Homologs in group_274

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05700 FBDBKF_05700 81.1 Morganella morganii S1 rnt ribonuclease T
EHELCC_11890 EHELCC_11890 81.1 Morganella morganii S2 rnt ribonuclease T
NLDBIP_12230 NLDBIP_12230 81.1 Morganella morganii S4 rnt ribonuclease T
LHKJJB_12090 LHKJJB_12090 81.1 Morganella morganii S3 rnt ribonuclease T
HKOGLL_10705 HKOGLL_10705 81.1 Morganella morganii S5 rnt ribonuclease T
F4V73_RS03605 F4V73_RS03605 80.2 Morganella psychrotolerans rnt ribonuclease T
F4V73_RS17870 F4V73_RS17870 33.0 Morganella psychrotolerans - 3'-5' exonuclease

Distribution of the homologs in the orthogroup group_274

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_274

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N3W0 2.16e-131 371 83 0 211 3 rnt Ribonuclease T Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4W9U3 7.6e-129 365 80 0 210 3 rnt Ribonuclease T Enterobacter sp. (strain 638)
Q66A36 1.52e-128 363 81 0 211 3 rnt Ribonuclease T Yersinia pseudotuberculosis serotype I (strain IP32953)
A8AH33 2.96e-128 363 78 0 212 3 rnt Ribonuclease T Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1JP36 7.03e-128 362 81 0 210 3 rnt Ribonuclease T Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7FHK6 8.02e-128 362 80 0 210 3 rnt Ribonuclease T Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D5W0 8.64e-128 362 81 0 209 3 rnt Ribonuclease T Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8ZE08 1.04e-127 361 80 0 210 3 rnt Ribonuclease T Yersinia pestis
Q57PK2 2.04e-127 360 78 0 212 3 rnt Ribonuclease T Salmonella choleraesuis (strain SC-B67)
P66684 3.81e-127 360 78 0 212 3 rnt Ribonuclease T Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66685 3.81e-127 360 78 0 212 3 rnt Ribonuclease T Salmonella typhi
Q5PH07 3.81e-127 360 78 0 212 3 rnt Ribonuclease T Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7MFC6 6.93e-125 355 78 0 210 3 rnt Ribonuclease T Cronobacter sakazakii (strain ATCC BAA-894)
Q3Z208 7.34e-124 352 78 0 210 3 rnt Ribonuclease T Shigella sonnei (strain Ss046)
P66683 7.34e-124 352 78 0 210 3 rnt Ribonuclease T Shigella flexneri
Q32FB8 7.34e-124 352 78 0 210 3 rnt Ribonuclease T Shigella dysenteriae serotype 1 (strain Sd197)
Q1RBE3 7.34e-124 352 78 0 210 3 rnt Ribonuclease T Escherichia coli (strain UTI89 / UPEC)
P66681 7.34e-124 352 78 0 210 3 rnt Ribonuclease T Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THH6 7.34e-124 352 78 0 210 3 rnt Ribonuclease T Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABJ5 7.34e-124 352 78 0 210 3 rnt Ribonuclease T Escherichia coli O1:K1 / APEC
A8A0J6 7.34e-124 352 78 0 210 3 rnt Ribonuclease T Escherichia coli O9:H4 (strain HS)
P66682 7.34e-124 352 78 0 210 3 rnt Ribonuclease T Escherichia coli O157:H7
A7ZMB5 7.34e-124 352 78 0 210 3 rnt Ribonuclease T Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TA01 7.93e-124 352 76 0 211 3 rnt Ribonuclease T Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q321A7 4.34e-123 350 77 0 210 3 rnt Ribonuclease T Shigella boydii serotype 4 (strain Sb227)
P30014 5.46e-123 349 77 0 209 1 rnt Ribonuclease T Escherichia coli (strain K12)
Q0T4C2 2.59e-122 348 77 0 210 3 rnt Ribonuclease T Shigella flexneri serotype 5b (strain 8401)
Q6LP25 5.29e-111 320 72 1 210 3 rnt Ribonuclease T Photobacterium profundum (strain SS9)
Q9KT97 8.12e-106 306 70 1 210 3 rnt Ribonuclease T Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8EDJ2 1.61e-105 305 68 0 209 3 rnt Ribonuclease T Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0KY98 3.29e-105 305 68 0 209 3 rnt Ribonuclease T Shewanella sp. (strain ANA-3)
A3D3D5 3.63e-105 305 68 0 209 3 rnt Ribonuclease T Shewanella baltica (strain OS155 / ATCC BAA-1091)
A6WM39 3.8e-105 305 68 0 209 3 rnt Ribonuclease T Shewanella baltica (strain OS185)
Q12PE3 1.48e-104 303 68 0 212 3 rnt Ribonuclease T Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0HTX3 1.57e-104 303 68 0 209 3 rnt Ribonuclease T Shewanella sp. (strain MR-7)
