein PstB 1 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q8DU23 5.45e-11 64 28 7 212 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P63374 5.5e-11 64 29 5 189 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P63373 5.5e-11 64 29 5 189 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q11NG0 5.55e-11 64 25 11 258 3 pstB Phosphate import ATP-binding protein PstB Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q5WET7 5.6e-11 64 27 8 233 3 pstB2 Phosphate import ATP-binding protein PstB 2 Shouchella clausii (strain KSM-K16)
P77268 5.74e-11 65 27 11 247 2 ddpD Probable D,D-dipeptide transport ATP-binding protein DdpD Escherichia coli (strain K12)
P21439 5.98e-11 65 28 10 257 1 ABCB4 Phosphatidylcholine translocator ABCB4 Homo sapiens
P21439 1.74e-08 58 30 9 224 1 ABCB4 Phosphatidylcholine translocator ABCB4 Homo sapiens
Q0S0Z3 6.09e-11 65 28 9 238 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
Q9K8L5 6.47e-11 64 27 8 208 3 pstB Phosphate import ATP-binding protein PstB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q08201 6.62e-11 65 31 9 220 1 Abcb4 Phosphatidylcholine translocator ABCB4 Rattus norvegicus
Q08201 7.19e-11 65 29 11 260 1 Abcb4 Phosphatidylcholine translocator ABCB4 Rattus norvegicus
Q035B3 6.73e-11 64 28 10 223 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q9G4F5 6.86e-11 64 28 7 207 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q58762 6.9e-11 64 28 9 221 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P57551 7.09e-11 65 25 8 231 3 mdlA Multidrug resistance-like ATP-binding protein MdlA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P06795 7.26e-11 65 30 9 220 1 Abcb1b ATP-dependent translocase ABCB1 Mus musculus
P06795 2.5e-10 63 27 9 243 1 Abcb1b ATP-dependent translocase ABCB1 Mus musculus
O70127 7.57e-11 65 29 10 221 1 Abcb11 Bile salt export pump Rattus norvegicus
Q8PUE7 7.59e-11 65 29 7 229 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 5.63e-10 62 28 11 234 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q3Z2Z3 7.72e-11 64 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 7.72e-11 64 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
P71355 7.77e-11 65 26 12 257 3 HI_0663 Uncharacterized ABC transporter ATP-binding protein HI_0663 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5XBY7 8.54e-11 63 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q9NP58 8.57e-11 65 27 10 231 1 ABCB6 ATP-binding cassette sub-family B member 6 Homo sapiens
P21447 8.59e-11 65 29 8 220 1 Abcb1a ATP-dependent translocase ABCB1 Mus musculus
P21447 8.67e-11 65 27 9 243 1 Abcb1a ATP-dependent translocase ABCB1 Mus musculus
Q2IF17 8.69e-11 63 30 7 219 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Anaeromyxobacter dehalogenans (strain 2CP-C)
Q88AS5 8.72e-11 64 27 6 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q30PC0 8.97e-11 63 27 10 238 3 pstB Phosphate import ATP-binding protein PstB Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q5FM17 9.05e-11 63 25 9 241 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q9X2W0 9.06e-11 64 26 10 239 1 mcjD Microcin-J25 export ATP-binding/permease protein McjD Escherichia coli
Q57SD6 9.17e-11 64 28 7 202 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
P57066 9.38e-11 63 28 6 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P55453 9.42e-11 64 28 8 231 3 NGR_a03670 Uncharacterized ABC transporter ATP-binding protein y4fO Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9SYI3 9.46e-11 65 27 7 237 3 ABCB5 ABC transporter B family member 5 Arabidopsis thaliana
Q9SYI3 2.56e-06 51 23 5 231 3 ABCB5 ABC transporter B family member 5 Arabidopsis thaliana
A2RI77 9.52e-11 64 25 10 262 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
Q03PF2 9.73e-11 64 26 8 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q8U4K3 9.8e-11 64 28 8 229 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8VNL9 9.99e-11 63 27 5 212 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
Q9QY30 1.07e-10 65 29 11 232 1 Abcb11 Bile salt export pump Mus musculus
