Homologs in group_1088

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05700 FBDBKF_05700 91.5 Morganella morganii S1 rnt ribonuclease T
EHELCC_11890 EHELCC_11890 91.5 Morganella morganii S2 rnt ribonuclease T
NLDBIP_12230 NLDBIP_12230 91.5 Morganella morganii S4 rnt ribonuclease T
LHKJJB_12090 LHKJJB_12090 91.5 Morganella morganii S3 rnt ribonuclease T
HKOGLL_10705 HKOGLL_10705 91.5 Morganella morganii S5 rnt ribonuclease T
PMI_RS06730 PMI_RS06730 80.2 Proteus mirabilis HI4320 rnt ribonuclease T

Distribution of the homologs in the orthogroup group_1088

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1088

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A6TA01 6.48e-122 347 76 0 210 3 rnt Ribonuclease T Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q7N3W0 2.73e-119 340 74 0 213 3 rnt Ribonuclease T Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D5W0 1.76e-118 338 73 0 209 3 rnt Ribonuclease T Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3Z208 6.31e-117 334 73 0 211 3 rnt Ribonuclease T Shigella sonnei (strain Ss046)
P66683 6.31e-117 334 73 0 211 3 rnt Ribonuclease T Shigella flexneri
Q32FB8 6.31e-117 334 73 0 211 3 rnt Ribonuclease T Shigella dysenteriae serotype 1 (strain Sd197)
Q1RBE3 6.31e-117 334 73 0 211 3 rnt Ribonuclease T Escherichia coli (strain UTI89 / UPEC)
P66681 6.31e-117 334 73 0 211 3 rnt Ribonuclease T Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THH6 6.31e-117 334 73 0 211 3 rnt Ribonuclease T Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABJ5 6.31e-117 334 73 0 211 3 rnt Ribonuclease T Escherichia coli O1:K1 / APEC
A8A0J6 6.31e-117 334 73 0 211 3 rnt Ribonuclease T Escherichia coli O9:H4 (strain HS)
P66682 6.31e-117 334 73 0 211 3 rnt Ribonuclease T Escherichia coli O157:H7
A7ZMB5 6.31e-117 334 73 0 211 3 rnt Ribonuclease T Escherichia coli O139:H28 (strain E24377A / ETEC)
Q321A7 6.66e-117 334 73 0 211 3 rnt Ribonuclease T Shigella boydii serotype 4 (strain Sb227)
A7MFC6 2.14e-116 333 73 0 210 3 rnt Ribonuclease T Cronobacter sakazakii (strain ATCC BAA-894)
A8AH33 5.71e-116 332 72 0 210 3 rnt Ribonuclease T Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P30014 5.9e-116 332 73 0 211 1 rnt Ribonuclease T Escherichia coli (strain K12)
A7FHK6 9.88e-116 331 72 0 211 3 rnt Ribonuclease T Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JP36 1.02e-115 331 72 0 211 3 rnt Ribonuclease T Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZE08 1.23e-115 331 72 0 211 3 rnt Ribonuclease T Yersinia pestis
P66684 1.23e-115 331 72 0 210 3 rnt Ribonuclease T Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66685 1.23e-115 331 72 0 210 3 rnt Ribonuclease T Salmonella typhi
Q5PH07 1.23e-115 331 72 0 210 3 rnt Ribonuclease T Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q0T4C2 1.6e-115 331 73 0 211 3 rnt Ribonuclease T Shigella flexneri serotype 5b (strain 8401)
Q57PK2 1.65e-115 330 72 0 210 3 rnt Ribonuclease T Salmonella choleraesuis (strain SC-B67)
Q66A36 3.16e-115 330 71 0 210 3 rnt Ribonuclease T Yersinia pseudotuberculosis serotype I (strain IP32953)
A4W9U3 7.98e-115 329 73 0 210 3 rnt Ribonuclease T Enterobacter sp. (strain 638)
A0KY98 1.69e-104 303 67 0 211 3 rnt Ribonuclease T Shewanella sp. (strain ANA-3)
Q6LP25 2.74e-104 303 68 1 210 3 rnt Ribonuclease T Photobacterium profundum (strain SS9)
Q0HTX3 8.19e-104 301 67 0 211 3 rnt Ribonuclease T Shewanella sp. (strain MR-7)
Q0HHM1 8.19e-104 301 67 0 211 3 rnt Ribonuclease T Shewanella sp. (strain MR-4)
Q8EDJ2 1.97e-103 300 67 0 211 3 rnt Ribonuclease T Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A6WM39 8.24e-102 296 65 0 211 3 rnt Ribonuclease T Shewanella baltica (strain OS185)
A3D3D5 8.61e-102 296 65 0 211 3 rnt Ribonuclease T Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q9KT97 6.95e-100 291 66 1 210 3 rnt Ribonuclease T Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1LU01 1.46e-98 288 63 0 207 3 rnt Ribonuclease T Baumannia cicadellinicola subsp. Homalodisca coagulata