Q0HHM1 1.57e-104 303 68 0 209 3 rnt Ribonuclease T Shewanella sp. (strain MR-4)
Q1LU01 5.28e-104 301 68 0 207 3 rnt Ribonuclease T Baumannia cicadellinicola subsp. Homalodisca coagulata
A5UAG1 1.25e-103 301 67 0 201 3 rnt Ribonuclease T Haemophilus influenzae (strain PittEE)
Q4QNL5 2.28e-103 300 68 0 201 3 rnt Ribonuclease T Haemophilus influenzae (strain 86-028NP)
A5UGD7 4.11e-103 300 68 0 201 3 rnt Ribonuclease T Haemophilus influenzae (strain PittGG)
P44639 4.44e-103 300 68 0 201 3 rnt Ribonuclease T Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4Y5U2 1.38e-100 293 69 0 209 3 rnt Ribonuclease T Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RKQ1 1.85e-100 293 69 0 209 3 rnt Ribonuclease T Shewanella sp. (strain W3-18-1)
P46232 6.17e-100 291 68 1 201 3 rnt Ribonuclease T Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MM91 1.55e-98 288 68 1 201 3 rnt Ribonuclease T Vibrio vulnificus (strain YJ016)
P57285 2.09e-98 288 64 0 202 3 rnt Ribonuclease T Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A7MUL2 2.34e-98 287 68 1 201 3 rnt Ribonuclease T Vibrio campbellii (strain ATCC BAA-1116)
Q0I251 5.12e-98 286 64 0 204 3 rnt Ribonuclease T Histophilus somni (strain 129Pt)
Q8D882 6.65e-98 286 68 1 201 3 rnt Ribonuclease T Vibrio vulnificus (strain CMCP6)
P57896 8.13e-98 286 65 0 206 3 rnt Ribonuclease T Pasteurella multocida (strain Pm70)
Q084K7 3.34e-97 285 66 0 209 3 rnt Ribonuclease T Shewanella frigidimarina (strain NCIMB 400)
Q057V1 3.59e-96 282 65 0 197 3 rnt Ribonuclease T Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q7VR55 3.04e-95 280 65 1 209 3 rnt Ribonuclease T Blochmanniella floridana
A3MYQ4 1.76e-94 277 63 0 202 3 rnt Ribonuclease T Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q492U0 4e-94 276 62 1 210 3 rnt Ribonuclease T Blochmanniella pennsylvanica (strain BPEN)
Q8D2L9 1.13e-93 275 60 0 203 3 rnt Ribonuclease T Wigglesworthia glossinidia brevipalpis
Q7VND8 2.49e-92 272 61 0 205 3 rnt Ribonuclease T Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8K9V5 9.27e-91 268 60 0 202 3 rnt Ribonuclease T Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P59497 2.79e-90 267 59 1 206 3 rnt Ribonuclease T Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q1QVM9 3.49e-90 266 62 1 211 3 rnt Ribonuclease T Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2SCE2 3.7e-89 264 60 0 198 3 rnt Ribonuclease T Hahella chejuensis (strain KCTC 2396)
O54364 1.09e-88 263 61 1 207 3 rnt Ribonuclease T Mannheimia haemolytica
A1U3L2 1.75e-88 262 60 0 205 3 rnt Ribonuclease T Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6V1R8 2.05e-88 262 61 0 198 3 rnt Ribonuclease T Pseudomonas aeruginosa (strain PA7)
Q9HY82 6.89e-88 261 61 0 198 1 rnt Ribonuclease T Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QZ9 6.89e-88 261 61 0 198 3 rnt Ribonuclease T Pseudomonas aeruginosa (strain UCBPP-PA14)
Q4ZPJ7 9.88e-88 261 61 0 198 3 rnt Ribonuclease T Pseudomonas syringae pv. syringae (strain B728a)
Q48F11 1.22e-87 260 61 0 198 3 rnt Ribonuclease T Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3K7J7 2.34e-87 259 62 0 198 3 rnt Ribonuclease T Pseudomonas fluorescens (strain Pf0-1)
Q88NW8 1e-86 257 61 0 198 3 rnt Ribonuclease T Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VZH7 1.46e-86 258 61 0 198 3 rnt Ribonuclease T Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IE06 1.73e-86 257 60 0 198 3 rnt Ribonuclease T Pseudomonas entomophila (strain L48)
Q87XM0 1.91e-86 257 61 0 198 3 rnt Ribonuclease T Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4K746 1.21e-85 255 61 0 198 3 rnt Ribonuclease T Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8PAG3 3.68e-61 193 48 0 192 3 rnt Ribonuclease T Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UT60 3.68e-61 193 48 0 192 3 rnt Ribonuclease T Xanthomonas campestris pv. campestris (strain 8004)
