Homologs in group_934

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05075 FBDBKF_05075 65.2 Morganella morganii S1 pyrF orotidine-5'-phosphate decarboxylase
EHELCC_12515 EHELCC_12515 65.2 Morganella morganii S2 pyrF orotidine-5'-phosphate decarboxylase
NLDBIP_12855 NLDBIP_12855 65.2 Morganella morganii S4 pyrF orotidine-5'-phosphate decarboxylase
LHKJJB_12715 LHKJJB_12715 65.2 Morganella morganii S3 pyrF orotidine-5'-phosphate decarboxylase
HKOGLL_11330 HKOGLL_11330 65.2 Morganella morganii S5 pyrF orotidine-5'-phosphate decarboxylase
F4V73_RS05530 F4V73_RS05530 66.7 Morganella psychrotolerans pyrF orotidine-5'-phosphate decarboxylase

Distribution of the homologs in the orthogroup group_934

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_934

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EW04 0.0 511 100 0 248 3 pyrF Orotidine 5'-phosphate decarboxylase Proteus mirabilis (strain HI4320)
Q7N4C1 1.7e-119 343 72 0 231 3 pyrF Orotidine 5'-phosphate decarboxylase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1LH07 5.1e-119 342 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain SMS-3-5 / SECEC)
B7N497 5.1e-119 342 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NVQ5 5.1e-119 342 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P58640 5.1e-119 342 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O157:H7
Q3Z131 1.84e-118 341 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella sonnei (strain Ss046)
B6I9Z7 1.84e-118 341 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain SE11)
B1ITH3 1.84e-118 341 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZM0 1.84e-118 341 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O9:H4 (strain HS)
B7LY40 1.84e-118 341 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O8 (strain IAI1)
B7L4B7 1.84e-118 341 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain 55989 / EAEC)
Q31ZX5 2.88e-118 340 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella boydii serotype 4 (strain Sb227)
A7ZLA2 2.88e-118 340 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O139:H28 (strain E24377A / ETEC)
P08244 3.28e-118 340 69 0 242 1 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain K12)
B1XBN2 3.28e-118 340 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain K12 / DH10B)
C4ZTX6 3.28e-118 340 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain K12 / MC4100 / BW2952)
Q1RC84 5.31e-118 340 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain UTI89 / UPEC)
B7MLV7 5.31e-118 340 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0T5B6 5.55e-118 340 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella flexneri serotype 5b (strain 8401)
B7LRZ7 6.33e-118 339 70 1 236 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2U0H4 1.39e-117 338 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q32GQ2 2.57e-117 338 68 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella dysenteriae serotype 1 (strain Sd197)
Q83RM1 6.38e-117 337 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella flexneri
C6DK13 9.56e-116 334 73 0 230 3 pyrF Orotidine 5'-phosphate decarboxylase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1SYZ6 5.43e-115 332 69 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A4WAY2 1.35e-114 331 70 0 232 3 pyrF Orotidine 5'-phosphate decarboxylase Enterobacter sp. (strain 638)
Q6D5T3 1.8e-114 331 72 0 230 3 pyrF Orotidine 5'-phosphate decarboxylase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JM26 4.26e-114 330 70 0 230 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JKQ0 5.07e-114 330 66 0 244 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66AI1 9.05e-114 329 68 0 233 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K4I4 9.05e-114 329 68 0 233 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FI10 9.05e-114 329 68 0 233 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TJ45 2.22e-113 328 65 0 244 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pestis (strain Pestoides F)
Q1CJ05 2.22e-113 328 65 0 244 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8T1 2.22e-113 328 65 0 244 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pestis bv. Antiqua (strain Angola)
P58644 2.22e-113 328 65 0 244 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pestis
Q1C7L9 2.22e-113 328 65 0 244 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pestis bv. Antiqua (strain Antiqua)
Q0TI84 5.36e-112 324 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FHU2 8.22e-112 324 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MUC3 8.22e-112 324 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O81 (strain ED1a)
B7UR89 4.24e-111 322 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5BID8 6.22e-111 322 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella paratyphi A (strain AKU_12601)
Q5PD06 6.22e-111 322 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5F565 6.22e-111 322 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella agona (strain SL483)
B4T6V0 6.57e-111 322 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella newport (strain SL254)
B5XS09 9.54e-111 321 69 0 233 3 pyrF Orotidine 5'-phosphate decarboxylase Klebsiella pneumoniae (strain 342)
B5R6P3 3.36e-110 320 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R486 3.36e-110 320 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella enteritidis PT4 (strain P125109)
Q57NV3 3.58e-110 320 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella choleraesuis (strain SC-B67)
P07691 2.57e-109 318 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P58643 7.51e-109 317 69 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella typhi
B5FG54 7.8e-107 311 63 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Aliivibrio fischeri (strain MJ11)