A5UAG1 1.17e-97 286 61 1 211 3 rnt Ribonuclease T Haemophilus influenzae (strain PittEE)
Q4QNL5 1.4e-97 286 62 1 211 3 rnt Ribonuclease T Haemophilus influenzae (strain 86-028NP)
A4Y5U2 1.57e-97 285 66 0 213 3 rnt Ribonuclease T Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RKQ1 2.15e-97 285 66 0 211 3 rnt Ribonuclease T Shewanella sp. (strain W3-18-1)
P44639 2.88e-97 285 62 1 211 3 rnt Ribonuclease T Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q12PE3 5.71e-97 284 64 0 209 3 rnt Ribonuclease T Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A5UGD7 1.17e-96 283 61 1 211 3 rnt Ribonuclease T Haemophilus influenzae (strain PittGG)
Q084K7 3.64e-95 279 64 0 211 3 rnt Ribonuclease T Shewanella frigidimarina (strain NCIMB 400)
Q7MM91 1.71e-94 278 64 1 205 3 rnt Ribonuclease T Vibrio vulnificus (strain YJ016)
P46232 8.07e-94 276 63 1 202 3 rnt Ribonuclease T Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D882 9.76e-94 276 63 1 205 3 rnt Ribonuclease T Vibrio vulnificus (strain CMCP6)
A7MUL2 2.94e-93 274 64 1 202 3 rnt Ribonuclease T Vibrio campbellii (strain ATCC BAA-1116)
Q0I251 3.22e-93 274 60 0 203 3 rnt Ribonuclease T Histophilus somni (strain 129Pt)
A3MYQ4 9.06e-92 271 60 0 208 3 rnt Ribonuclease T Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q492U0 1.8e-91 270 59 1 210 3 rnt Ribonuclease T Blochmanniella pennsylvanica (strain BPEN)
P57896 2.13e-91 270 61 0 203 3 rnt Ribonuclease T Pasteurella multocida (strain Pm70)
P57285 1.38e-90 268 58 0 209 3 rnt Ribonuclease T Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q2SCE2 1.75e-89 265 58 1 209 3 rnt Ribonuclease T Hahella chejuensis (strain KCTC 2396)
Q7VR55 1.77e-89 265 61 1 209 3 rnt Ribonuclease T Blochmanniella floridana
A1U3L2 4.74e-89 264 58 1 211 3 rnt Ribonuclease T Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q057V1 1.27e-88 263 59 0 199 3 rnt Ribonuclease T Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q7VND8 3.41e-88 261 59 0 204 3 rnt Ribonuclease T Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A6V1R8 3.96e-88 261 61 0 195 3 rnt Ribonuclease T Pseudomonas aeruginosa (strain PA7)
Q8D2L9 8.38e-88 260 57 0 205 3 rnt Ribonuclease T Wigglesworthia glossinidia brevipalpis
Q9HY82 9.2e-88 261 61 0 195 1 rnt Ribonuclease T Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QZ9 9.2e-88 261 61 0 195 3 rnt Ribonuclease T Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1QVM9 1.18e-87 260 59 1 211 3 rnt Ribonuclease T Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q4ZPJ7 1.07e-86 258 60 0 198 3 rnt Ribonuclease T Pseudomonas syringae pv. syringae (strain B728a)
P59497 1.13e-86 258 55 0 208 3 rnt Ribonuclease T Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q48F11 1.31e-86 258 60 0 198 3 rnt Ribonuclease T Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3K7J7 4.51e-86 256 60 0 198 3 rnt Ribonuclease T Pseudomonas fluorescens (strain Pf0-1)
Q87XM0 2.02e-85 255 59 0 198 3 rnt Ribonuclease T Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8K9V5 3.33e-85 254 56 0 209 3 rnt Ribonuclease T Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q88NW8 7.65e-85 253 60 0 195 3 rnt Ribonuclease T Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q4K746 8.54e-85 253 59 0 198 3 rnt Ribonuclease T Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A5VZH7 1.28e-84 253 60 0 195 3 rnt Ribonuclease T Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IE06 2.05e-84 252 59 0 195 3 rnt Ribonuclease T Pseudomonas entomophila (strain L48)
O54364 1.36e-81 245 56 1 212 3 rnt Ribonuclease T Mannheimia haemolytica
Q9PBJ8 2.03e-62 196 49 0 196 3 rnt Ribonuclease T Xylella fastidiosa (strain 9a5c)
Q87C86 2.87e-62 196 49 0 196 3 rnt Ribonuclease T Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8PAG3 3.59e-62 196 48 1 204 3 rnt Ribonuclease T Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UT60 3.59e-62 196 48 1 204 3 rnt Ribonuclease T Xanthomonas campestris pv. campestris (strain 8004)