Q87R16 1.09e-10 64 26 10 235 3 msbA ATP-dependent lipid A-core flippase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P63402 1.1e-10 63 27 6 201 3 BQ2027_MB2593 Uncharacterized ABC transporter ATP-binding protein Mb2593 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQI5 1.1e-10 63 27 6 201 1 Rv2564 Uncharacterized ABC transporter ATP-binding protein Rv2564 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQI4 1.1e-10 63 27 6 201 3 MT2640 Uncharacterized ABC transporter ATP-binding protein MT2640 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5PMK1 1.11e-10 64 27 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9KS33 1.13e-10 64 27 6 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3B3H7 1.16e-10 63 26 7 235 3 pstB Phosphate import ATP-binding protein PstB Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q8Z7H7 1.19e-10 64 27 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q67JX4 1.2e-10 63 27 7 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P40790 1.2e-10 64 27 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 1.2e-10 64 27 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
P45247 1.23e-10 62 28 6 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKQ9 1.23e-10 62 28 6 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain 86-028NP)
Q32EY4 1.29e-10 63 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
P63372 1.33e-10 63 26 5 193 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63371 1.33e-10 63 26 5 193 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype III (strain NEM316)
Q04G50 1.33e-10 63 25 9 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
P56344 1.38e-10 62 26 7 219 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
P21440 1.39e-10 64 28 11 263 1 Abcb4 Phosphatidylcholine translocator ABCB4 Mus musculus
P21440 3.01e-09 60 30 9 220 1 Abcb4 Phosphatidylcholine translocator ABCB4 Mus musculus
Q3JYY5 1.42e-10 63 26 5 193 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q13W55 1.42e-10 63 27 9 236 3 pstB Phosphate import ATP-binding protein PstB Paraburkholderia xenovorans (strain LB400)
Q9C7F8 1.43e-10 64 27 7 219 3 ABCB13 ABC transporter B family member 13 Arabidopsis thaliana
Q9C7F8 3.13e-08 57 25 7 221 3 ABCB13 ABC transporter B family member 13 Arabidopsis thaliana
Q65UE1 1.44e-10 63 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8PSR0 1.47e-10 64 23 7 230 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 1.04e-06 52 26 5 219 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8E8K8 1.5e-10 63 27 7 210 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P77737 1.57e-10 63 26 9 216 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
Q8DWR4 1.57e-10 63 25 7 220 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 1.57e-10 63 25 7 220 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 1.57e-10 63 25 7 220 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q1RD28 1.58e-10 63 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 1.58e-10 63 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
Q2W7J9 1.61e-10 63 27 12 254 3 pstB2 Phosphate import ATP-binding protein PstB 2 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q57243 1.62e-10 63 24 3 203 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q65P77 1.64e-10 63 30 7 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q5X627 1.65e-10 63 25 6 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q2SUW7 1.66e-10 63 27 9 234 3 pstB Phosphate import ATP-binding protein PstB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63V79 1.66e-10 63 27 9 234 3 pstB Phosphate import ATP-binding protein PstB Burkholderia pseudomallei (strain K96243)
Q3JTS8 1.66e-10 63 27 9 234 3 pstB Phosphate import ATP-binding protein PstB Burkholderia pseudomallei (strain 1710b)
P69877 1.67e-10 63 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 1.67e-10 63 27 6 221 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 1.67e-10 63 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 1.67e-10 63 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 1.67e-10 63 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q62L74 1.69e-10 63 27 9 234 3 pstB Phosphate import ATP-binding protein PstB Burkholderia mallei (strain ATCC 23344)
Q9KN37 1.7e-10 63 25 7 261 3 rbsA Ribose import ATP-binding protein RbsA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KN37 1.33e-06 52 23 8 234 3 rbsA Ribose import ATP-binding protein RbsA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7NAQ6 1.75e-10 63 30 10 223 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q62K82 1.81e-10 63 28 7 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q7VNG4 1.9e-10 63 28 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A6TEB8 1.93e-10 63 25 5 231 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q5RKI8 1.95e-10 63 25 7 241 2 Abcb8 Mitochondrial potassium channel ATP-binding subunit Rattus norvegicus