Q5E3Z6 7.8e-107 311 63 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EIY4 2.37e-105 307 63 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Aliivibrio salmonicida (strain LFI1238)
A7MUN7 5.47e-104 303 64 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio campbellii (strain ATCC BAA-1116)
Q7VLR5 6.63e-104 303 64 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87N49 6.88e-104 303 64 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0BP16 3.2e-103 301 63 0 226 3 pyrF Orotidine 5'-phosphate decarboxylase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXH2 3.2e-103 301 63 0 226 3 pyrF Orotidine 5'-phosphate decarboxylase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0A0 3.2e-103 301 63 0 226 3 pyrF Orotidine 5'-phosphate decarboxylase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A5UBN7 3.38e-103 301 64 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Haemophilus influenzae (strain PittEE)
Q7MLX2 6.61e-103 301 63 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio vulnificus (strain YJ016)
Q2NT36 7.49e-103 301 65 0 233 3 pyrF Orotidine 5'-phosphate decarboxylase Sodalis glossinidius (strain morsitans)
A5F6Y1 8.31e-103 300 64 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8D8J6 1.27e-102 300 63 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio vulnificus (strain CMCP6)
A6VPK5 1.87e-102 300 62 0 228 3 pyrF Orotidine 5'-phosphate decarboxylase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q4QJV1 2.22e-102 300 64 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Haemophilus influenzae (strain 86-028NP)
P43812 2.98e-102 299 64 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B7VH29 2.99e-102 299 61 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio atlanticus (strain LGP32)
C3LNL5 3.72e-102 299 64 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio cholerae serotype O1 (strain M66-2)
Q9KQT7 3.72e-102 299 64 0 225 1 pyrF Orotidine 5'-phosphate decarboxylase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B8F472 6.63e-102 298 63 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Glaesserella parasuis serovar 5 (strain SH0165)
Q65SI1 6.96e-102 298 62 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q15T09 2.55e-101 297 62 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q9CMM1 2.28e-100 295 63 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Pasteurella multocida (strain Pm70)
Q3IGA7 5.18e-100 293 62 0 233 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudoalteromonas translucida (strain TAC 125)
Q6LPE7 6.42e-100 293 62 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Photobacterium profundum (strain SS9)
C4LEZ7 5.69e-98 288 60 1 226 3 pyrF Orotidine 5'-phosphate decarboxylase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q482F9 2.07e-97 287 65 0 226 3 pyrF Orotidine 5'-phosphate decarboxylase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q8EEI4 1.26e-96 285 61 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7NTL2 2.84e-95 282 61 1 231 3 pyrF Orotidine 5'-phosphate decarboxylase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1LTG7 6.25e-95 281 59 0 232 3 pyrF Orotidine 5'-phosphate decarboxylase Baumannia cicadellinicola subsp. Homalodisca coagulata
C5BSJ7 2.07e-94 279 61 1 232 3 pyrF Orotidine 5'-phosphate decarboxylase Teredinibacter turnerae (strain ATCC 39867 / T7901)
A6W097 2.33e-93 277 57 0 224 3 pyrF Orotidine 5'-phosphate decarboxylase Marinomonas sp. (strain MWYL1)
A8FVN0 7.76e-92 273 60 0 226 3 pyrF Orotidine 5'-phosphate decarboxylase Shewanella sediminis (strain HAW-EB3)
A1TZF4 7.16e-90 268 59 0 228 3 pyrF Orotidine 5'-phosphate decarboxylase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A3M508 7.7e-90 268 56 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HZE8 7.7e-90 268 56 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain ACICU)
Q5WWS3 8.57e-90 268 55 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Legionella pneumophila (strain Lens)
A5IBR7 9.56e-90 267 55 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Legionella pneumophila (strain Corby)
Q5X5E0 1.16e-89 267 56 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Legionella pneumophila (strain Paris)
B7I534 1.83e-89 267 56 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain AB0057)
B0VD17 2.52e-89 266 56 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain AYE)
B7H3K6 2.52e-89 266 56 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain AB307-0294)
Q2SCG0 3.09e-89 266 56 1 228 3 pyrF Orotidine 5'-phosphate decarboxylase Hahella chejuensis (strain KCTC 2396)
B0VN04 3.91e-89 266 56 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain SDF)
Q5ZVL5 4.05e-89 266 55 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q3J8N5 1.93e-88 264 55 1 228 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q31GC7 2.41e-88 264 56 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0VNQ9 1.63e-87 262 62 1 230 3 pyrF Orotidine 5'-phosphate decarboxylase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q21IS8 2.58e-87 261 58 1 221 3 pyrF Orotidine 5'-phosphate decarboxylase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q6F9Z3 5.28e-87 260 57 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0AIZ1 3.14e-86 258 56 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
C1D549 1.87e-85 257 57 3 232 3 pyrF Orotidine 5'-phosphate decarboxylase Laribacter hongkongensis (strain HLHK9)
Q2Y7B1 6.76e-85 255 55 1 228 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q82TD8 7.52e-85 255 58 2 229 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5QZ42 1.73e-83 251 56 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9M3Q3 8.8e-83 250 56 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria meningitidis serogroup C (strain 053442)
