Homologs in group_1096

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05795 FBDBKF_05795 100.0 Morganella morganii S1 lpp Major outer membrane lipoprotein Lpp
EHELCC_11795 EHELCC_11795 100.0 Morganella morganii S2 lpp Major outer membrane lipoprotein Lpp
NLDBIP_12135 NLDBIP_12135 100.0 Morganella morganii S4 lpp Major outer membrane lipoprotein Lpp
HKOGLL_10610 HKOGLL_10610 100.0 Morganella morganii S5 lpp Major outer membrane lipoprotein Lpp
F4V73_RS03530 F4V73_RS03530 94.9 Morganella psychrotolerans - major outer membrane lipoprotein
PMI_RS06815 PMI_RS06815 64.9 Proteus mirabilis HI4320 - Lpp/OprI family alanine-zipper lipoprotein

Distribution of the homologs in the orthogroup group_1096

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1096

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P02940 5.25e-49 152 100 0 78 3 lpp Major outer membrane lipoprotein Lpp Morganella morganii
Q6D622 4.25e-40 129 82 0 78 3 lpp Major outer membrane lipoprotein Lpp Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7N3U8 1.32e-39 128 82 0 78 3 lpp Major outer membrane lipoprotein Lpp Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66A25 7.8e-39 126 79 0 78 3 lpp Major outer membrane lipoprotein Lpp Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZDZ6 7.8e-39 126 79 0 78 3 lpp Major outer membrane lipoprotein Lpp Yersinia pestis
P02939 7.49e-38 124 78 0 78 3 lpp Major outer membrane lipoprotein Lpp Erwinia amylovora
Q7CQN4 4.58e-37 121 76 0 78 3 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFI1 4.58e-37 121 76 0 78 3 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella typhi
E8XH70 4.58e-37 121 76 0 78 2 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella typhimurium (strain 4/74)
Q5PH64 4.58e-37 121 76 0 78 3 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P69780 5.37e-35 116 74 0 78 3 lpp Major outer membrane lipoprotein Lpp Shigella flexneri
P69776 5.37e-35 116 74 0 78 1 lpp Major outer membrane lipoprotein Lpp Escherichia coli (strain K12)
P69777 5.37e-35 116 74 0 78 3 lpp Major outer membrane lipoprotein Lpp Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69778 5.37e-35 116 74 0 78 3 lpp Major outer membrane lipoprotein Lpp Escherichia coli O157:H7
P02938 3.09e-34 114 75 1 78 3 lpp Major outer membrane lipoprotein Lpp Serratia marcescens
Q5PH63 2.46e-33 112 73 1 79 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PH62 7.87e-33 111 78 1 74 3 lpp3 Major outer membrane lipoprotein Lpp 3 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z6K1 2.97e-32 109 77 1 74 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella typhi
Q8ZPP9 3.51e-31 107 74 1 74 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E8XH69 3.51e-31 107 74 1 74 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella typhimurium (strain 4/74)
P09461 8.67e-18 73 62 2 78 3 lpp Major outer membrane lipoprotein Lpp Proteus mirabilis
P65299 6.93e-16 68 48 0 70 3 yqhH Uncharacterized lipoprotein YqhH Shigella flexneri
P65298 6.93e-16 68 48 0 70 3 yqhH Uncharacterized lipoprotein YqhH Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_11995
Feature type CDS
Gene lpp
Product Major outer membrane lipoprotein Lpp
Location 19121 - 19357 (strand: -1)
Length 237 (nucleotides) / 78 (amino acids)
In genomic island -

Contig

Accession ZDB_369
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1096
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04728 Lipoprotein leucine-zipper

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4238 Cell wall/membrane/envelope biogenesis (M) M Outer membrane murein-binding lipoprotein Lpp

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06078 murein lipoprotein - -

Protein Sequence

MGRSKIVLGAVVLASALLAGCSSNAKFDQLDNDVKTLNAKVDQLSNDVNAIRADVQQAKDEAARANQRLDNQVRSYKK

Flanking regions ( +/- flanking 50bp)

AATATCATTACTGCTACTTGGTGATTAACTTTAATCTAGAGGGTATTAAAATGGGTCGTTCTAAGATTGTATTAGGTGCTGTAGTTTTAGCTTCTGCATTATTAGCAGGTTGTTCTTCTAACGCTAAATTTGACCAACTGGACAACGACGTTAAGACGCTGAATGCCAAAGTTGATCAACTGAGCAACGATGTTAACGCAATCCGCGCTGATGTTCAGCAGGCTAAAGACGAAGCAGCACGCGCTAACCAGCGCTTAGACAACCAGGTTCGTTCTTACAAAAAATAATTTGTAATCACGATCTGAAGAACAGGTGGCGTAGCATAAATTATGTTACG