Q31VE6 1.98e-10 62 28 8 224 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q890D1 1.98e-10 62 29 5 197 2 larO Nickel import ATP-binding protein LarO Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q87S48 2.01e-10 62 26 10 242 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87H79 2.05e-10 63 24 7 256 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87H79 5.62e-06 50 24 8 225 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q63TY1 2.1e-10 63 28 7 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
P0CZ27 2.11e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 2.11e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P45073 2.12e-10 62 25 6 230 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P36947 2.13e-10 63 23 8 237 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
P36947 0.000467 44 22 10 247 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
Q74KF8 2.14e-10 62 26 9 248 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q39HM4 2.15e-10 62 27 9 234 3 pstB Phosphate import ATP-binding protein PstB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q3BV68 2.16e-10 62 25 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q7W9U5 2.2e-10 63 29 6 191 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8NQU4 2.22e-10 62 28 6 200 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8PM59 2.22e-10 62 25 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas axonopodis pv. citri (strain 306)
Q7VZE5 2.22e-10 63 29 6 191 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2LY16 2.28e-10 62 28 6 248 3 cbiO Cobalt import ATP-binding protein CbiO Syntrophus aciditrophicus (strain SB)
Q5H002 2.29e-10 62 25 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P2Y5 2.29e-10 62 25 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
P63368 2.31e-10 62 29 5 189 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63367 2.31e-10 62 29 5 189 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype III (strain NEM316)
Q3K199 2.31e-10 62 29 5 189 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
O31711 2.37e-10 62 27 8 219 1 yknY Uncharacterized ABC transporter ATP-binding protein YknY Bacillus subtilis (strain 168)
Q8TQ05 2.44e-10 63 27 7 218 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8CK44 2.45e-10 63 25 4 238 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8CK44 1.41e-05 49 25 10 236 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q0T5R2 2.57e-10 63 27 5 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
P9WQJ0 2.58e-10 63 30 8 217 3 MT1311 Uncharacterized ABC transporter ATP-binding protein MT1311 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q138A9 2.61e-10 62 31 6 171 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
Q92MP8 2.63e-10 63 34 4 126 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q92MP8 0.000124 46 24 7 203 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q0RYP7 2.69e-10 63 28 7 214 3 fbpC3 Fe(3+) ions import ATP-binding protein FbpC 3 Rhodococcus jostii (strain RHA1)
Q48QM3 2.69e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RH10 2.69e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J450 2.69e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC9 2.69e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJD0 2.69e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J983 2.69e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMM8 2.69e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B6 2.69e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XI2 2.69e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M1
Q73P93 2.71e-10 63 26 6 213 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P93 4.43e-07 53 25 7 215 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P43245 2.75e-10 63 28 8 227 2 Abcb1 ATP-dependent translocase ABCB1 Rattus norvegicus
P43245 3.69e-09 60 27 8 219 2 Abcb1 ATP-dependent translocase ABCB1 Rattus norvegicus
Q9C8K2 2.75e-10 63 31 6 183 1 ABCG12 ABC transporter G family member 12 Arabidopsis thaliana
Q1LLB5 2.77e-10 62 27 10 237 3 pstB Phosphate import ATP-binding protein PstB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q18C09 2.77e-10 62 27 8 246 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q8TYV9 2.77e-10 62 28 5 221 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q8XXB6 2.82e-10 63 28 9 230 3 msbA ATP-dependent lipid A-core flippase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q65T42 2.82e-10 63 28 8 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A0A481WQK1 2.92e-10 63 28 8 229 3 claG ABC-type transporter claG Penicillium crustosum
