Homologs in group_1032

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05820 FBDBKF_05820 100.0 Morganella morganii S1 sufC Fe-S cluster assembly ATPase SufC
EHELCC_11770 EHELCC_11770 100.0 Morganella morganii S2 sufC Fe-S cluster assembly ATPase SufC
NLDBIP_12110 NLDBIP_12110 100.0 Morganella morganii S4 sufC Fe-S cluster assembly ATPase SufC
HKOGLL_10585 HKOGLL_10585 100.0 Morganella morganii S5 sufC Fe-S cluster assembly ATPase SufC
F4V73_RS03505 F4V73_RS03505 96.0 Morganella psychrotolerans sufC Fe-S cluster assembly ATPase SufC
PMI_RS06840 PMI_RS06840 86.7 Proteus mirabilis HI4320 sufC Fe-S cluster assembly ATPase SufC

Distribution of the homologs in the orthogroup group_1032

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1032

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77499 2.43e-153 429 81 0 248 1 sufC Probable ATP-dependent transporter SufC Escherichia coli (strain K12)
Q55791 2.69e-101 298 57 0 247 3 slr0075 Probable ATP-dependent transporter slr0075 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P51241 5.77e-100 294 56 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Porphyra purpurea
P48255 8.1e-99 291 57 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Cyanophora paradoxa
Q1XDP6 2.17e-98 290 55 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Neopyropia yezoensis
O78474 7.67e-97 286 55 0 247 3 ycf16 Probable ATP-dependent transporter ycf16 Guillardia theta
Q02856 3.11e-95 282 54 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Antithamnion sp.
Q00830 3.96e-95 282 55 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Trieres chinensis
P80866 1.74e-93 278 53 1 243 1 sufC Vegetative protein 296 Bacillus subtilis (strain 168)
P35020 2e-88 265 51 2 249 3 ycf16 Probable ATP-dependent transporter ycf16 Galdieria sulphuraria
Q9CAF5 2.46e-87 265 53 1 243 1 ABCI6 ABC transporter I family member 6, chloroplastic Arabidopsis thaliana
Q8P2M5 1.21e-85 258 50 1 244 3 spyM18_0273 Probable ABC transporter ATP-binding protein spyM18_0273 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q9A1G5 1.77e-85 258 50 1 244 3 SPy_0285 Probable ABC transporter ATP-binding protein SPy_0285/M5005_Spy0242 Streptococcus pyogenes serotype M1
Q5XDV5 1.77e-85 258 50 1 244 1 M6_Spy0273 Probable ABC transporter ATP-binding protein M6_Spy0273 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ43 1.77e-85 258 50 1 244 3 SPs0214 Probable ABC transporter ATP-binding protein SPs0214 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ42 1.77e-85 258 50 1 244 3 SpyM3_0208 Probable ABC transporter ATP-binding protein SpyM3_0208 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8ILW0 5.58e-83 254 48 2 249 1 SufC Iron-sulfur cluster assembly protein SufC Plasmodium falciparum (isolate 3D7)
A0A509AN56 4.53e-78 242 46 2 249 1 SufC Iron-sulfur cluster assembly protein SufC Plasmodium berghei (strain Anka)
Q9TLX1 5.21e-78 238 45 0 244 3 ycf16 Probable ATP-dependent transporter ycf16 Cyanidium caldarium
Q60350 1.71e-40 142 35 4 230 3 MJ0035 Uncharacterized ABC transporter ATP-binding protein MJ0035 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8U3E0 9.93e-17 80 31 9 234 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P34712 2.6e-16 81 28 8 237 1 pgp-1 Multidrug resistance protein pgp-1 Caenorhabditis elegans
Q8RHL0 1.42e-15 77 33 8 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
O65934 1.84e-15 79 30 5 212 1 Rv1747 ABC transporter ATP-binding/permease protein Rv1747 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q93YS4 1.89e-15 79 35 5 188 1 ABCG22 ABC transporter G family member 22 Arabidopsis thaliana
Q97KD5 2.2e-15 77 29 9 247 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q1DDP4 9.25e-15 75 31 13 246 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
P0DTT6 9.44e-15 74 25 4 228 1 xylG Xylose/arabinose import ATP-binding protein XylG Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q58488 1.17e-14 75 29 9 247 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8ZX91 2.02e-14 73 28 9 239 3 pstB Phosphate import ATP-binding protein PstB Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q8ES39 2.05e-14 75 31 5 209 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 4.47e-05 47 26 4 161 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q97ZT9 2.52e-14 73 28 10 241 3 pstB Phosphate import ATP-binding protein PstB Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q9K6J9 2.99e-14 75 28 4 205 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K6J9 1.3e-05 49 26 5 191 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9Y8G1 3.15e-14 75 31 8 221 1 atrD ABC multidrug transporter atrD Emericella nidulans
Q9Y8G1 3e-06 51 26 9 239 1 atrD ABC multidrug transporter atrD Emericella nidulans
A0A348AXX9 3.3e-14 75 27 9 236 2 kk1G ABC-type transporter kk1G Curvularia clavata
A0A348AXX9 0.000379 45 26 4 126 2 kk1G ABC-type transporter kk1G Curvularia clavata
Q5BAY0 3.4e-14 75 31 7 219 1 atrD ABC multidrug transporter atrD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5BAY0 2.84e-06 51 26 9 239 1 atrD ABC multidrug transporter atrD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8T674 4.12e-14 74 29 7 231 3 abcG20 ABC transporter G family member 20 Dictyostelium discoideum
Q7UX73 4.98e-14 72 28 9 246 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q54BU4 5.78e-14 74 29 6 214 3 abcB1 ABC transporter B family member 1 Dictyostelium discoideum
Q9X196 6.57e-14 73 28 7 242 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q50294 6.8e-14 72 31 6 214 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8YYE2 6.83e-14 72 29 7 211 3 pstB2 Phosphate import ATP-binding protein PstB 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3M4H5 7.11e-14 72 29 7 211 3 pstB5 Phosphate import ATP-binding protein PstB 5 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q92N13 8.13e-14 72 28 4 211 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
F2T1C4 8.28e-14 73 31 8 217 1 MDR2 ABC multidrug transporter MDR2 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
P16875 8.99e-14 73 30 7 235 3 MDR1 Multidrug resistance protein 1 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16875 6.87e-09 59 27 9 227 3 MDR1 Multidrug resistance protein 1 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q834B4 9.02e-14 72 29 6 215 3 pstB1 Phosphate import ATP-binding protein PstB 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q2NHA1 9.76e-14 72 28 7 235 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
A3CRB8 9.86e-14 72 28 6 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
P33310 1.05e-13 73 29 9 253 1 MDL1 ATP-dependent permease MDL1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8E9I8 1.31e-13 71 26 7 238 3 pstB2 Phosphate import ATP-binding protein PstB 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q55DA0 1.51e-13 73 28 6 242 2 abcG22 ABC transporter G family member 22 Dictyostelium discoideum