Q1QVK2 2.2e-82 249 55 1 226 3 pyrF Orotidine 5'-phosphate decarboxylase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B8D963 8.51e-82 248 51 1 226 3 pyrF Orotidine 5'-phosphate decarboxylase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D7G7 1e-81 247 51 1 226 3 pyrF Orotidine 5'-phosphate decarboxylase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57358 1e-81 247 51 1 226 3 pyrF Orotidine 5'-phosphate decarboxylase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
C3K758 1.62e-81 246 54 2 231 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas fluorescens (strain SBW25)
B4RKA3 1.75e-81 247 56 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria gonorrhoeae (strain NCCP11945)
Q5F9J2 1.75e-81 247 56 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q3K8H1 3.25e-81 246 54 2 227 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas fluorescens (strain Pf0-1)
A1KT74 4.23e-81 246 55 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K005 4.23e-81 246 55 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JV18 5.87e-81 246 55 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q4KFV3 4.66e-80 243 53 2 227 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q59654 6.98e-80 243 56 2 216 1 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02P38 6.98e-80 243 56 2 216 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V800 6.98e-80 243 56 2 216 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas aeruginosa (strain LESB58)
A6V3L5 1.2e-79 242 56 2 216 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas aeruginosa (strain PA7)
Q8K9Q1 1.99e-79 241 49 1 226 3 pyrF Orotidine 5'-phosphate decarboxylase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q3SK77 2.72e-78 239 57 1 234 3 pyrF Orotidine 5'-phosphate decarboxylase Thiobacillus denitrificans (strain ATCC 25259)
Q1QA56 1.19e-77 237 53 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FRL9 1.22e-77 237 53 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B0KUJ6 5.78e-77 235 53 2 233 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas putida (strain GB-1)
Q88LW2 5.97e-77 235 53 2 233 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B1J5Q0 6.96e-77 235 55 2 216 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas putida (strain W619)
A5W7B0 8.28e-77 234 53 2 233 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q884R0 1.63e-76 234 55 2 216 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZVD9 4.03e-76 233 55 2 216 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas syringae pv. syringae (strain B728a)
Q83E06 6.22e-76 233 53 1 227 1 pyrF Orotidine 5'-phosphate decarboxylase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NC23 6.22e-76 233 53 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KCT0 6.22e-76 233 53 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Coxiella burnetii (strain Dugway 5J108-111)
B6J1D4 6.22e-76 233 53 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Coxiella burnetii (strain CbuG_Q212)
B6J887 6.22e-76 233 53 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Coxiella burnetii (strain CbuK_Q154)
Q8D2J1 7.18e-76 232 49 1 223 3 pyrF Orotidine 5'-phosphate decarboxylase Wigglesworthia glossinidia brevipalpis
Q1ID82 1.29e-75 231 52 2 233 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas entomophila (strain L48)
Q48KP5 1.34e-75 231 55 2 216 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A5EVH6 3.61e-72 223 56 1 223 3 pyrF Orotidine 5'-phosphate decarboxylase Dichelobacter nodosus (strain VCS1703A)
Q89AL6 1.98e-70 219 45 2 226 3 pyrF Orotidine 5'-phosphate decarboxylase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q0AA48 1.38e-67 211 52 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1WUI3 9.95e-67 209 55 1 209 3 pyrF Orotidine 5'-phosphate decarboxylase Halorhodospira halophila (strain DSM 244 / SL1)
A7GRK8 1.06e-66 209 47 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q3A6R4 2.28e-66 208 45 2 236 3 pyrF Orotidine 5'-phosphate decarboxylase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B7HLL7 5.03e-65 205 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain AH187)
A9VTC3 1.27e-64 204 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus mycoides (strain KBAB4)
Q819S6 1.53e-64 204 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H6L9 1.53e-64 204 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain B4264)
Q6HET1 1.8e-64 203 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1EPP7 2.18e-64 203 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain 03BB102)
Q732I6 2.18e-64 203 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7IUP3 2.84e-64 203 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain G9842)
B7JJX0 4.06e-64 202 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain AH820)
Q636E3 4.57e-64 202 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain ZK / E33L)
B9IVW0 5.04e-64 202 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain Q1)
Q81WF5 6.76e-64 202 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus anthracis
C3L743 6.76e-64 202 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P653 6.76e-64 202 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus anthracis (strain A0248)
Q119B9 1.36e-62 199 45 3 237 3 pyrF Orotidine 5'-phosphate decarboxylase Trichodesmium erythraeum (strain IMS101)
Q3AC06 2.99e-62 198 44 3 236 3 pyrF Orotidine 5'-phosphate decarboxylase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A5G5A2 7.27e-62 197 44 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Geotalea uraniireducens (strain Rf4)
B3E1T2 1.25e-61 196 45 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A1APM0 4.93e-61 195 45 1 222 3 pyrF Orotidine 5'-phosphate decarboxylase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B7KL53 6.49e-61 194 45 3 229 3 pyrF Orotidine 5'-phosphate decarboxylase Gloeothece citriformis (strain PCC 7424)