P0A4W5 2.93e-10 63 30 8 217 3 BQ2027_MB1304C Uncharacterized ABC transporter ATP-binding protein Mb1304c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ1 2.93e-10 63 30 8 217 1 Rv1273c Uncharacterized ABC transporter ATP-binding protein Rv1273c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q6D201 2.94e-10 62 30 8 194 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JJ55 3.04e-10 63 26 6 238 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A1JJ55 2.23e-05 48 24 7 218 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A0A1U9YI12 3.07e-10 63 28 6 214 2 verA ABC-type transmembrane transporter verA Clonostachys rogersoniana
Q825P1 3.09e-10 63 26 3 204 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P96605 3.16e-10 62 25 8 262 3 ydbJ Uncharacterized ABC transporter ATP-binding protein YdbJ Bacillus subtilis (strain 168)
Q97IE0 3.37e-10 62 26 6 210 3 pstB Phosphate import ATP-binding protein PstB Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9MAH4 3.39e-10 63 28 8 239 3 ABCG10 ABC transporter G family member 10 Arabidopsis thaliana
Q9NUT2 3.41e-10 63 26 6 219 1 ABCB8 Mitochondrial potassium channel ATP-binding subunit Homo sapiens
Q5ZWE4 3.44e-10 62 27 7 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q4A5A5 3.47e-10 62 28 8 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q82WT5 3.48e-10 62 29 7 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q6D437 3.54e-10 63 24 5 222 3 msbA ATP-dependent lipid A-core flippase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6MMH0 3.54e-10 62 25 8 243 3 pstB Phosphate import ATP-binding protein PstB Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q9X0Y8 3.58e-10 62 26 11 226 3 pstB Phosphate import ATP-binding protein PstB Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q080T2 3.61e-10 63 26 6 218 3 msbA ATP-dependent lipid A-core flippase Shewanella frigidimarina (strain NCIMB 400)
Q2SSS4 3.66e-10 62 24 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
O51587 3.68e-10 62 25 8 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q6MU19 3.7e-10 62 24 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q88HL0 3.78e-10 62 28 7 223 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8UA73 3.81e-10 62 27 8 215 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A2U9 3.85e-10 62 25 9 240 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 3.85e-10 62 25 9 240 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8T685 3.86e-10 63 29 8 238 3 abcG12 ABC transporter G family member 12 Dictyostelium discoideum
Q88CL2 3.88e-10 62 27 6 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q63VX7 4.1e-10 62 29 8 236 3 msbA ATP-dependent lipid A-core flippase Burkholderia pseudomallei (strain K96243)
Q3JUI6 4.1e-10 62 29 8 236 3 msbA ATP-dependent lipid A-core flippase Burkholderia pseudomallei (strain 1710b)
Q62IG3 4.1e-10 62 29 8 236 3 msbA ATP-dependent lipid A-core flippase Burkholderia mallei (strain ATCC 23344)
Q46ZA5 4.11e-10 62 27 10 237 3 pstB Phosphate import ATP-binding protein PstB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q9CIS8 4.14e-10 62 26 8 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q9PDN2 4.18e-10 62 26 7 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q58967 4.25e-10 62 28 6 198 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8XNY7 4.26e-10 62 28 8 243 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q660M8 4.28e-10 62 25 7 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q99PE8 4.39e-10 62 27 6 222 1 Abcg5 ATP-binding cassette sub-family G member 5 Mus musculus
Q8EPK1 4.64e-10 62 29 9 215 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q7NA79 4.73e-10 62 25 4 209 3 rbsA Ribose import ATP-binding protein RbsA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q82JY6 4.76e-10 62 26 6 230 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q0I3Y9 4.83e-10 62 26 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q3K9F9 4.97e-10 61 29 9 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas fluorescens (strain Pf0-1)
Q8ZKQ4 5e-10 62 36 1 94 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZKQ4 8.03e-07 53 25 8 222 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8T689 5.05e-10 62 28 7 228 3 abcG4 ABC transporter G family member 4 Dictyostelium discoideum
A9MZG1 5.1e-10 62 36 1 94 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A9MZG1 1.04e-06 52 25 8 222 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJE7 5.1e-10 62 36 1 94 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PJE7 1.04e-06 52 25 8 222 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P77257 5.1e-10 62 35 1 94 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain K12)