A0A059JJ46 1.66e-13 73 31 8 217 2 MDR2 ABC multidrug transporter MDR2 Trichophyton interdigitale (strain MR816)
A0A059JJ46 9.11e-06 50 26 7 235 2 MDR2 ABC multidrug transporter MDR2 Trichophyton interdigitale (strain MR816)
Q2NIT5 1.75e-13 71 30 9 230 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
P54537 2.42e-13 70 27 5 230 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q11ID5 2.51e-13 70 29 4 189 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q58663 2.7e-13 70 27 7 223 1 livG Probable branched-chain amino acid transport ATP-binding protein LivG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A3CVD3 2.95e-13 70 30 8 232 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
F2RP52 3.14e-13 72 30 8 217 2 MDR2 ABC multidrug transporter MDR2 Trichophyton tonsurans (strain CBS 112818)
F2RP52 8.63e-06 50 26 7 235 2 MDR2 ABC multidrug transporter MDR2 Trichophyton tonsurans (strain CBS 112818)
F2PRR1 3.14e-13 72 30 8 217 2 MDR2 ABC multidrug transporter MDR2 Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
F2PRR1 8.63e-06 50 26 7 235 2 MDR2 ABC multidrug transporter MDR2 Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
Q2SJY7 3.89e-13 71 29 6 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q4WSI1 4.2e-13 72 29 9 216 2 mdr4 ABC multidrug transporter mdr4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WSI1 5.94e-06 50 25 8 224 2 mdr4 ABC multidrug transporter mdr4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9KS33 4.45e-13 71 29 6 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8TUR7 4.59e-13 70 30 10 233 3 pstB Phosphate import ATP-binding protein PstB Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q6LR20 5.87e-13 70 29 5 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
O31339 6.23e-13 70 29 8 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q83GE8 6.28e-13 69 27 5 208 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain Twist)
Q2S081 6.42e-13 69 25 8 236 3 pstB Phosphate import ATP-binding protein PstB Salinibacter ruber (strain DSM 13855 / M31)
Q1WSB8 6.54e-13 70 30 5 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
Q9GTN7 6.87e-13 71 30 8 215 1 tagA Serine protease/ABC transporter B family protein tagA Dictyostelium discoideum
Q38YC1 7.97e-13 69 28 8 211 3 pstB2 Phosphate import ATP-binding protein PstB 2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8G838 8.01e-13 71 30 6 217 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 3.9e-08 57 26 4 196 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q56A55 8.74e-13 70 29 5 216 2 abcb8 Mitochondrial potassium channel ATP-binding subunit Danio rerio
Q93DX8 9.81e-13 69 29 6 207 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q88XV2 1.04e-12 69 30 6 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8F6L8 1.13e-12 68 25 9 250 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q00449 1.2e-12 70 29 8 225 2 Mdr49 Multidrug resistance protein homolog 49 Drosophila melanogaster
Q00449 5.21e-09 59 29 8 223 2 Mdr49 Multidrug resistance protein homolog 49 Drosophila melanogaster
Q8U242 1.21e-12 68 29 10 239 3 pstB Phosphate import ATP-binding protein PstB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O27764 1.25e-12 68 26 9 240 3 pstB Phosphate import ATP-binding protein PstB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q72PP0 1.29e-12 68 25 9 250 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
P94440 1.31e-12 69 26 6 233 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
P45171 1.32e-12 70 28 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A3DJK5 1.35e-12 69 31 12 236 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q897I2 1.36e-12 70 28 9 222 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q4WTT9 1.45e-12 70 30 8 218 2 mdr1 ABC multidrug transporter mdr1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WTT9 7.72e-05 47 26 7 212 2 mdr1 ABC multidrug transporter mdr1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q3JDJ6 1.54e-12 68 29 9 225 3 pstB1 Phosphate import ATP-binding protein PstB 1 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q88DY1 1.57e-12 68 28 8 208 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P96605 1.74e-12 68 26 8 262 3 ydbJ Uncharacterized ABC transporter ATP-binding protein YdbJ Bacillus subtilis (strain 168)
A1TXH7 1.75e-12 69 28 7 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
P72479 1.76e-12 68 26 9 229 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q839D5 1.94e-12 68 28 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q3SJQ8 2.13e-12 68 27 7 216 3 pstB Phosphate import ATP-binding protein PstB Thiobacillus denitrificans (strain ATCC 25259)
Q4QK57 2.14e-12 69 28 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q8FVN0 2.18e-12 68 30 10 229 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q81J16 2.23e-12 68 28 6 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P39456 2.28e-12 68 29 7 217 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q38UT9 2.29e-12 68 29 7 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q9ZU35 2.53e-12 69 29 3 220 2 ABCG7 ABC transporter G family member 7 Arabidopsis thaliana
A0A125QXJ1 2.63e-12 69 27 8 230 2 ABCB6 ATP-binding cassette sub-family B member 6 Mesocricetus auratus
Q7NC40 2.74e-12 68 25 7 230 3 pstB Phosphate import ATP-binding protein PstB Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q81GU1 2.99e-12 68 29 6 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 3.08e-12 69 28 6 227 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
K3VYH8 3.08e-12 69 27 7 231 3 FPSE_09185 ABC transporter FPSE_09185 Fusarium pseudograminearum (strain CS3096)
K3VYH8 1.31e-05 49 23 9 293 3 FPSE_09185 ABC transporter FPSE_09185 Fusarium pseudograminearum (strain CS3096)
Q73R11 3.1e-12 68 26 7 227 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73R11 0.000863 43 24 9 214 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q6LX68 3.11e-12 68 30 8 236 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q8PVG9 3.17e-12 69 27 8 235 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PVG9 3.96e-07 53 26 9 231 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8YCN7 3.36e-12 67 30 10 229 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 3.36e-12 67 30 10 229 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 3.36e-12 67 30 10 229 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q8D3Z9 3.66e-12 68 29 10 220 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
O34946 3.87e-12 67 28 8 211 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
O31711 3.93e-12 67 26 7 219 1 yknY Uncharacterized ABC transporter ATP-binding protein YknY Bacillus subtilis (strain 168)
Q7UC29 4.03e-12 68 28 7 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q9DC29 4.28e-12 68 27 8 230 1 Abcb6 ATP-binding cassette sub-family B member 6 Mus musculus
Q0A9K1 4.4e-12 67 27 10 265 3 pstB Phosphate import ATP-binding protein PstB Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