Q2RK39 7.75e-61 194 48 2 220 3 pyrF Orotidine 5'-phosphate decarboxylase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P58639 1.02e-60 194 46 3 234 3 pyrF Orotidine 5'-phosphate decarboxylase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
C6E497 1.32e-60 194 43 2 228 3 pyrF Orotidine 5'-phosphate decarboxylase Geobacter sp. (strain M21)
C5D8Q3 1.72e-60 193 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Geobacillus sp. (strain WCH70)
Q834E3 2.97e-60 192 46 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Enterococcus faecalis (strain ATCC 700802 / V583)
B5EIT8 3.09e-60 192 43 2 224 3 pyrF Orotidine 5'-phosphate decarboxylase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q8DTV1 4e-60 192 46 5 230 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2LQ82 6.95e-60 192 49 2 204 3 pyrF Orotidine 5'-phosphate decarboxylase Syntrophus aciditrophicus (strain SB)
B9LZK2 8.04e-60 192 46 2 210 3 pyrF Orotidine 5'-phosphate decarboxylase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A4VV36 1.65e-59 191 47 4 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus suis (strain 05ZYH33)
A4W1D9 1.65e-59 191 47 4 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus suis (strain 98HAH33)
A6QGA5 2.73e-59 190 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain Newman)
Q5HGM8 2.73e-59 190 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain COL)
Q2FZ71 2.73e-59 190 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHN4 2.73e-59 190 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain USA300)
A3CN89 2.79e-59 190 46 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus sanguinis (strain SK36)
Q0AXG7 4.93e-59 189 44 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P65596 7.34e-59 189 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain MW2)
Q6GA09 7.34e-59 189 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain MSSA476)
Q6GHN1 7.34e-59 189 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain MRSA252)
P99145 7.34e-59 189 44 3 224 1 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain N315)
P65595 7.34e-59 189 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X1F5 7.34e-59 189 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A4IM36 7.36e-59 189 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Geobacillus thermodenitrificans (strain NG80-2)
Q2YXG4 1.55e-58 188 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5LZW9 2.69e-58 187 45 4 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus thermophilus (strain CNRZ 1066)
Q03KS6 5.28e-58 187 44 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M4I0 5.76e-58 187 44 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q8CPJ3 6.5e-58 186 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A8AXM8 8.44e-58 186 46 4 226 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q3MEN8 9.65e-58 186 44 3 233 3 pyrF Orotidine 5'-phosphate decarboxylase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q5WFJ5 1.07e-57 186 44 2 236 3 pyrF Orotidine 5'-phosphate decarboxylase Shouchella clausii (strain KSM-K16)
Q043A6 1.26e-57 186 46 3 232 3 pyrF Orotidine 5'-phosphate decarboxylase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q71YI4 1.73e-57 186 46 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria monocytogenes serotype 4b (strain F2365)
C1KWD1 1.73e-57 186 46 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q5HPY7 1.82e-57 185 43 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9CFW9 1.87e-57 186 43 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Lactococcus lactis subsp. lactis (strain IL1403)
C6BZZ8 2.26e-57 185 44 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
P50924 2.33e-57 185 43 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Lactococcus lactis subsp. cremoris (strain MG1363)
Q3YSH4 3.22e-57 184 43 3 229 3 pyrF Orotidine 5'-phosphate decarboxylase Ehrlichia canis (strain Jake)
C1CD54 3.71e-57 184 45 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain JJA)
B8ZMZ9 3.71e-57 184 45 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q02YJ4 4.76e-57 184 43 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Lactococcus lactis subsp. cremoris (strain SK11)
C1CQG7 6.24e-57 184 45 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CJF5 6.24e-57 184 45 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain P1031)
B5E301 6.24e-57 184 45 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae serotype 19F (strain G54)
Q2RNS7 6.94e-57 184 46 2 233 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P58641 7.42e-57 184 46 2 223 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0CB75 7.67e-57 184 45 3 223 1 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q5L0U0 8.88e-57 184 45 2 232 1 pyrF Orotidine 5'-phosphate decarboxylase Geobacillus kaustophilus (strain HTA426)
Q4L5Q6 1.14e-56 183 44 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus haemolyticus (strain JCSC1435)
Q8DQL6 1.25e-56 183 45 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IN86 1.25e-56 183 45 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain CGSP14)
Q04LJ3 1.25e-56 183 45 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q2GG43 1.28e-56 183 43 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
B3CN77 1.54e-56 183 45 2 226 3 pyrF Orotidine 5'-phosphate decarboxylase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
C1C651 1.57e-56 183 44 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain 70585)
Q74D58 2.01e-56 183 45 2 223 3 pyrF Orotidine 5'-phosphate decarboxylase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B1IAM6 2.27e-56 182 45 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain Hungary19A-6)