P77257 1.81e-05 48 22 7 229 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain K12)
B1XEA1 5.1e-10 62 35 1 94 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain K12 / DH10B)
B1XEA1 1.81e-05 48 22 7 229 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain K12 / DH10B)
Q8RBQ1 5.1e-10 62 24 5 232 3 TTE0763 Putative ribose/galactose/methyl galactoside import ATP-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8RBQ1 9.25e-05 46 22 5 200 3 TTE0763 Putative ribose/galactose/methyl galactoside import ATP-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7MNI7 5.11e-10 61 24 8 250 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain YJ016)
Q8DEW5 5.11e-10 61 24 8 250 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain CMCP6)
Q9PBK0 5.15e-10 61 25 9 235 3 pstB Phosphate import ATP-binding protein PstB Xylella fastidiosa (strain 9a5c)
Q5M4F2 5.22e-10 61 26 5 189 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZU2 5.22e-10 61 26 5 189 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus thermophilus (strain CNRZ 1066)
P0C886 5.39e-10 62 36 1 94 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella choleraesuis (strain SC-B67)
P0C886 1.09e-06 52 25 8 222 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella choleraesuis (strain SC-B67)
Q8Z2X5 5.44e-10 62 36 1 94 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhi
Q8Z2X5 1.21e-06 52 25 8 222 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhi
Q8DGZ3 5.44e-10 61 25 7 235 3 pstB Phosphate import ATP-binding protein PstB Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8DPB4 5.68e-10 61 27 8 212 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8LPK2 5.72e-10 62 27 7 217 1 ABCB2 ABC transporter B family member 2 Arabidopsis thaliana
Q8LPK2 1.96e-07 55 26 7 216 1 ABCB2 ABC transporter B family member 2 Arabidopsis thaliana
Q5WXF0 5.82e-10 62 27 7 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q87DT9 6.09e-10 62 26 8 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9CEW8 6.1e-10 61 26 7 211 3 pstB1 Phosphate import ATP-binding protein PstB 1 Lactococcus lactis subsp. lactis (strain IL1403)
O57896 6.14e-10 62 27 9 218 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q891M1 6.22e-10 62 24 5 198 3 rbsA Ribose import ATP-binding protein RbsA Clostridium tetani (strain Massachusetts / E88)
Q891M1 0.000111 46 26 12 264 3 rbsA Ribose import ATP-binding protein RbsA Clostridium tetani (strain Massachusetts / E88)
Q6LQ00 6.28e-10 62 27 9 222 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 5.84e-05 47 25 7 240 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
P0A2V1 6.32e-10 62 28 7 221 1 ndvA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA Rhizobium radiobacter
P0A2V0 6.32e-10 62 28 7 221 3 ndvA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA Agrobacterium fabrum (strain C58 / ATCC 33970)
Q67RG2 6.4e-10 61 25 8 223 3 pstB1 Phosphate import ATP-binding protein PstB 1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A3CRB9 6.48e-10 61 31 9 214 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q2S3A3 6.77e-10 61 32 8 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salinibacter ruber (strain DSM 13855 / M31)
Q47Y12 6.78e-10 61 26 9 238 3 pstB Phosphate import ATP-binding protein PstB Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q8T6J0 6.94e-10 62 27 7 232 3 abcA7 ABC transporter A family member 7 Dictyostelium discoideum
Q7WGW1 6.94e-10 62 29 6 191 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9Z3R9 6.98e-10 62 28 8 233 3 aglK Alpha-glucoside transport ATP-binding protein AglK Rhizobium meliloti (strain 1021)
Q5RFQ9 7.32e-10 62 26 6 219 2 ABCB8 Mitochondrial potassium channel ATP-binding subunit Pongo abelii
Q5E4V6 7.7e-10 62 25 6 228 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E4V6 2.47e-06 51 23 9 234 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q71WT2 7.82e-10 61 24 8 239 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria monocytogenes serotype 4b (strain F2365)
O75027 7.84e-10 62 28 6 221 1 ABCB7 Iron-sulfur clusters transporter ABCB7, mitochondrial Homo sapiens
Q2NHW1 7.92e-10 60 26 9 246 3 pstB Phosphate import ATP-binding protein PstB Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
A2RI78 8.11e-10 61 26 9 223 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
