Homologs in group_1096

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05795 FBDBKF_05795 94.9 Morganella morganii S1 lpp Major outer membrane lipoprotein Lpp
EHELCC_11795 EHELCC_11795 94.9 Morganella morganii S2 lpp Major outer membrane lipoprotein Lpp
NLDBIP_12135 NLDBIP_12135 94.9 Morganella morganii S4 lpp Major outer membrane lipoprotein Lpp
LHKJJB_11995 LHKJJB_11995 94.9 Morganella morganii S3 lpp Major outer membrane lipoprotein Lpp
HKOGLL_10610 HKOGLL_10610 94.9 Morganella morganii S5 lpp Major outer membrane lipoprotein Lpp
PMI_RS06815 PMI_RS06815 64.9 Proteus mirabilis HI4320 - Lpp/OprI family alanine-zipper lipoprotein

Distribution of the homologs in the orthogroup group_1096

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1096

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P02940 4.44e-47 147 94 0 78 3 lpp Major outer membrane lipoprotein Lpp Morganella morganii
Q6D622 6.85e-42 134 85 0 78 3 lpp Major outer membrane lipoprotein Lpp Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7N3U8 1.4e-40 130 82 0 78 3 lpp Major outer membrane lipoprotein Lpp Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66A25 6.74e-40 129 80 0 78 3 lpp Major outer membrane lipoprotein Lpp Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZDZ6 6.74e-40 129 80 0 78 3 lpp Major outer membrane lipoprotein Lpp Yersinia pestis
P02939 1.3e-39 128 82 0 78 3 lpp Major outer membrane lipoprotein Lpp Erwinia amylovora
Q7CQN4 7.46e-39 126 80 0 78 3 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFI1 7.46e-39 126 80 0 78 3 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella typhi
E8XH70 7.46e-39 126 80 0 78 2 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella typhimurium (strain 4/74)
Q5PH64 7.46e-39 126 80 0 78 3 lpp1 Major outer membrane lipoprotein Lpp 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P69780 6.44e-37 121 78 0 78 3 lpp Major outer membrane lipoprotein Lpp Shigella flexneri
P69776 6.44e-37 121 78 0 78 1 lpp Major outer membrane lipoprotein Lpp Escherichia coli (strain K12)
P69777 6.44e-37 121 78 0 78 3 lpp Major outer membrane lipoprotein Lpp Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69778 6.44e-37 121 78 0 78 3 lpp Major outer membrane lipoprotein Lpp Escherichia coli O157:H7
P02938 2.17e-35 117 78 1 78 3 lpp Major outer membrane lipoprotein Lpp Serratia marcescens
Q8Z6K1 1.42e-33 113 78 1 74 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella typhi
Q5PH63 2.81e-33 112 72 1 79 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PH62 9.18e-33 110 77 1 74 3 lpp3 Major outer membrane lipoprotein Lpp 3 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZPP9 1.52e-32 110 75 1 74 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E8XH69 1.52e-32 110 75 1 74 3 lpp2 Major outer membrane lipoprotein Lpp 2 Salmonella typhimurium (strain 4/74)
P09461 8.58e-18 73 62 2 78 3 lpp Major outer membrane lipoprotein Lpp Proteus mirabilis
P65299 8.53e-16 68 47 0 70 3 yqhH Uncharacterized lipoprotein YqhH Shigella flexneri
P65298 8.53e-16 68 47 0 70 3 yqhH Uncharacterized lipoprotein YqhH Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03530
Feature type CDS
Gene -
Product major outer membrane lipoprotein
Location 755114 - 755350 (strand: -1)
Length 237 (nucleotides) / 78 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1096
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04728 Lipoprotein leucine-zipper

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4238 Cell wall/membrane/envelope biogenesis (M) M Outer membrane murein-binding lipoprotein Lpp

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06078 murein lipoprotein - -

Protein Sequence

MSRSKIVLGAVILASTLLAGCSSNAKFDQLDNDVKTLNAKVDQLSNDVNAIRSDVQQAKDEAARANQRLDNQVRSYKK

Flanking regions ( +/- flanking 50bp)

AATATCATAAGTGCTACTTGGCGATTAACTTTAATCTAGAGGGTATAAAAATGAGTCGTTCTAAAATTGTTTTAGGTGCTGTAATTTTAGCTTCTACCTTATTAGCAGGTTGTTCTTCTAACGCTAAATTTGACCAACTGGACAACGACGTTAAAACGCTGAATGCCAAAGTTGATCAACTGAGCAACGACGTTAACGCAATCCGTTCTGATGTTCAGCAGGCTAAAGACGAAGCAGCACGCGCTAACCAGCGCTTAGATAACCAGGTTCGTTCTTACAAAAAATAATTTGTAACCACGAGCTTAAGAGCAGATGGCGTAACATGAAATATGTTACG