P40860 4.43e-12 68 31 8 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FFB3 4.43e-12 68 28 7 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P16676 4.51e-12 68 28 7 225 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8Z4V6 4.54e-12 68 31 8 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
O85818 4.63e-12 68 28 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q8PAG0 4.65e-12 67 26 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UT63 4.65e-12 67 26 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas campestris pv. campestris (strain 8004)
Q87R16 4.7e-12 68 27 10 235 3 msbA ATP-dependent lipid A-core flippase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8XBJ8 4.87e-12 68 28 7 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
P0CZ37 4.91e-12 67 30 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P63377 4.91e-12 67 30 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0CZ36 4.91e-12 67 30 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P63375 4.91e-12 67 30 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M1
Q9CP06 5.15e-12 68 29 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q8DQH4 5.3e-12 66 25 5 218 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM82 5.3e-12 66 25 5 218 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q48TC3 5.33e-12 67 30 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J6D2 5.33e-12 67 30 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGL3 5.33e-12 67 30 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLH7 5.43e-12 67 30 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBJ5 5.43e-12 67 30 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P63402 5.52e-12 67 28 6 201 3 BQ2027_MB2593 Uncharacterized ABC transporter ATP-binding protein Mb2593 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQI5 5.52e-12 67 28 6 201 1 Rv2564 Uncharacterized ABC transporter ATP-binding protein Rv2564 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQI4 5.52e-12 67 28 6 201 3 MT2640 Uncharacterized ABC transporter ATP-binding protein MT2640 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8ST66 5.64e-12 68 29 4 217 3 abcG18 ABC transporter G family member 18 Dictyostelium discoideum
Q6KHL1 5.88e-12 67 31 7 214 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
P96063 6.26e-12 67 28 6 208 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9UZU7 6.3e-12 67 23 7 242 3 pstB Phosphate import ATP-binding protein PstB Pyrococcus abyssi (strain GE5 / Orsay)
Q8Z8W8 6.32e-12 67 28 6 208 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
Q5PFQ7 6.38e-12 67 28 6 208 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7MFH3 6.54e-12 68 29 10 220 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
O70595 6.57e-12 68 27 8 230 1 Abcb6 ATP-binding cassette sub-family B member 6 Rattus norvegicus
Q2RWU0 7.24e-12 66 26 12 256 3 pstB Phosphate import ATP-binding protein PstB Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q4ZRT7 7.42e-12 66 26 10 254 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas syringae pv. syringae (strain B728a)
Q880A6 7.42e-12 66 26 10 254 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q73F67 7.48e-12 67 28 6 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9FWX7 7.67e-12 68 28 8 252 2 ABCB11 ABC transporter B family member 11 Arabidopsis thaliana
Q9FWX7 9.04e-09 59 26 6 233 2 ABCB11 ABC transporter B family member 11 Arabidopsis thaliana
Q7A470 7.74e-12 67 29 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 7.74e-12 67 29 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7MKU3 7.77e-12 67 30 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 7.77e-12 67 30 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q8R9I2 7.93e-12 66 25 7 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8G7F4 7.94e-12 66 27 7 205 3 pstB Phosphate import ATP-binding protein PstB Bifidobacterium longum (strain NCC 2705)
Q3Z2Z3 8.18e-12 67 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 8.18e-12 67 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q50801 8.26e-12 67 29 7 231 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q48HD9 8.59e-12 66 26 10 254 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B2GUP8 8.72e-12 67 28 8 245 2 abcb8 Mitochondrial potassium channel ATP-binding subunit Xenopus tropicalis
Q7N6Z2 8.76e-12 67 29 6 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P9WQJ9 8.83e-12 68 26 8 220 1 irtA Mycobactin import ATP-binding/permease protein IrtA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ8 8.83e-12 68 26 8 220 3 irtA Mycobactin import ATP-binding/permease protein IrtA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63392 8.83e-12 68 26 8 220 3 irtA Mycobactin import ATP-binding/permease protein IrtA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2YYM4 8.87e-12 66 29 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5HDY6 9.69e-12 66 29 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 9.69e-12 66 29 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 9.69e-12 66 29 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q9HMZ4 9.96e-12 66 30 7 231 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q87PH3 1e-11 67 30 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5E586 1.03e-11 67 29 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9SZR9 1.07e-11 67 30 6 209 1 ABCG9 ABC transporter G family member 9 Arabidopsis thaliana
Q9WY65 1.08e-11 66 30 7 213 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A6TEB8 1.1e-11 67 25 5 231 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q5FM17 1.1e-11 66 27 9 239 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q9M1Q9 1.12e-11 67 28 8 237 1 ABCB21 ABC transporter B family member 21 Arabidopsis thaliana
Q9M1Q9 5.58e-08 56 25 8 236 1 ABCB21 ABC transporter B family member 21 Arabidopsis thaliana
Q83HT1 1.12e-11 66 26 5 208 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain TW08/27)
Q6GEL3 1.16e-11 66 29 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
P40735 1.2e-11 66 34 11 231 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
Q32EY4 1.22e-11 67 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
Q08D64 1.22e-11 67 27 8 229 2 abcb6 ATP-binding cassette sub-family B member 6 Xenopus tropicalis
Q49WM4 1.23e-11 67 25 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q57SD6 1.24e-11 67 28 6 208 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
A2RI77 1.29e-11 67 26 10 262 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
Q1WSB9 1.34e-11 66 28 7 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
P47425 1.4e-11 66 29 6 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9JI39 1.41e-11 67 27 8 234 1 Abcb10 ATP-binding cassette sub-family B member 10, mitochondrial Mus musculus
Q6FCW7 1.41e-11 66 31 11 216 3 pstB Phosphate import ATP-binding protein PstB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q63H62 1.46e-11 66 28 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