A3PRY1 8.17e-10 61 27 6 205 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q2SZW0 8.39e-10 62 29 8 236 3 msbA ATP-dependent lipid A-core flippase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P0A193 8.46e-10 60 25 8 243 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A194 8.46e-10 60 25 8 243 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhi
Q9C8J8 8.59e-10 62 33 5 167 2 ABCG13 ABC transporter G family member 13 Arabidopsis thaliana
Q927Z7 8.69e-10 60 24 8 239 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q97Q34 8.76e-10 60 27 8 212 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q1BG93 8.8e-10 62 25 6 236 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
Q1BG93 0.000264 45 24 9 241 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
A0KE53 8.8e-10 62 25 6 236 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
A0KE53 0.000264 45 24 9 241 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
Q5E586 8.8e-10 61 26 7 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8X4L6 9e-10 60 28 8 224 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
P77279 9.09e-10 60 29 8 192 1 fetA Probable iron export ATP-binding protein FetA Escherichia coli (strain K12)
P36619 9.1e-10 62 27 6 218 3 pmd1 Leptomycin B resistance protein pmd1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P36619 4.43e-09 60 26 6 235 3 pmd1 Leptomycin B resistance protein pmd1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8K985 9.12e-10 62 26 9 241 3 mdlA Multidrug resistance-like ATP-binding protein MdlA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P08183 9.19e-10 62 30 9 220 1 ABCB1 ATP-dependent translocase ABCB1 Homo sapiens
P08183 1.28e-09 61 26 9 243 1 ABCB1 ATP-dependent translocase ABCB1 Homo sapiens
O27739 9.22e-10 61 26 7 234 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P25885 9.23e-10 60 24 7 228 3 R00382 Uncharacterized ABC transporter ATP-binding protein R00382 Rhizobium meliloti (strain 1021)
Q8ETV7 9.31e-10 60 29 6 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B9G5Y5 9.43e-10 62 29 6 182 2 ABCG25 ABC transporter G family member 25 Oryza sativa subsp. japonica
Q93SH7 9.53e-10 60 31 6 172 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8Y4E9 9.57e-10 60 24 8 239 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q827Y0 9.89e-10 61 25 9 246 3 metN Methionine import ATP-binding protein MetN Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9CXJ4 1e-09 62 25 5 219 1 Abcb8 Mitochondrial potassium channel ATP-binding subunit Mus musculus
Q9NGP5 1e-09 62 30 3 182 1 abcG2 ABC transporter G family member 2 Dictyostelium discoideum
G7CBF5 1e-09 62 24 5 216 1 irtA Mycobactin import ATP-binding/permease protein IrtA Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316)
Q0SML1 1.01e-09 61 25 8 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
G7CBF6 1.01e-09 61 28 9 237 1 irtB Mycobactin import ATP-binding/permease protein IrtB Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316)
B1LFA2 1.02e-09 61 35 1 94 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain SMS-3-5 / SECEC)
B1LFA2 3.33e-05 48 22 7 229 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain SMS-3-5 / SECEC)
Q895Y0 1.03e-09 60 25 7 238 3 pstB Phosphate import ATP-binding protein PstB Clostridium tetani (strain Massachusetts / E88)
Q6LH11 1.05e-09 61 25 5 228 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6LH11 1.89e-08 57 24 8 234 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q1CDJ0 1.05e-09 61 27 9 237 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDJ0 1.13e-05 49 24 7 217 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CG00 1.05e-09 61 27 9 237 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q7CG00 1.13e-05 49 24 7 217 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q1C1B8 1.05e-09 61 27 9 237 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C1B8 1.13e-05 49 24 7 217 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
P54718 1.05e-09 61 27 9 240 3 yfiB Uncharacterized ABC transporter ATP-binding protein YfiB Bacillus subtilis (strain 168)
P0A9S9 1.06e-09 60 26 8 242 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Shigella flexneri
P0A9S7 1.06e-09 60 26 8 242 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli (strain K12)
P0A9S8 1.06e-09 60 26 8 242 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli O157:H7
P36879 1.09e-09 61 28 5 202 1 yadG Uncharacterized ABC transporter ATP-binding protein YadG Escherichia coli (strain K12)
Q9M0M2 1.1e-09 62 28 8 243 3 ABCB9 ABC transporter B family member 9 Arabidopsis thaliana