Q6A911 2.68e-56 182 45 2 221 3 pyrF Orotidine 5'-phosphate decarboxylase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q49WY5 3.56e-56 182 44 5 229 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q39VY5 4.52e-56 182 47 2 210 3 pyrF Orotidine 5'-phosphate decarboxylase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P46535 4.97e-56 182 45 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus caldolyticus
Q74J28 5.2e-56 182 45 3 232 3 pyrF Orotidine 5'-phosphate decarboxylase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q30XT2 2.37e-55 180 43 4 232 3 pyrF Orotidine 5'-phosphate decarboxylase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8E5F0 4.06e-55 179 43 5 229 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus agalactiae serotype III (strain NEM316)
Q049E0 5.34e-55 179 44 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G991 5.34e-55 179 44 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q5FJB3 5.53e-55 179 43 3 232 1 pyrF Orotidine 5'-phosphate decarboxylase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q7NK22 6.06e-55 179 47 3 206 3 pyrF Orotidine 5'-phosphate decarboxylase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B1HQC3 7.59e-55 179 45 3 218 3 pyrF Orotidine 5'-phosphate decarboxylase Lysinibacillus sphaericus (strain C3-41)
Q92AH6 9.65e-55 178 45 2 223 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B8DKC9 9.93e-55 179 47 4 214 3 pyrF Orotidine 5'-phosphate decarboxylase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q5FNS8 1.06e-54 178 44 2 218 3 pyrF Orotidine 5'-phosphate decarboxylase Gluconobacter oxydans (strain 621H)
Q8DZQ2 1.61e-54 178 44 6 229 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
B8E2K1 2.16e-54 178 40 2 236 3 pyrF Orotidine 5'-phosphate decarboxylase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q3K145 2.18e-54 177 43 5 229 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q1WTX2 2.43e-54 177 42 4 227 3 pyrF Orotidine 5'-phosphate decarboxylase Ligilactobacillus salivarius (strain UCC118)
B6JCI7 5.56e-54 176 44 2 223 3 pyrF Orotidine 5'-phosphate decarboxylase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B5YFH2 5.84e-54 177 39 2 236 3 pyrF Orotidine 5'-phosphate decarboxylase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B9DUH9 1.06e-53 176 42 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q5GRJ9 2.19e-53 175 42 2 226 3 pyrF Orotidine 5'-phosphate decarboxylase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q0I824 4.63e-53 174 47 3 219 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain CC9311)
A0AJT7 1.91e-52 172 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A5GN53 2.35e-52 172 47 3 219 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain WH7803)
Q2W019 3.12e-52 172 43 1 214 3 pyrF Orotidine 5'-phosphate decarboxylase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2JPF1 3.15e-52 172 44 5 227 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain JA-2-3B'a(2-13))
A1VF83 3.19e-52 172 48 3 215 3 pyrF Orotidine 5'-phosphate decarboxylase Nitratidesulfovibrio vulgaris (strain DP4)
Q72DM8 3.19e-52 172 48 3 215 3 pyrF Orotidine 5'-phosphate decarboxylase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B8DDS0 4.34e-52 172 43 2 223 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria monocytogenes serotype 4a (strain HCC23)
A8FD20 1.22e-51 171 43 2 224 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus pumilus (strain SAFR-032)
Q5PB36 2.24e-51 170 43 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Anaplasma marginale (strain St. Maries)
Q1GU89 2.34e-51 169 41 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
C0ME50 2.48e-51 169 43 4 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus equi subsp. zooepidemicus (strain H70)
B4U3E1 5.64e-51 169 42 4 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M7X0 5.64e-51 169 42 4 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus equi subsp. equi (strain 4047)
Q3AHU2 5.81e-51 169 47 3 219 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain CC9605)
Q9K9W2 6.27e-51 169 42 3 232 3 pyrF Orotidine 5'-phosphate decarboxylase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P77888 1.44e-50 168 43 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q5N1T9 1.66e-50 168 42 4 228 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31K20 1.66e-50 168 42 4 228 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q2JTW6 2.1e-50 167 44 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain JA-3-3Ab)
Q2G8S2 3.73e-50 166 41 2 226 3 pyrF Orotidine 5'-phosphate decarboxylase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B5XL15 3.74e-50 167 42 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M49 (strain NZ131)
Q7U8P3 5.64e-50 167 45 4 230 3 pyrF Orotidine 5'-phosphate decarboxylase Parasynechococcus marenigrum (strain WH8102)
B8IFW8 7.57e-50 166 43 1 221 3 pyrF Orotidine 5'-phosphate decarboxylase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
P0DC81 7.73e-50 166 42 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48U10 7.73e-50 166 42 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JM65 7.73e-50 166 42 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JC81 7.73e-50 166 42 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0DC80 7.73e-50 166 42 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B0TDZ7 9.79e-50 166 40 2 226 3 pyrF Orotidine 5'-phosphate decarboxylase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A2RF05 1.12e-49 165 42 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J729 1.12e-49 165 42 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHB0 1.12e-49 165 42 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5XCK8 1.12e-49 165 42 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8ER36 1.47e-49 165 44 4 217 3 pyrF Orotidine 5'-phosphate decarboxylase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P73761 1.59e-49 165 43 3 215 3 pyrF Orotidine 5'-phosphate decarboxylase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1MRK9 2.66e-49 164 40 3 230 3 pyrF Orotidine 5'-phosphate decarboxylase Lawsonia intracellularis (strain PHE/MN1-00)