Q9PBJ8 6.09e-60 189 48 0 192 3 rnt Ribonuclease T Xylella fastidiosa (strain 9a5c)
Q3BV71 8.89e-60 189 47 0 192 3 rnt Ribonuclease T Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q87C86 1.06e-59 189 48 0 192 3 rnt Ribonuclease T Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8PM62 3.91e-59 187 47 0 192 3 rnt Ribonuclease T Xanthomonas axonopodis pv. citri (strain 306)
Q9Z5X0 3.52e-45 149 58 0 112 3 rnt Ribonuclease T (Fragment) Azotobacter vinelandii
Q4L5W6 2.42e-08 57 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus haemolyticus (strain JCSC1435)
Q5HPS7 1.42e-07 54 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CPG6 1.47e-07 54 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P0C1P9 3.25e-07 53 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus
P63982 3.4e-07 53 28 7 194 1 polC DNA polymerase III PolC-type Staphylococcus aureus (strain N315)
P63981 3.4e-07 53 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X1P4 3.4e-07 53 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6G9U9 3.44e-07 53 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain MSSA476)
A6QGG4 3.44e-07 53 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain Newman)
Q5HGG7 3.44e-07 53 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain COL)
P68852 3.47e-07 53 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain MW2)
Q2G1Z8 3.47e-07 53 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHH4 3.47e-07 53 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain USA300)
Q6GHH1 3.6e-07 53 28 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain MRSA252)
Q1WUF9 4.34e-07 53 27 10 196 3 polC DNA polymerase III PolC-type Ligilactobacillus salivarius (strain UCC118)
Q2YXK4 1.48e-06 51 27 7 194 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q819Y5 1.63e-06 51 26 3 180 3 polC DNA polymerase III PolC-type Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8EQU6 1.31e-05 48 29 6 186 3 polC DNA polymerase III PolC-type Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q03QS9 1.92e-05 48 30 10 178 3 polC DNA polymerase III PolC-type Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q8RA32 2.53e-05 48 27 7 188 3 polC DNA polymerase III PolC-type Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9KA72 4.21e-05 47 30 8 184 3 polC DNA polymerase III PolC-type Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q49X49 5.21e-05 47 24 3 186 3 polC DNA polymerase III PolC-type Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q92C34 7.33e-05 46 31 4 121 3 polC DNA polymerase III PolC-type Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AIC1 0.000243 45 25 6 191 3 polC DNA polymerase III PolC-type Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q038M0 0.000271 45 31 5 119 3 polC DNA polymerase III PolC-type Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8Y7G1 0.000306 44 30 4 121 3 polC DNA polymerase III PolC-type Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q720A2 0.000306 44 30 4 121 3 polC DNA polymerase III PolC-type Listeria monocytogenes serotype 4b (strain F2365)
P47277 0.000643 43 25 10 198 3 polC DNA polymerase III PolC-type Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47729 0.000786 43 23 4 188 3 polC DNA polymerase III PolC-type Mycoplasmopsis pulmonis (strain UAB CTIP)
A4VXT1 0.000879 43 30 5 124 3 polC DNA polymerase III PolC-type Streptococcus suis (strain 05ZYH33)
A4W428 0.000879 43 30 5 124 3 polC DNA polymerase III PolC-type Streptococcus suis (strain 98HAH33)
Q8XJR3 0.001 43 31 4 110 3 polC DNA polymerase III PolC-type Clostridium perfringens (strain 13 / Type A)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06730
Feature type CDS
Gene rnt
Product ribonuclease T
Location 1470217 - 1470855 (strand: 1)
Length 639 (nucleotides) / 212 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_274
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00929 Exonuclease