Q9M0M2 0.000553 44 23 6 233 3 ABCB9 ABC transporter B family member 9 Arabidopsis thaliana
Q6HNE7 1.12e-09 61 24 5 208 3 rbsA Ribose import ATP-binding protein RbsA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HNE7 4.51e-08 56 25 7 218 3 rbsA Ribose import ATP-binding protein RbsA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81V36 1.12e-09 61 24 5 208 3 rbsA Ribose import ATP-binding protein RbsA Bacillus anthracis
Q81V36 4.51e-08 56 25 7 218 3 rbsA Ribose import ATP-binding protein RbsA Bacillus anthracis
Q2RFS8 1.16e-09 60 28 8 218 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9KU04 1.17e-09 60 26 9 240 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q03I82 1.17e-09 60 27 7 227 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q63FX9 1.17e-09 61 24 5 208 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ZK / E33L)
Q63FX9 2.87e-08 57 25 7 218 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ZK / E33L)
Q664G2 1.17e-09 61 27 9 237 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q664G2 8.84e-06 49 24 8 228 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q39S52 1.19e-09 60 24 10 256 3 pstB Phosphate import ATP-binding protein PstB Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q1J982 1.19e-09 60 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q02151 1.21e-09 60 27 7 236 3 ymeB Uncharacterized ABC transporter ATP-binding protein YmeB Lactococcus lactis subsp. lactis (strain IL1403)
Q3J7R8 1.21e-09 61 29 9 225 3 msbA ATP-dependent lipid A-core flippase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B2KWH4 1.21e-09 61 25 8 220 2 ABC1 ABC transporter 1 Ajellomyces capsulatus
B2KWH4 1.88e-06 52 24 8 255 2 ABC1 ABC transporter 1 Ajellomyces capsulatus
O34900 1.23e-09 60 28 9 238 1 tcyN L-cystine import ATP-binding protein TcyN Bacillus subtilis (strain 168)
Q3ILC5 1.23e-09 60 25 9 252 3 pstB Phosphate import ATP-binding protein PstB Pseudoalteromonas translucida (strain TAC 125)
Q1R5D8 1.25e-09 60 27 8 224 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 1.25e-09 60 27 8 224 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 1.25e-09 60 27 8 224 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q12L15 1.25e-09 60 25 8 251 3 pstB Phosphate import ATP-binding protein PstB Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8DMX9 1.25e-09 60 28 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 1.25e-09 60 28 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 1.25e-09 60 28 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q5FM18 1.25e-09 60 28 10 229 3 pstB1 Phosphate import ATP-binding protein PstB 1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q9HPH7 1.26e-09 60 28 10 252 3 VNG_1631G Putative ABC transporter ATP-binding protein VNG_1631G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P24136 1.31e-09 61 26 10 264 1 oppD Oligopeptide transport ATP-binding protein OppD Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03505
Feature type CDS
Gene sufC
Product Fe-S cluster assembly ATPase SufC
Location 750073 - 750819 (strand: 1)
Length 747 (nucleotides) / 248 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1099
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0396 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster assembly ATPase SufC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09013 Fe-S cluster assembly ATP-binding protein - -

Protein Sequence

MLSVKDLHVSVEGNEILKGLSLEVKPGEIHAIMGPNGSGKSTLSATLAGREDYEVDSGTVSFKGKDLLELAPEDRAGEGIFLAFQYPVEIPGVSNQFFLQTAVNAVRKYRSQSELDRFDFADFIEDKIELLNMPQDLLTRAVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDIDALKTVANGVNQLRSPERAFIIVTHYQRILDYVKPDFVHVLYQGKIIKSGDFSLAKKLEEQGYGWLIDQQ

Flanking regions ( +/- flanking 50bp)

ACATCAGAATCAGCGCCCGCGGACTAACCGGCGGGACGGAGTAGTACATTATGTTAAGTGTAAAAGATTTGCATGTCAGCGTGGAAGGTAACGAGATCCTCAAAGGGCTATCCCTTGAGGTAAAACCGGGTGAAATTCACGCGATTATGGGACCGAACGGCTCCGGAAAAAGCACCTTATCTGCCACTCTGGCAGGGCGGGAAGATTACGAAGTTGATAGCGGTACCGTCAGTTTTAAAGGTAAAGACCTGCTGGAGCTGGCGCCGGAAGATCGCGCCGGTGAGGGGATTTTCCTGGCATTTCAGTATCCGGTGGAAATTCCCGGTGTCAGCAATCAGTTCTTCCTGCAAACCGCAGTGAATGCGGTGCGTAAATACCGCAGCCAATCAGAGCTGGATCGGTTTGATTTTGCTGATTTTATTGAAGATAAAATTGAGTTGCTCAATATGCCGCAGGATCTGCTGACGCGCGCGGTGAATGTCGGGTTCTCCGGCGGTGAGAAAAAACGTAACGATATCCTGCAAATGGCAGCGCTTGAGCCGTCACTGTGCATCCTGGATGAAACCGATTCCGGGCTGGATATTGATGCCCTGAAAACCGTGGCAAATGGGGTCAATCAACTGCGCAGCCCGGAGCGCGCCTTTATTATTGTCACGCACTATCAGCGGATCCTCGATTATGTAAAACCGGATTTTGTTCATGTGCTGTATCAGGGCAAAATTATCAAATCCGGTGATTTCTCACTGGCTAAAAAACTGGAGGAGCAGGGATATGGCTGGCTTATTGACCAACAGTGAACGCGCGCTGAAACGCAGTCAGGTCAGTGAGCGCAATGCGGCGGCGATGG