P33982 1.49e-11 66 25 5 229 3 AZC_3926 Probable ABC transporter ATP-binding protein AZC_3926 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q6HPN0 1.49e-11 66 28 6 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 1.49e-11 66 28 6 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 1.49e-11 66 28 6 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q87H79 1.5e-11 67 25 7 253 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87H79 2.05e-06 51 25 9 225 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q58967 1.59e-11 66 29 6 198 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q63TY1 1.6e-11 66 29 7 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
P69877 1.65e-11 66 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 1.65e-11 66 27 6 221 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 1.65e-11 66 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 1.65e-11 66 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 1.65e-11 66 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q62K82 1.66e-11 66 29 7 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q1RD28 1.69e-11 66 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 1.69e-11 66 27 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
Q8Z7H7 1.79e-11 66 27 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q5PMK1 1.79e-11 66 27 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7VNG4 1.84e-11 66 29 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P71355 1.85e-11 67 26 11 249 3 HI_0663 Uncharacterized ABC transporter ATP-binding protein HI_0663 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P63396 1.87e-11 67 29 11 246 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63396 9.69e-05 46 24 6 214 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ5 1.87e-11 67 29 11 246 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ5 9.69e-05 46 24 6 214 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ4 1.87e-11 67 29 11 246 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQJ4 9.69e-05 46 24 6 214 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P40790 1.9e-11 66 27 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 1.9e-11 66 27 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
O28881 1.9e-11 65 26 5 232 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q11NG0 1.92e-11 65 25 10 265 3 pstB Phosphate import ATP-binding protein PstB Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A0R6H8 1.94e-11 67 28 6 213 1 irtA Mycobactin import ATP-binding/permease protein IrtA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q668K6 1.97e-11 66 30 8 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8F6Z1 1.97e-11 66 31 9 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 1.97e-11 66 31 9 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8EPK1 2.13e-11 66 30 9 215 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8NVB5 2.2e-11 65 29 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 2.2e-11 65 29 8 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
P21449 2.29e-11 67 29 8 217 2 PGY2 Multidrug resistance protein 2 Cricetulus griseus
P21449 1.35e-10 64 27 9 243 2 PGY2 Multidrug resistance protein 2 Cricetulus griseus
Q88AS5 2.34e-11 65 28 6 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q080T2 2.49e-11 66 26 6 218 3 msbA ATP-dependent lipid A-core flippase Shewanella frigidimarina (strain NCIMB 400)
P45022 2.52e-11 65 27 6 236 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0T5R2 2.59e-11 66 28 5 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
Q8D0W8 2.61e-11 66 30 8 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
Q9PDN2 2.64e-11 65 27 7 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q65UE1 2.65e-11 66 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q74KF8 2.69e-11 65 27 10 248 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q5WC31 2.7e-11 66 30 7 201 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q8TSC8 2.77e-11 66 28 10 237 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TSC8 1.36e-07 55 26 10 241 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q5XBY7 3e-11 65 29 6 185 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
O26236 3.15e-11 65 28 7 226 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q6D4E2 3.26e-11 65 26 6 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8PSR0 3.39e-11 66 26 9 237 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 2.94e-07 54 25 5 235 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P26905 3.61e-11 65 28 9 249 3 dppD Dipeptide transport ATP-binding protein DppD Bacillus subtilis (strain 168)
Q87DT9 3.65e-11 65 27 7 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q3ABN1 3.83e-11 65 29 7 223 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9X2W0 3.91e-11 65 27 10 239 1 mcjD Microcin-J25 export ATP-binding/permease protein McjD Escherichia coli
Q9M0M2 3.98e-11 66 29 8 243 3 ABCB9 ABC transporter B family member 9 Arabidopsis thaliana
Q9M0M2 0.000392 45 23 6 233 3 ABCB9 ABC transporter B family member 9 Arabidopsis thaliana
P36619 4.15e-11 66 27 6 235 3 pmd1 Leptomycin B resistance protein pmd1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P36619 4.73e-09 60 27 6 218 3 pmd1 Leptomycin B resistance protein pmd1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9NP58 4.18e-11 65 27 10 231 1 ABCB6 ATP-binding cassette sub-family B member 6 Homo sapiens
Q827Y0 4.19e-11 65 27 10 246 3 metN Methionine import ATP-binding protein MetN Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5L3R0 4.26e-11 64 29 7 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
G7CBF6 4.29e-11 65 28 9 237 1 irtB Mycobactin import ATP-binding/permease protein IrtB Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316)
Q8DU23 4.4e-11 64 29 7 212 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8TTN2 4.47e-11 65 28 6 230 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q5KUX3 4.48e-11 65 25 6 228 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q5KUX3 7.2e-05 47 23 8 222 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q0SIB7 4.53e-11 65 25 4 243 3 hmuV Hemin import ATP-binding protein HmuV Rhodococcus jostii (strain RHA1)
P21439 4.82e-11 65 28 10 257 1 ABCB4 Phosphatidylcholine translocator ABCB4 Homo sapiens
P21439 2.05e-06 52 27 9 224 1 ABCB4 Phosphatidylcholine translocator ABCB4 Homo sapiens
Q8T685 5.07e-11 65 29 8 238 3 abcG12 ABC transporter G family member 12 Dictyostelium discoideum