Q07UT0 3.64e-49 164 44 2 209 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain BisA53)
Q3AZD9 3.66e-49 164 42 3 231 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain CC9902)
Q7V5Y2 4.7e-49 164 43 3 239 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9313)
A6Q2C1 4.8e-49 164 40 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Nitratiruptor sp. (strain SB155-2)
Q9A077 4.96e-49 164 41 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M1
Q65JU4 7.1e-49 164 41 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8RG83 8.5e-49 163 38 2 222 3 pyrF Orotidine 5'-phosphate decarboxylase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P25971 1.34e-48 163 40 2 231 1 pyrF Orotidine 5'-phosphate decarboxylase Bacillus subtilis (strain 168)
B7KUF7 2.14e-48 162 44 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A9W2W3 2.81e-48 162 44 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Methylorubrum extorquens (strain PA1)
Q8P1C0 3.87e-48 161 42 6 232 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q30QK7 5.7e-48 161 40 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q47R19 7.24e-48 161 44 3 220 3 pyrF Orotidine 5'-phosphate decarboxylase Thermobifida fusca (strain YX)
Q7VAP8 1.18e-47 160 41 4 228 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A6Q826 2.18e-47 159 41 4 228 3 pyrF Orotidine 5'-phosphate decarboxylase Sulfurovum sp. (strain NBC37-1)
Q21CH8 2.96e-47 159 44 2 209 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain BisB18)
B9L788 4.9e-47 159 37 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B2V790 5.4e-47 158 39 3 219 3 pyrF Orotidine 5'-phosphate decarboxylase Sulfurihydrogenibium sp. (strain YO3AOP1)
A9BBV1 5.52e-47 159 41 3 231 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9211)
B1M7M3 6.92e-47 158 43 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B1ZFB1 9.49e-47 158 42 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q8EUY3 1.67e-46 157 37 2 224 3 pyrF Orotidine 5'-phosphate decarboxylase Malacoplasma penetrans (strain HF-2)
B8J9L8 2.32e-46 157 44 2 205 3 pyrF Orotidine 5'-phosphate decarboxylase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IGK0 3.61e-46 156 44 2 205 3 pyrF Orotidine 5'-phosphate decarboxylase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q2N9N4 5.32e-46 155 39 2 226 3 pyrF Orotidine 5'-phosphate decarboxylase Erythrobacter litoralis (strain HTCC2594)
B4UGH8 5.99e-46 155 44 2 205 3 pyrF Orotidine 5'-phosphate decarboxylase Anaeromyxobacter sp. (strain K)
Q2J838 8.54e-46 157 40 3 249 3 pyrF Orotidine 5'-phosphate decarboxylase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A0RQJ5 1.15e-45 155 37 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter fetus subsp. fetus (strain 82-40)
Q8DLT3 1.51e-45 155 44 3 218 3 pyrF Orotidine 5'-phosphate decarboxylase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P58638 2.03e-45 154 42 2 214 3 pyrF Orotidine 5'-phosphate decarboxylase Agrobacterium fabrum (strain C58 / ATCC 33970)
A6UFC6 3.45e-45 154 41 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Sinorhizobium medicae (strain WSM419)
Q2J316 3.52e-45 154 42 2 214 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain HaA2)
Q04H28 3.62e-45 154 40 5 227 3 pyrF Orotidine 5'-phosphate decarboxylase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q38X21 1.94e-44 152 39 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Latilactobacillus sakei subsp. sakei (strain 23K)
Q7MAE8 2.78e-44 151 38 3 225 3 pyrF Orotidine 5'-phosphate decarboxylase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A8Z6D0 3.26e-44 151 37 3 220 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter concisus (strain 13826)
A8G6D9 7.04e-44 151 40 2 209 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9215)
Q92SN8 8.58e-44 150 40 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium meliloti (strain 1021)
B0UL68 1.02e-43 150 42 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Methylobacterium sp. (strain 4-46)
Q13E64 1.26e-43 150 41 2 214 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain BisB5)
A7HZG2 1.41e-43 150 38 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q9PIC1 1.55e-43 151 38 4 226 1 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7GWZ8 1.95e-43 149 37 3 220 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter curvus (strain 525.92)
A3PEG2 2.09e-43 150 39 2 210 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9301)
Q7V0D8 5.76e-43 148 40 2 209 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
B9JZC0 8.08e-43 148 39 2 226 3 pyrF Orotidine 5'-phosphate decarboxylase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B1ZSC4 8.12e-43 148 44 1 194 3 pyrF Orotidine 5'-phosphate decarboxylase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q9EYV3 1e-42 147 38 3 230 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium fredii (strain HH103)
Q5HW86 1.42e-42 149 38 4 226 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter jejuni (strain RM1221)
Q6NCY0 3.66e-42 146 41 2 208 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q9LCT0 4.54e-42 146 41 2 214 3 pyrF Orotidine 5'-phosphate decarboxylase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B3Q976 5.69e-42 146 41 2 208 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain TIE-1)
A1VYA1 6.06e-41 143 37 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FKG8 6.06e-41 143 37 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q44843 7.27e-41 143 40 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase (Fragment) Bartonella bacilliformis