Q3BV71 1.83e-61 194 48 0 192 3 rnt Ribonuclease T Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PM62 9.42e-60 189 47 0 192 3 rnt Ribonuclease T Xanthomonas axonopodis pv. citri (strain 306)
Q9Z5X0 2.38e-49 159 62 0 112 3 rnt Ribonuclease T (Fragment) Azotobacter vinelandii
Q5HPS7 3.37e-09 59 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L5W6 4.11e-09 59 29 7 193 3 polC DNA polymerase III PolC-type Staphylococcus haemolyticus (strain JCSC1435)
P68852 5.4e-09 58 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain MW2)
Q2G1Z8 5.4e-09 58 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHH4 5.4e-09 58 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain USA300)
Q6GHH1 5.4e-09 58 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain MRSA252)
P63982 5.5e-09 58 28 6 193 1 polC DNA polymerase III PolC-type Staphylococcus aureus (strain N315)
P63981 5.5e-09 58 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X1P4 5.5e-09 58 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain Mu3 / ATCC 700698)
P0C1P9 5.55e-09 58 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus
Q6G9U9 5.55e-09 58 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain MSSA476)
A6QGG4 5.55e-09 58 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain Newman)
Q5HGG7 5.55e-09 58 28 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain COL)
Q8CPG6 9.48e-09 58 29 7 193 3 polC DNA polymerase III PolC-type Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q2YXK4 2.42e-08 57 27 6 193 3 polC DNA polymerase III PolC-type Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q1WUF9 6.9e-08 55 28 9 194 3 polC DNA polymerase III PolC-type Ligilactobacillus salivarius (strain UCC118)
Q03FS8 1.07e-06 52 31 11 193 3 polC DNA polymerase III PolC-type Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q819Y5 2.92e-06 50 28 7 179 3 polC DNA polymerase III PolC-type Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q92C34 3.42e-06 50 33 5 121 3 polC DNA polymerase III PolC-type Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q49X49 5.44e-06 50 25 5 186 3 polC DNA polymerase III PolC-type Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A0AIC1 5.44e-06 50 26 7 191 3 polC DNA polymerase III PolC-type Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q4L6F9 8.71e-06 49 26 7 188 3 dinG 3'-5' exonuclease DinG Staphylococcus haemolyticus (strain JCSC1435)
Q720A2 1.34e-05 48 32 5 121 3 polC DNA polymerase III PolC-type Listeria monocytogenes serotype 4b (strain F2365)
Q8Y7G1 1.4e-05 48 32 5 121 3 polC DNA polymerase III PolC-type Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9KA72 1.56e-05 48 31 9 183 3 polC DNA polymerase III PolC-type Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q03QS9 1.86e-05 48 31 5 133 3 polC DNA polymerase III PolC-type Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A5VJD5 3.22e-05 47 28 10 200 3 polC DNA polymerase III PolC-type Limosilactobacillus reuteri (strain DSM 20016)
Q8EQU6 8.31e-05 46 27 6 181 3 polC DNA polymerase III PolC-type Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q895K2 9.03e-05 46 27 5 146 3 polC DNA polymerase III PolC-type Clostridium tetani (strain Massachusetts / E88)
Q8RA32 0.000342 44 26 8 196 3 polC DNA polymerase III PolC-type Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P47729 0.000595 43 24 5 186 3 polC DNA polymerase III PolC-type Mycoplasmopsis pulmonis (strain UAB CTIP)
Q038M0 0.000658 43 33 5 120 3 polC DNA polymerase III PolC-type Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A4VXT1 0.000876 43 26 2 119 3 polC DNA polymerase III PolC-type Streptococcus suis (strain 05ZYH33)
A4W428 0.000876 43 26 2 119 3 polC DNA polymerase III PolC-type Streptococcus suis (strain 98HAH33)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03605
Feature type CDS
Gene rnt
Product ribonuclease T
Location 767819 - 768460 (strand: -1)
Length 642 (nucleotides) / 213 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1088
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00929 Exonuclease