Q82JY6 5.07e-11 65 27 6 230 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8PUE7 5.28e-11 65 29 11 234 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 4.38e-10 62 28 8 230 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q87G35 5.47e-11 65 28 8 228 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 0.000129 46 24 8 217 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LH11 5.56e-11 65 25 5 228 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6LH11 4.63e-08 56 26 9 234 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6HI76 5.58e-11 65 28 7 242 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6YR39 5.65e-11 64 30 9 230 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q89UD2 5.82e-11 65 32 6 192 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P45073 6.24e-11 63 25 6 230 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8UA73 6.32e-11 64 27 7 215 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2SSS4 6.51e-11 64 25 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q9RYZ3 6.7e-11 63 26 9 226 3 pstB Phosphate import ATP-binding protein PstB Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q0I3Y9 6.72e-11 65 26 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q6MU19 6.83e-11 64 25 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
P21440 6.87e-11 65 28 11 263 1 Abcb4 Phosphatidylcholine translocator ABCB4 Mus musculus
P21440 1.71e-09 61 29 8 217 1 Abcb4 Phosphatidylcholine translocator ABCB4 Mus musculus
P16876 7.5e-11 65 29 9 236 3 MDR3 Multidrug resistance protein 3 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16876 1.65e-06 52 27 10 227 3 MDR3 Multidrug resistance protein 3 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P63374 7.75e-11 63 30 6 189 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P63373 7.75e-11 63 30 6 189 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q21TG3 7.99e-11 63 27 9 229 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q884I3 8.15e-11 63 30 10 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88CL2 8.2e-11 64 28 6 206 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5E4V6 8.23e-11 65 25 5 228 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E4V6 6.64e-06 50 23 9 234 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9FWX8 8.27e-11 65 26 8 253 2 ABCB12 ABC transporter B family member 12 Arabidopsis thaliana
Q9FWX8 4.67e-08 57 25 6 235 2 ABCB12 ABC transporter B family member 12 Arabidopsis thaliana
Q13FD9 8.62e-11 64 26 6 231 3 Bxeno_C1272 Putative ribose/galactose/methyl galactoside import ATP-binding protein Paraburkholderia xenovorans (strain LB400)
Q4KFA2 9.08e-11 63 30 10 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A0KPH6 9.33e-11 63 27 8 207 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
O70127 9.65e-11 65 29 10 221 1 Abcb11 Bile salt export pump Rattus norvegicus
Q2IF17 9.77e-11 63 30 8 219 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Anaeromyxobacter dehalogenans (strain 2CP-C)
Q08201 9.78e-11 65 28 11 260 1 Abcb4 Phosphatidylcholine translocator ABCB4 Rattus norvegicus
Q08201 1.49e-09 61 28 8 217 1 Abcb4 Phosphatidylcholine translocator ABCB4 Rattus norvegicus
Q9LSJ5 1.02e-10 65 28 7 222 3 ABCB18 ABC transporter B family member 18 Arabidopsis thaliana
Q9LSJ5 0.000785 44 27 9 228 3 ABCB18 ABC transporter B family member 18 Arabidopsis thaliana
Q9K8L5 1.07e-10 63 26 7 218 3 pstB Phosphate import ATP-binding protein PstB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3JYY5 1.08e-10 63 26 5 193 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8VNL9 1.09e-10 63 27 5 212 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
Q9PBK0 1.1e-10 63 25 9 235 3 pstB Phosphate import ATP-binding protein PstB Xylella fastidiosa (strain 9a5c)
Q8DRS0 1.1e-10 63 26 7 224 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9QY30 1.13e-10 64 29 11 232 1 Abcb11 Bile salt export pump Mus musculus
Q9Z3R9 1.19e-10 64 29 8 233 3 aglK Alpha-glucoside transport ATP-binding protein AglK Rhizobium meliloti (strain 1021)
Q13W55 1.22e-10 63 27 9 239 3 pstB Phosphate import ATP-binding protein PstB Paraburkholderia xenovorans (strain LB400)
Q6LQ00 1.22e-10 64 29 11 223 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 0.000146 46 25 7 240 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q2LY16 1.23e-10 63 28 6 248 3 cbiO Cobalt import ATP-binding protein CbiO Syntrophus aciditrophicus (strain SB)
Q12M46 1.24e-10 64 27 8 236 3 msbA ATP-dependent lipid A-core flippase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P25885 1.25e-10 63 25 7 228 3 R00382 Uncharacterized ABC transporter ATP-binding protein R00382 Rhizobium meliloti (strain 1021)
P63368 1.27e-10 63 30 6 189 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63367 1.27e-10 63 30 6 189 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype III (strain NEM316)
Q3K199 1.27e-10 63 30 6 189 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q03ZQ0 1.28e-10 63 25 8 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
P63372 1.34e-10 63 26 5 193 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63371 1.34e-10 63 26 5 193 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype III (strain NEM316)
Q5WET7 1.38e-10 63 28 9 234 3 pstB2 Phosphate import ATP-binding protein PstB 2 Shouchella clausii (strain KSM-K16)
P23174 1.39e-10 64 26 8 239 2 ABCB4 Phosphatidylcholine translocator ABCB4 Cricetulus griseus
P23174 1.05e-09 62 29 8 217 2 ABCB4 Phosphatidylcholine translocator ABCB4 Cricetulus griseus
Q9HZL7 1.41e-10 62 27 8 227 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3BV68 1.42e-10 63 25 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q57243 1.49e-10 63 24 3 203 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q62L74 1.51e-10 63 27 8 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia mallei (strain ATCC 23344)
Q5NIG3 1.51e-10 64 25 9 252 3 msbA ATP-dependent lipid A-core flippase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JW6 1.51e-10 64 25 9 252 1 msbA ATP-dependent lipid A-core flippase Francisella tularensis subsp. tularensis (strain FSC 198)
Q2YAD6 1.51e-10 63 27 7 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q48KI4 1.52e-10 62 30 10 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2SUW7 1.52e-10 63 27 8 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63V79 1.52e-10 63 27 8 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia pseudomallei (strain K96243)
Q3JTS8 1.52e-10 63 27 8 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia pseudomallei (strain 1710b)
P06795 1.53e-10 64 29 8 217 1 Abcb1b ATP-dependent translocase ABCB1 Mus musculus
P06795 1.79e-09 61 26 9 243 1 Abcb1b ATP-dependent translocase ABCB1 Mus musculus
Q5H002 1.55e-10 63 25 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P2Y5 1.55e-10 63 25 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8X5Q4 1.61e-10 63 28 7 221 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
P9WQJ0 1.62e-10 64 31 9 218 3 MT1311 Uncharacterized ABC transporter ATP-binding protein MT1311 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q834B3 1.63e-10 63 26 7 232 3 pstB2 Phosphate import ATP-binding protein PstB 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8PM59 1.63e-10 63 25 8 233 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas axonopodis pv. citri (strain 306)
P21448 1.63e-10 64 28 8 217 1 ABCB1 ATP-dependent translocase ABCB1 Cricetulus griseus
P21448 3.7e-10 63 27 9 243 1 ABCB1 ATP-dependent translocase ABCB1 Cricetulus griseus
