Homologs in group_1028

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05795 FBDBKF_05795 64.9 Morganella morganii S1 lpp Major outer membrane lipoprotein Lpp
EHELCC_11795 EHELCC_11795 64.9 Morganella morganii S2 lpp Major outer membrane lipoprotein Lpp
NLDBIP_12135 NLDBIP_12135 64.9 Morganella morganii S4 lpp Major outer membrane lipoprotein Lpp
LHKJJB_11995 LHKJJB_11995 64.9 Morganella morganii S3 lpp Major outer membrane lipoprotein Lpp
HKOGLL_10610 HKOGLL_10610 64.9 Morganella morganii S5 lpp Major outer membrane lipoprotein Lpp
F4V73_RS03530 F4V73_RS03530 64.9 Morganella psychrotolerans - major outer membrane lipoprotein

Distribution of the homologs in the orthogroup group_1028

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1028

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P09461 4.63e-47 147 98 1 79 3 lpp Major outer membrane lipoprotein Lpp Proteus mirabilis
Q6D622 1.29e-26 95 65 1 78 3 lpp Major outer membrane lipoprotein Lpp Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P02940 4.39e-26 94 64 1 78 3 lpp Major outer membrane lipoprotein Lpp Morganella morganii
Q7N3U8 6.88e-26 93 61 1 78 3 lpp Major outer membrane lipoprotein Lpp Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66A25 9.67e-26 93 64 1 78 3 lpp Major outer membrane lipoprotein Lpp Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZDZ6 9.67e-26 93 64 1 78 3 lpp Major outer membrane lipoprotein Lpp Yersinia pestis
Q7CQN4 1.18e-25 93 62 1 78 3 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFI1 1.18e-25 93 62 1 78 3 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella typhi
E8XH70 1.18e-25 93 62 1 78 2 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella typhimurium (strain 4/74)
Q5PH64 1.18e-25 93 62 1 78 3 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P69780 4.79e-25 91 63 2 80 3 lpp Major outer membrane lipoprotein Lpp Shigella flexneri
P69776 4.79e-25 91 63 2 80 1 lpp Major outer membrane lipoprotein Lpp Escherichia coli (strain K12)
P69777 4.79e-25 91 63 2 80 3 lpp Major outer membrane lipoprotein Lpp Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69778 4.79e-25 91 63 2 80 3 lpp Major outer membrane lipoprotein Lpp Escherichia coli O157:H7
P02939 1.73e-24 90 60 1 78 3 lpp Major outer membrane lipoprotein Lpp Erwinia amylovora
Q5PH63 2.16e-22 84 57 1 76 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P02938 1.7e-21 82 60 2 78 3 lpp Major outer membrane lipoprotein Lpp Serratia marcescens
Q5PH62 2.54e-21 82 60 1 71 3 lpp3 Major outer membrane lipoprotein Lpp 3 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z6K1 3.61e-21 81 60 1 71 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella typhi
Q8ZPP9 8.2e-21 80 59 1 71 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E8XH69 8.2e-21 80 59 1 71 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella typhimurium (strain 4/74)
P65299 3.5e-11 56 42 1 73 3 yqhH Uncharacterized lipoprotein YqhH Shigella flexneri
P65298 3.5e-11 56 42 1 73 3 yqhH Uncharacterized lipoprotein YqhH Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06815
Feature type CDS
Gene -
Product Lpp/OprI family alanine-zipper lipoprotein
Location 1488740 - 1488979 (strand: 1)
Length 240 (nucleotides) / 79 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1028
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04728 Lipoprotein leucine-zipper

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4238 Cell wall/membrane/envelope biogenesis (M) M Outer membrane murein-binding lipoprotein Lpp

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06078 murein lipoprotein - -

Protein Sequence

MKAKIVLGAVILASGLLAGCSSSNNAQLDQISSDVNRLNTQVQQLSSDVQSANAQAKAAYDEAARANQRLDNQVTTYKK

Flanking regions ( +/- flanking 50bp)

ACAAAATGCTACTTGTTCCTTTAAACAAACTAATAATAGAGGTTGTCACAATGAAAGCAAAAATTGTACTAGGTGCGGTAATTCTGGCTTCAGGCCTATTAGCAGGTTGTTCTTCTAGCAACAACGCACAATTAGACCAAATCTCTTCTGATGTAAACCGTTTAAATACGCAAGTTCAACAACTAAGTAGTGATGTTCAATCAGCTAACGCTCAAGCAAAAGCCGCTTATGATGAAGCAGCTCGTGCTAATCAGCGTCTAGATAACCAAGTAACTACTTATAAAAAATAATTTGACTGCTTAATAAGCTGAAAACGTTAAGTCAGCTTTAATTAATAATA