A4YJQ1 8.19e-41 143 41 3 213 3 pyrF Orotidine 5'-phosphate decarboxylase Bradyrhizobium sp. (strain ORS 278)
A2BY35 9.93e-41 142 36 3 230 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9515)
A2BSQ0 1.67e-40 142 39 2 209 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain AS9601)
A7H4Z6 1.91e-40 142 36 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B3DVI6 1.98e-40 142 38 2 220 3 pyrF Orotidine 5'-phosphate decarboxylase Methylacidiphilum infernorum (isolate V4)
Q3SRG9 3.12e-40 141 37 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q46JD8 3.49e-40 141 38 3 218 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain NATL2A)
Q98DD5 5.25e-40 140 39 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A2C4A1 7.16e-40 140 37 3 218 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain NATL1A)
Q2KDF0 8.97e-40 140 37 1 229 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1MMI1 1.14e-39 140 38 1 221 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B9J7M8 1.4e-39 139 38 2 221 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B3PYJ5 2.01e-39 139 39 1 214 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium etli (strain CIAT 652)
A5E8J8 2.23e-39 139 41 3 210 3 pyrF Orotidine 5'-phosphate decarboxylase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q319F9 1.82e-38 137 38 3 211 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9312)
B5ZYG6 2.02e-38 137 36 1 229 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1QMP2 2.51e-38 136 37 2 221 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q8FXW9 2.56e-38 136 40 7 233 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella suis biovar 1 (strain 1330)
B0CJX7 2.56e-38 136 40 7 233 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M9W1 2.56e-38 136 40 7 233 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8YE79 1.69e-37 134 40 7 233 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RG13 1.69e-37 134 40 7 233 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella melitensis biotype 2 (strain ATCC 23457)
B8GXJ5 3.49e-37 133 36 3 232 3 pyrF Orotidine 5'-phosphate decarboxylase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9ABW5 3.49e-37 133 36 3 232 3 pyrF Orotidine 5'-phosphate decarboxylase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q57AD4 4.28e-36 130 39 7 233 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella abortus biovar 1 (strain 9-941)
Q2YQU9 4.28e-36 130 39 7 233 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella abortus (strain 2308)
B2S9C4 4.28e-36 130 39 7 233 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella abortus (strain S19)
P56155 7.32e-36 130 34 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Helicobacter pylori (strain ATCC 700392 / 26695)
A8ZWP0 1.29e-35 130 36 5 235 3 pyrF Orotidine 5'-phosphate decarboxylase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B2UW09 2.82e-35 128 34 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Helicobacter pylori (strain Shi470)
B0T410 6.41e-35 127 35 2 228 3 pyrF Orotidine 5'-phosphate decarboxylase Caulobacter sp. (strain K31)
B6JPA4 7e-35 127 35 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Helicobacter pylori (strain P12)
Q609Y2 1.62e-33 124 36 5 244 3 pyrF Orotidine 5'-phosphate decarboxylase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B9KFP1 2.43e-33 123 33 4 221 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
O67520 5.2e-33 122 35 5 227 3 pyrF Orotidine 5'-phosphate decarboxylase Aquifex aeolicus (strain VF5)
Q9ZN53 6.2e-33 122 33 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Helicobacter pylori (strain J99 / ATCC 700824)
Q3BMA4 9e-32 119 35 4 228 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B2FU58 4.22e-31 118 34 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Stenotrophomonas maltophilia (strain K279a)
Q28K56 8.47e-31 117 38 7 229 3 pyrF Orotidine 5'-phosphate decarboxylase Jannaschia sp. (strain CCS1)
Q8PER4 1.65e-30 116 36 4 217 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas axonopodis pv. citri (strain 306)
B4SRN9 1.69e-30 116 37 4 210 3 pyrF Orotidine 5'-phosphate decarboxylase Stenotrophomonas maltophilia (strain R551-3)
Q5H6B9 1.53e-29 114 37 4 210 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SHJ1 1.53e-29 114 37 4 210 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P8Z6 1.53e-29 114 37 4 210 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q5LND3 5.23e-29 112 38 8 221 3 pyrF Orotidine 5'-phosphate decarboxylase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9PHB0 2.34e-28 110 35 4 216 3 pyrF Orotidine 5'-phosphate decarboxylase Xylella fastidiosa (strain 9a5c)
B0U1D6 2.47e-28 110 34 4 216 3 pyrF Orotidine 5'-phosphate decarboxylase Xylella fastidiosa (strain M12)
Q87FA3 2.52e-28 110 34 4 216 3 pyrF Orotidine 5'-phosphate decarboxylase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I656 2.52e-28 110 34 4 216 3 pyrF Orotidine 5'-phosphate decarboxylase Xylella fastidiosa (strain M23)
B0RZ30 3.53e-28 110 34 3 216 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas campestris pv. campestris (strain B100)
Q8P3D7 4.13e-28 110 34 3 216 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UNV9 4.13e-28 110 34 3 216 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas campestris pv. campestris (strain 8004)
Q3IY00 3.91e-26 104 37 7 222 3 pyrF Orotidine 5'-phosphate decarboxylase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q97CS3 1.48e-15 76 28 9 225 3 pyrF Orotidine 5'-phosphate decarboxylase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q46GE2 1.92e-12 67 25 5 227 3 pyrF Orotidine 5'-phosphate decarboxylase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q977X5 5.03e-12 66 25 5 227 3 pyrF Orotidine 5'-phosphate decarboxylase Methanosarcina thermophila