P0A4W5 1.69e-10 63 31 9 218 3 BQ2027_MB1304C Uncharacterized ABC transporter ATP-binding protein Mb1304c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ1 1.69e-10 63 31 9 218 1 Rv1273c Uncharacterized ABC transporter ATP-binding protein Rv1273c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P56344 1.75e-10 62 26 7 220 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
G5EG61 1.77e-10 64 31 8 218 2 pgp-14 P-glycoprotein 14 Caenorhabditis elegans
G5EG61 1.22e-07 55 24 8 237 2 pgp-14 P-glycoprotein 14 Caenorhabditis elegans
P08007 1.81e-10 63 27 8 216 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6D201 1.85e-10 63 29 7 196 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5PJX5 1.88e-10 63 25 6 236 3 rbsA Ribose import ATP-binding protein RbsA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PJX5 3.29e-07 54 24 7 232 3 rbsA Ribose import ATP-binding protein RbsA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ELT4 1.94e-10 62 27 8 220 3 pstB Phosphate import ATP-binding protein PstB Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q7NZI7 1.96e-10 62 27 9 236 3 pstB Phosphate import ATP-binding protein PstB Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8CK44 2e-10 63 25 4 238 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8CK44 1.65e-06 52 25 10 236 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5LS19 2.02e-10 62 25 10 247 3 pstB Phosphate import ATP-binding protein PstB Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
P0A2U9 2.03e-10 63 26 9 240 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 2.03e-10 63 26 9 240 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97IE0 2.07e-10 62 26 6 210 3 pstB Phosphate import ATP-binding protein PstB Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9I6L0 2.1e-10 63 28 6 207 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5WXF0 2.15e-10 63 26 6 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q5RKI8 2.16e-10 63 26 7 241 2 Abcb8 Mitochondrial potassium channel ATP-binding subunit Rattus norvegicus
Q89A97 2.17e-10 63 23 7 239 3 mdlA Multidrug resistance-like ATP-binding protein MdlA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P07821 2.23e-10 62 28 8 229 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
Q03AH0 2.24e-10 63 25 8 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8DWR4 2.24e-10 62 26 6 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 2.24e-10 62 26 6 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 2.24e-10 62 26 6 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q0B1U4 2.35e-10 63 25 5 238 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q47908 2.43e-10 63 26 8 246 3 msbA ATP-dependent lipid A-core flippase Francisella novicida
P0CZ27 2.47e-10 62 26 6 216 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 2.47e-10 62 26 6 216 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0A2V2 2.53e-10 62 28 8 248 2 occP Octopine permease ATP-binding protein P Rhizobium radiobacter
P0A2V3 2.53e-10 62 28 8 248 3 occP Octopine permease ATP-binding protein P Agrobacterium tumefaciens (strain Ach5)
Q9SYI3 2.56e-10 63 27 7 237 3 ABCB5 ABC transporter B family member 5 Arabidopsis thaliana
Q9SYI3 4.96e-08 57 26 8 240 3 ABCB5 ABC transporter B family member 5 Arabidopsis thaliana
Q3E9B8 2.69e-10 63 27 9 243 2 ABCG23 ABC transporter G family member 23 Arabidopsis thaliana
Q3AAA4 2.7e-10 62 26 9 217 3 pstB Phosphate import ATP-binding protein PstB Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q1J982 2.72e-10 62 33 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q035B3 2.77e-10 62 27 8 220 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q035B2 2.83e-10 62 32 9 231 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q5RFQ9 2.89e-10 63 27 7 221 2 ABCB8 Mitochondrial potassium channel ATP-binding subunit Pongo abelii
P36947 2.92e-10 63 23 8 237 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
P36947 8.87e-05 46 23 10 247 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
Q180A5 2.97e-10 62 24 5 211 3 pstB Phosphate import ATP-binding protein PstB Clostridioides difficile (strain 630)
A2RH10 3.02e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J450 3.02e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC9 3.02e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJD0 3.02e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J983 3.02e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMM8 3.02e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B6 3.02e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XI2 3.02e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M1
Q7MNI7 3.04e-10 62 24 7 250 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain YJ016)
Q8DEW5 3.04e-10 62 24 7 250 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain CMCP6)
Q5WET8 3.05e-10 62 25 9 235 3 pstB1 Phosphate import ATP-binding protein PstB 1 Shouchella clausii (strain KSM-K16)
P55453 3.13e-10 62 27 6 231 3 NGR_a03670 Uncharacterized ABC transporter ATP-binding protein y4fO Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9KN37 3.26e-10 63 25 7 262 3 rbsA Ribose import ATP-binding protein RbsA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KN37 1.02e-05 49 23 9 243 3 rbsA Ribose import ATP-binding protein RbsA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q48QM3 3.26e-10 62 26 6 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q38VW6 3.27e-10 62 26 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q99PE8 3.29e-10 63 27 6 222 1 Abcg5 ATP-binding cassette sub-family G member 5 Mus musculus
Q9CXJ4 3.32e-10 63 26 5 219 1 Abcb8 Mitochondrial potassium channel ATP-binding subunit Mus musculus
Q5ZWE4 3.34e-10 62 26 6 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q6D437 3.34e-10 63 25 5 222 3 msbA ATP-dependent lipid A-core flippase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q98L75 3.45e-10 62 24 7 248 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P77268 3.45e-10 62 26 10 242 2 ddpD Probable D,D-dipeptide transport ATP-binding protein DdpD Escherichia coli (strain K12)
Q2W7J9 3.57e-10 62 26 11 256 3 pstB2 Phosphate import ATP-binding protein PstB 2 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q8TYV9 3.57e-10 62 29 7 227 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q9NUT2 3.57e-10 63 26 6 220 1 ABCB8 Mitochondrial potassium channel ATP-binding subunit Homo sapiens
P16877 3.58e-10 63 28 9 236 3 MDR4 Multidrug resistance protein 4 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16877 6.61e-07 53 27 10 227 3 MDR4 Multidrug resistance protein 4 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q73P93 3.58e-10 63 25 6 213 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P93 1.25e-07 55 28 9 217 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q18CJ0 3.61e-10 62 30 9 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