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0847 Replication, recombination and repair (L) L DNA polymerase III, epsilon subunit or related 3'-5' exonuclease

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03683 ribonuclease T [EC:3.1.13.-] - -

Protein Sequence

MPDKINPNELCNRFRGYYPVVIDVETGGFNAKTDGLLEIAAITLKMDEQGWLKPDNTLHFHVDPFEGANLEPAALEFTGIDPTNPLRGAVSEYEALHAIFKMVRKGMKDANCNRAIIVAHNANFDHSFVMAAAERAGLKRNPFHPFATFDTAALSGLVLGQTILAKACITAGIPFDSKLAHGALYDTNRTSLLFCELVNRWKKLGGWPLPTP

Flanking regions ( +/- flanking 50bp)

GATTATTATTAATTTCTGATGTGCTATTTTCATCGGATAAGTACAGTTTAATGCCTGATAAAATAAACCCTAATGAATTATGTAACCGCTTTCGAGGTTACTATCCAGTCGTTATTGATGTTGAAACGGGTGGATTTAATGCCAAAACAGATGGCTTACTTGAAATTGCTGCTATCACTTTAAAAATGGATGAGCAAGGTTGGTTAAAACCTGATAATACATTGCATTTTCATGTCGACCCCTTTGAGGGCGCAAATTTAGAGCCAGCGGCGTTAGAATTTACCGGAATTGATCCTACAAATCCTCTTCGTGGTGCTGTCAGCGAATATGAAGCGTTACACGCCATTTTTAAAATGGTACGTAAAGGAATGAAAGACGCCAACTGTAACCGTGCGATCATTGTGGCTCATAATGCTAATTTTGATCATAGCTTTGTTATGGCGGCAGCTGAGCGAGCAGGTTTAAAGCGTAACCCTTTCCACCCTTTTGCTACTTTTGATACTGCGGCTTTAAGTGGTTTAGTACTAGGACAAACTATTTTAGCGAAAGCCTGTATTACTGCAGGTATCCCCTTTGATAGTAAACTCGCTCATGGGGCTTTATACGATACCAATCGTACATCATTACTGTTTTGTGAATTAGTTAACCGCTGGAAAAAATTAGGTGGTTGGCCACTACCAACGCCCTAATCAAACTTATGTGTTTGGCTGTGCCATATTAAGCGACAAAAAAGAAGCCA