Q12X87 1.07e-11 65 26 6 224 3 pyrF Orotidine 5'-phosphate decarboxylase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q8U1U1 1.09e-11 65 23 5 230 3 pyrF Orotidine 5'-phosphate decarboxylase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8TS37 1.92e-11 65 25 6 232 3 pyrF Orotidine 5'-phosphate decarboxylase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PV88 3.24e-11 64 25 5 231 3 pyrF Orotidine 5'-phosphate decarboxylase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q5JDB0 2.03e-10 62 26 7 233 3 pyrF Orotidine 5'-phosphate decarboxylase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q4VWW3 3.57e-10 62 26 8 239 3 URA3 Orotidine 5'-phosphate decarboxylase Coccidioides posadasii (strain RMSCC 757 / Silveira)
Q9UZ35 3.79e-10 61 26 7 234 3 pyrF Orotidine 5'-phosphate decarboxylase Pyrococcus abyssi (strain GE5 / Orsay)
Q6LZM2 5.97e-10 60 25 8 228 3 pyrF Orotidine 5'-phosphate decarboxylase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q1E9A1 1.41e-09 60 26 8 239 3 URA3 Orotidine 5'-phosphate decarboxylase Coccidioides immitis (strain RS)
Q2NHA5 2.24e-09 59 23 7 236 3 pyrF Orotidine 5'-phosphate decarboxylase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
O58462 2.54e-09 58 25 7 235 1 pyrF Orotidine 5'-phosphate decarboxylase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q57700 1.31e-08 57 22 9 225 1 pyrF Orotidine 5'-phosphate decarboxylase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O74110 1.68e-08 56 26 8 234 3 pyrF Orotidine 5'-phosphate decarboxylase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
A9A6C3 2.21e-08 56 23 6 230 3 pyrF Orotidine 5'-phosphate decarboxylase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Q9LDN2 2.72e-08 57 26 11 251 2 UMPS1 Uridine 5'-monophosphate synthase Oryza sativa subsp. japonica
O26232 2.76e-08 56 22 4 234 1 pyrF Orotidine 5'-phosphate decarboxylase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q42586 2.92e-08 57 24 8 244 2 PYRE-F Uridine 5'-monophosphate synthase Arabidopsis thaliana
Q9WYG7 4.28e-08 55 26 9 222 1 pyrF Orotidine 5'-phosphate decarboxylase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P15188 1.2e-07 55 23 9 232 2 PYR6 Orotidine 5'-phosphate decarboxylase Ustilago maydis (strain 521 / FGSC 9021)
Q9HFV8 1.22e-07 54 24 9 238 3 PYR1 Orotidine 5'-phosphate decarboxylase Passalora fulva
Q9C131 2.38e-07 53 25 7 239 3 URA3 Orotidine 5'-phosphate decarboxylase Paracoccidioides brasiliensis
Q9P8X9 5.84e-07 52 24 8 214 3 URA3 Orotidine 5'-phosphate decarboxylase Aureobasidium pullulans
O13416 1.35e-06 51 23 10 242 3 pyrG Orotidine 5'-phosphate decarboxylase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q7Z8L4 1.89e-06 51 24 9 238 3 pyrG Orotidine 5'-phosphate decarboxylase Penicillium camembertii
Q6BY69 2.18e-06 51 24 10 240 3 URA3 Orotidine 5'-phosphate decarboxylase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
P10652 2.45e-06 50 25 9 235 3 pyrG Orotidine 5'-phosphate decarboxylase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
O13410 2.92e-06 50 24 9 240 3 pyrG Orotidine 5'-phosphate decarboxylase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q757S1 4.92e-05 47 26 10 227 3 URA3 Orotidine 5'-phosphate decarboxylase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q8RZA1 6.65e-05 47 27 11 251 2 UMPS2 Uridine 5'-monophosphate synthase Oryza sativa subsp. japonica
P13649 0.000188 45 23 10 232 3 URA3 Orotidine 5'-phosphate decarboxylase Candida albicans (strain SC5314 / ATCC MYA-2876)
P03962 0.000321 44 21 9 237 1 URA3 Orotidine 5'-phosphate decarboxylase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9C150 0.00059 43 22 11 240 3 URA3 Orotidine 5'-phosphate decarboxylase Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
P09463 0.000652 43 23 10 244 3 pyrG Orotidine 5'-phosphate decarboxylase Penicillium chrysogenum
Q9UX10 0.000887 43 38 1 57 3 pyrF Orotidine 5'-phosphate decarboxylase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06335
Feature type CDS
Gene pyrF
Product orotidine-5'-phosphate decarboxylase
Location 1388387 - 1389133 (strand: -1)
Length 747 (nucleotides) / 248 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_934
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00215 Orotidine 5'-phosphate decarboxylase / HUMPS family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0284 Nucleotide transport and metabolism (F) F Orotidine-5'-phosphate decarboxylase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01591 orotidine-5'-phosphate decarboxylase [EC:4.1.1.23] Pyrimidine metabolism
Metabolic pathways
Biosynthesis of cofactors		 De novo pyrimidine biosynthesis, glutamine (+ PRPP) => UMP

Protein Sequence

MSFDCDKKSPSSTCAPVIVALDYEDQKSALDFAQLIDPSSCRLKIGKEMFTRFGPQFVTQLQQQGFDIFLDLKFHDIPNTVARAVAAAADLGVWMVNVHASGGSRMMRAAKESLRSFGKEAPLLTAVTVLTSMDQSDLTELGINLTPAEQAERLALLAKACGLDGVVCSAHEATRFKQVCGDDFLLVTPGIRPAGSEVGDQRRVMTPEQAIVAGVDYMVIGRPITRSENPLETLQQINRSIQGVVQHG

Flanking regions ( +/- flanking 50bp)

TCAGTGACGATGTCACTTTTAATAGTCTCTTGATAAATAAAGGCCTTAAAATGTCATTTGATTGTGATAAAAAATCGCCCAGCTCTACCTGCGCGCCCGTTATTGTGGCACTAGACTATGAAGACCAAAAAAGTGCACTCGATTTTGCACAACTTATCGACCCTTCATCTTGTCGCCTTAAAATTGGTAAAGAGATGTTTACTCGCTTTGGACCGCAATTTGTAACGCAATTGCAACAGCAAGGGTTTGATATTTTCTTAGATTTAAAATTTCATGATATACCCAATACGGTGGCGAGAGCAGTTGCCGCGGCTGCCGATTTAGGGGTATGGATGGTAAATGTGCATGCGAGTGGTGGTAGTCGTATGATGCGTGCGGCAAAGGAGAGCTTAAGATCATTTGGCAAAGAGGCACCGCTATTAACCGCTGTCACTGTGTTGACCAGTATGGATCAATCCGATCTCACTGAATTGGGCATTAACCTAACTCCAGCAGAACAAGCCGAACGCTTAGCATTACTGGCTAAAGCCTGTGGTCTTGATGGTGTGGTATGTTCGGCCCATGAAGCCACTCGTTTTAAACAAGTGTGTGGTGATGACTTTTTATTGGTCACTCCCGGAATTCGACCCGCGGGGAGCGAAGTGGGTGATCAGCGTCGAGTTATGACGCCAGAGCAAGCGATAGTGGCTGGGGTGGATTATATGGTGATCGGCAGACCTATTACACGCAGTGAAAATCCACTGGAAACTTTACAGCAAATTAATCGTTCTATACAAGGTGTTGTGCAACATGGATAATAATTCTCGGCTGGTTTATTCCACTGATATTGGTCGGATTAAAGAAGAAG