Q890D1 3.7e-10 61 29 5 197 2 larO Nickel import ATP-binding protein LarO Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9SJK6 3.71e-10 63 26 4 189 1 WBC30 Putative white-brown complex homolog protein 30 Arabidopsis thaliana
Q87C88 3.74e-10 62 25 9 235 3 pstB Phosphate import ATP-binding protein PstB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8DQY5 3.86e-10 63 28 7 231 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 0.000164 46 23 8 227 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0C0E9 3.92e-10 62 32 5 174 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 3.92e-10 62 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48QM2 3.92e-10 62 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RH11 3.92e-10 62 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 3.92e-10 62 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 3.92e-10 62 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJC9 3.92e-10 62 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q7CMM7 3.92e-10 62 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 3.92e-10 62 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 3.92e-10 62 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0E8 3.92e-10 62 32 5 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q5X627 3.96e-10 62 25 6 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q2M3G0 4.09e-10 63 31 7 214 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q2M3G0 2.76e-08 57 29 7 216 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q6G2E2 4.12e-10 62 26 8 218 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q8T689 4.31e-10 63 28 4 217 3 abcG4 ABC transporter G family member 4 Dictyostelium discoideum
A3CRB9 4.37e-10 62 31 9 214 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q8RBQ1 4.39e-10 62 24 5 232 3 TTE0763 Putative ribose/galactose/methyl galactoside import ATP-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8RBQ1 1.17e-06 52 23 5 200 3 TTE0763 Putative ribose/galactose/methyl galactoside import ATP-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P21447 4.41e-10 63 27 9 243 1 Abcb1a ATP-dependent translocase ABCB1 Mus musculus
P21447 6.82e-10 62 29 8 220 1 Abcb1a ATP-dependent translocase ABCB1 Mus musculus
Q03ZL6 4.42e-10 62 27 9 249 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q18AM3 4.45e-10 62 25 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
O57896 4.58e-10 62 27 9 218 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q92MP8 4.64e-10 62 33 3 126 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q92MP8 0.000307 45 23 7 203 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
B8K1W2 4.69e-10 63 31 12 224 1 Abcb11e Bile salt export pump Canis lupus familiaris
Q0BKJ3 4.88e-10 62 25 9 252 3 msbA ATP-dependent lipid A-core flippase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1U9 4.88e-10 62 25 9 252 3 msbA ATP-dependent lipid A-core flippase Francisella tularensis subsp. holarctica (strain LVS)
A0A1U9YI12 4.97e-10 62 28 6 214 2 verA ABC-type transmembrane transporter verA Clonostachys rogersoniana
A0A1U9YI12 1.83e-06 52 25 8 247 2 verA ABC-type transmembrane transporter verA Clonostachys rogersoniana
Q87S48 5.01e-10 61 23 5 246 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1QX69 5.02e-10 62 28 6 221 3 msbA ATP-dependent lipid A-core flippase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
D4AYW0 5.24e-10 62 26 5 234 1 ARB_01379 ABC transporter G family member ARB_01379 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
Q8DGZ3 5.34e-10 61 25 9 249 3 pstB Phosphate import ATP-binding protein PstB Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8DMX9 5.49e-10 61 28 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 5.49e-10 61 28 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 5.49e-10 61 28 7 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q39HM4 5.56e-10 61 27 8 237 3 pstB Phosphate import ATP-binding protein PstB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q65T42 5.72e-10 62 27 7 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q729H7 5.81e-10 61 28 6 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8XNY7 5.95e-10 61 27 7 243 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q8ETV7 6.05e-10 61 28 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8LPK2 6.1e-10 62 27 7 217 1 ABCB2 ABC transporter B family member 2 Arabidopsis thaliana
Q8LPK2 3.66e-07 54 25 7 217 1 ABCB2 ABC transporter B family member 2 Arabidopsis thaliana
Q30PC0 6.12e-10 61 27 10 238 3 pstB Phosphate import ATP-binding protein PstB Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q81PZ8 6.17e-10 62 28 7 242 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q9C9W0 6.35e-10 61 28 12 237 2 ABCI17 ABC transporter I family member 17 Arabidopsis thaliana
O27739 6.37e-10 61 27 7 234 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8TQ05 6.41e-10 62 26 7 218 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 1.13e-05 49 28 6 228 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q30YR3 6.52e-10 61 27 9 231 3 pstB Phosphate import ATP-binding protein PstB Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8FZV2 6.64e-10 60 28 6 232 3 BR1368 Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363 Brucella suis biovar 1 (strain 1330)
Q05596 6.64e-10 61 25 7 265 1 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P9WQK5 6.69e-10 61 29 8 214 1 Rv0073 Uncharacterized ABC transporter ATP-binding protein Rv0073 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQK4 6.69e-10 61 29 8 214 3 MT0079 Uncharacterized ABC transporter ATP-binding protein MT0079 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8Z5N5 6.7e-10 61 26 7 265 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhi
Q8UBB7 6.73e-10 62 27 5 208 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A2V1 6.74e-10 62 29 9 221 1 ndvA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA Rhizobium radiobacter
P0A2V0 6.74e-10 62 29 9 221 3 ndvA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA Agrobacterium fabrum (strain C58 / ATCC 33970)
A0PXX7 6.77e-10 61 29 9 231 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium novyi (strain NT)
Q03I82 6.9e-10 61 27 7 227 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q2NHW1 6.98e-10 61 22 5 247 3 pstB Phosphate import ATP-binding protein PstB Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q895Y0 6.99e-10 61 25 8 249 3 pstB Phosphate import ATP-binding protein PstB Clostridium tetani (strain Massachusetts / E88)
Q65P77 7.08e-10 61 30 7 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q53193 7.08e-10 61 25 7 248 3 NGR_a01410 Probable peptide ABC transporter ATP-binding protein y4tR Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8DPB4 7.08e-10 61 28 8 212 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q88KY4 7.28e-10 60 29 9 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5PDU4 7.45e-10 61 26 7 265 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q08234 7.57e-10 62 28 4 199 1 YOL075C Uncharacterized ABC transporter ATP-binding protein/permease YOL075C Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q08234 8.38e-07 53 25 9 254 1 YOL075C Uncharacterized ABC transporter ATP-binding protein/permease YOL075C Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8XAW7 7.6e-10 62 24 6 236 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Escherichia coli O157:H7