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0847 Replication, recombination and repair (L) L DNA polymerase III, epsilon subunit or related 3'-5' exonuclease

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03683 ribonuclease T [EC:3.1.13.-] - -

Protein Sequence

MSDNQNHNTLNARFRGYYPVVIDVETGGFNAKTDAMLEIAAITVKMDDNGWLMPDQRLEFNVQPFEGANLDPAALAFTGINPADPERKAVREYDALHEIFKMVRKGMKNADCKRAIIVAHNANFDHNFVTTAAERCGLKRNPFHPFATFDTAALSGLALGQTILAKACITAGIPFDSKKAHGAAYDTDRTSLLFCEIVNRWKKLGGWPLPADA

Flanking regions ( +/- flanking 50bp)

GCTCGCCGCGCTAGAATGATGCGTTTTGTTCGTTACAACCAAAGAGTCCCATGTCTGATAATCAAAATCACAATACCCTGAACGCACGTTTCCGCGGATACTATCCTGTTGTTATTGATGTTGAAACAGGCGGATTTAATGCCAAAACTGATGCTATGCTGGAAATTGCCGCCATCACCGTTAAAATGGATGATAATGGCTGGCTGATGCCCGATCAGCGGCTTGAGTTCAATGTACAGCCTTTCGAGGGCGCGAATCTTGATCCTGCTGCGCTGGCCTTTACCGGGATAAACCCTGCCGACCCGGAACGCAAAGCAGTCCGCGAGTATGATGCCTTACATGAAATTTTTAAAATGGTGCGTAAAGGCATGAAAAATGCTGACTGCAAGCGCGCGATTATCGTGGCACACAATGCGAACTTTGATCACAATTTTGTGACGACAGCCGCAGAGCGCTGCGGTCTGAAACGTAATCCGTTTCATCCGTTTGCCACCTTTGATACCGCTGCATTAAGCGGACTGGCTCTCGGGCAGACCATTCTGGCAAAAGCCTGTATTACCGCCGGTATTCCATTTGACAGCAAAAAAGCCCATGGCGCGGCGTATGATACAGACCGCACATCCCTGCTGTTTTGTGAAATTGTTAATCGCTGGAAGAAACTGGGCGGCTGGCCGCTGCCCGCAGACGCATAAGTGATTTAAAACATCCCCGCCACCTTACGGGTGCCGGGGATGTTTGTTTT