Q8XAW7 4.49e-08 56 25 9 228 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Escherichia coli O157:H7
P77737 7.68e-10 61 26 9 216 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
Q3B3H7 7.68e-10 61 27 9 236 3 pstB Phosphate import ATP-binding protein PstB Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q9Z9J3 7.85e-10 61 30 5 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q67JX4 7.94e-10 61 27 7 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8PC11 8.01e-10 61 28 7 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q88HL0 8.09e-10 61 27 7 223 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q825P1 8.38e-10 62 26 3 204 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q825P1 1.19e-05 49 24 8 222 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9KQW9 8.47e-10 62 27 7 229 1 msbA ATP-dependent lipid A-core flippase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q93SH7 8.66e-10 60 30 5 175 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q46ZA5 8.74e-10 60 26 9 238 3 pstB Phosphate import ATP-binding protein PstB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0APW8 8.88e-10 60 31 10 202 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Maricaulis maris (strain MCS10)
Q4A5A5 8.94e-10 60 27 8 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
B5X0E4 8.99e-10 62 28 8 228 2 Abcb5 ATP-binding cassette sub-family B member 5 Mus musculus
B5X0E4 2.71e-06 51 27 7 218 2 Abcb5 ATP-binding cassette sub-family B member 5 Mus musculus
A1JJ55 9.02e-10 62 26 7 238 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A1JJ55 9.82e-06 49 24 7 218 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q57213 9.26e-10 60 27 8 226 3 HI_1474 Uncharacterized ABC transporter ATP-binding protein HI_1474 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57551 9.43e-10 62 24 7 231 3 mdlA Multidrug resistance-like ATP-binding protein MdlA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9G4F5 9.53e-10 61 28 7 207 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q6YUU5 9.68e-10 62 28 8 225 3 Os02g0190300 Putative multidrug resistance protein Oryza sativa subsp. japonica
A2RKA7 9.73e-10 61 24 9 243 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
A2RKA7 4.57e-06 50 27 8 218 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
Q03PY5 9.76e-10 60 28 9 245 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q71WT2 9.85e-10 60 26 10 245 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria monocytogenes serotype 4b (strain F2365)
Q03PF2 1.03e-09 61 25 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
P0A2V5 1.04e-09 61 25 7 214 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 1.04e-09 61 25 7 214 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
Q1BG93 1.06e-09 61 25 6 236 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
Q1BG93 0.000722 43 25 9 241 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
A0KE53 1.06e-09 61 25 6 236 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
A0KE53 0.000722 43 25 9 241 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
Q97Q34 1.07e-09 60 28 8 212 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q927Z7 1.07e-09 60 26 10 245 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y4E9 1.08e-09 60 26 10 245 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q7VZE5 1.09e-09 61 30 5 191 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W9U5 1.09e-09 61 30 5 191 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q3MAR5 1.11e-09 61 27 7 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q7NA79 1.14e-09 61 23 5 217 3 rbsA Ribose import ATP-binding protein RbsA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8RCU0 1.16e-09 60 26 7 233 3 pstB1 Phosphate import ATP-binding protein PstB 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q2YQP3 1.17e-09 60 28 6 232 3 BAB1_1388 Putative ABC transporter ATP-binding protein BAB1_1388 Brucella abortus (strain 2308)
Q57CD8 1.17e-09 60 28 6 232 3 BruAb1_1365 Putative ABC transporter ATP-binding protein BruAb1_1365 Brucella abortus biovar 1 (strain 9-941)
Q1LLB5 1.2e-09 60 26 9 238 3 pstB Phosphate import ATP-binding protein PstB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q5M4F2 1.2e-09 60 28 6 189 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZU2 1.2e-09 60 28 6 189 3 pstB2 Phosphate import ATP-binding protein PstB 2 Streptococcus thermophilus (strain CNRZ 1066)
Q663R5 1.22e-09 60 26 10 240 3 pstB2 Phosphate import ATP-binding protein PstB 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CCI2 1.22e-09 60 26 10 240 3 pstB2 Phosphate import ATP-binding protein PstB 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8Z9T1 1.22e-09 60 26 10 240 3 pstB2 Phosphate import ATP-binding protein PstB 2 Yersinia pestis
Q1C0A2 1.22e-09 60 26 10 240 3 pstB2 Phosphate import ATP-binding protein PstB 2 Yersinia pestis bv. Antiqua (strain Antiqua)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_11970
Feature type CDS
Gene sufC
Product Fe-S cluster assembly ATPase SufC
Location 14108 - 14854 (strand: 1)
Length 747 (nucleotides) / 248 (amino acids)

Contig

Accession ZDB_369
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1032
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0396 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster assembly ATPase SufC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09013 Fe-S cluster assembly ATP-binding protein - -

Protein Sequence

MLSVKDLHVSVEGNEILKGLSLDVKPGEIHAIMGPNGSGKSTLSATLAGREEYEIDSGSVTFKGKDLLELAPEDRAGEGIFLAFQYPVEIPGVSNQFFLQTAVNAVREYRGEEALDRFDFADFIEDKIELLNMPQDLLTRAVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDIDALKTVANGVNQLRSPERAFIIVTHYQRILDYVKPDFVHVLYQGKIIKSGDFSLAKKLEEQGYGWLIDQQ

Flanking regions ( +/- flanking 50bp)

CCATCAGAATCAGCGCCTGCGGGATAACCGGCGGGACGGAGTAGTACATTATGTTAAGCGTAAAAGATTTGCATGTCAGCGTGGAGGGTAACGAAATCCTCAAAGGGTTATCACTGGACGTGAAACCGGGGGAAATCCACGCCATTATGGGGCCGAATGGTTCTGGTAAAAGTACCCTGTCTGCCACACTGGCCGGCCGGGAAGAGTATGAAATTGACAGCGGATCCGTCACTTTTAAAGGTAAAGACCTGCTGGAGCTGGCACCGGAAGACCGTGCCGGTGAAGGCATTTTCCTCGCCTTTCAGTACCCGGTGGAAATTCCCGGGGTAAGTAACCAGTTTTTCCTGCAAACCGCAGTCAATGCGGTGCGCGAATATCGCGGTGAAGAGGCGCTGGACCGCTTCGATTTCGCTGATTTTATCGAAGATAAAATTGAGCTGCTGAATATGCCGCAGGATCTGCTGACGCGTGCGGTGAACGTCGGGTTCTCCGGCGGTGAGAAAAAACGTAACGATATCCTGCAAATGGCTGCCCTTGAGCCGTCACTCTGCATTCTTGATGAAACGGATTCCGGGCTGGATATTGATGCCCTGAAAACCGTGGCCAACGGCGTGAATCAGCTGCGCAGCCCGGAACGCGCCTTTATTATTGTCACTCATTATCAGCGCATCCTGGATTATGTGAAGCCTGACTTTGTTCATGTATTGTATCAGGGCAAAATCATCAAATCCGGTGATTTCTCACTGGCGAAAAAACTGGAGGAGCAGGGATATGGCTGGCTTATTGACCAACAGTGAACGCGCGCTGAAACGCCGCGAAGTCAGTGAGCGCAATCTGGCCGCAATGG