Homologs in group_934

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05075 FBDBKF_05075 100.0 Morganella morganii S1 pyrF orotidine-5'-phosphate decarboxylase
EHELCC_12515 EHELCC_12515 100.0 Morganella morganii S2 pyrF orotidine-5'-phosphate decarboxylase
NLDBIP_12855 NLDBIP_12855 100.0 Morganella morganii S4 pyrF orotidine-5'-phosphate decarboxylase
LHKJJB_12715 LHKJJB_12715 100.0 Morganella morganii S3 pyrF orotidine-5'-phosphate decarboxylase
F4V73_RS05530 F4V73_RS05530 83.5 Morganella psychrotolerans pyrF orotidine-5'-phosphate decarboxylase
PMI_RS06335 PMI_RS06335 65.2 Proteus mirabilis HI4320 pyrF orotidine-5'-phosphate decarboxylase

Distribution of the homologs in the orthogroup group_934

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_934

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N4C1 1.67e-126 361 76 2 242 3 pyrF Orotidine 5'-phosphate decarboxylase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8D8J6 2.02e-124 355 74 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio vulnificus (strain CMCP6)
Q7MLX2 3.93e-123 352 73 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio vulnificus (strain YJ016)
A4WAY2 9.32e-123 352 72 0 242 3 pyrF Orotidine 5'-phosphate decarboxylase Enterobacter sp. (strain 638)
Q87N49 8.65e-122 348 72 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q32GQ2 1.36e-121 348 72 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella dysenteriae serotype 1 (strain Sd197)
A7MUN7 1.4e-121 348 72 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio campbellii (strain ATCC BAA-1116)
Q31ZX5 1.98e-121 348 72 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella boydii serotype 4 (strain Sb227)
A7ZLA2 1.98e-121 348 72 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O139:H28 (strain E24377A / ETEC)
P08244 8.11e-121 347 72 0 241 1 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain K12)
B1XBN2 8.11e-121 347 72 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain K12 / DH10B)
C4ZTX6 8.11e-121 347 72 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain K12 / MC4100 / BW2952)
B2U0H4 1.48e-120 346 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3Z131 1.64e-120 346 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella sonnei (strain Ss046)
B6I9Z7 1.64e-120 346 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain SE11)
B1ITH3 1.64e-120 346 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZM0 1.64e-120 346 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O9:H4 (strain HS)
B7LY40 1.64e-120 346 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O8 (strain IAI1)
B7L4B7 1.64e-120 346 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain 55989 / EAEC)
B5XS09 1.75e-120 346 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Klebsiella pneumoniae (strain 342)
Q0T5B6 1.82e-120 345 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella flexneri serotype 5b (strain 8401)
Q1RC84 2.48e-120 345 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain UTI89 / UPEC)
B7MLV7 2.48e-120 345 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O45:K1 (strain S88 / ExPEC)
B1LH07 5.76e-120 344 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli (strain SMS-3-5 / SECEC)
B7N497 5.76e-120 344 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NVQ5 5.76e-120 344 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P58640 5.76e-120 344 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O157:H7
B7VH29 1.24e-119 343 71 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio atlanticus (strain LGP32)
Q83RM1 2.03e-119 343 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Shigella flexneri
A1JM26 3.59e-119 342 72 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7LRZ7 6.27e-119 342 70 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
C3LNL5 3.96e-118 339 70 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio cholerae serotype O1 (strain M66-2)
Q9KQT7 3.96e-118 339 70 0 225 1 pyrF Orotidine 5'-phosphate decarboxylase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B5FG54 5.54e-118 339 69 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Aliivibrio fischeri (strain MJ11)
Q5E3Z6 5.54e-118 339 69 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A5F6Y1 2.81e-117 337 70 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B6EIY4 2.7e-116 335 70 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Aliivibrio salmonicida (strain LFI1238)
B1JKQ0 6.27e-116 334 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66AI1 9.3e-116 334 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K4I4 9.3e-116 334 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FI10 9.3e-116 334 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TJ45 2.33e-115 333 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pestis (strain Pestoides F)
Q1CJ05 2.33e-115 333 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8T1 2.33e-115 333 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pestis bv. Antiqua (strain Angola)
P58644 2.33e-115 333 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pestis
Q1C7L9 2.33e-115 333 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Yersinia pestis bv. Antiqua (strain Antiqua)
B7UR89 5.77e-114 329 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8FHU2 2.85e-113 327 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MUC3 2.85e-113 327 71 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O81 (strain ED1a)
Q0TI84 1.17e-112 326 70 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
C6DK13 1.84e-112 325 70 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D5T3 1.5e-111 323 70 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6LPE7 3.43e-111 322 69 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Photobacterium profundum (strain SS9)
B5BID8 1.91e-109 318 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella paratyphi A (strain AKU_12601)
Q5PD06 1.91e-109 318 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5F565 1.91e-109 318 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella agona (strain SL483)
B4T6V0 2.6e-109 317 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella newport (strain SL254)
B5R6P3 3.09e-109 317 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R486 3.09e-109 317 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella enteritidis PT4 (strain P125109)
A1SYZ6 3.66e-109 317 67 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q15T09 8e-109 316 66 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q57NV3 8.19e-109 316 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella choleraesuis (strain SC-B67)
Q4QJV1 1.03e-108 315 64 0 230 3 pyrF Orotidine 5'-phosphate decarboxylase Haemophilus influenzae (strain 86-028NP)
P07691 1.53e-108 315 69 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2NT36 6.99e-108 314 72 0 212 3 pyrF Orotidine 5'-phosphate decarboxylase Sodalis glossinidius (strain morsitans)
P58643 3.85e-107 312 68 0 241 3 pyrF Orotidine 5'-phosphate decarboxylase Salmonella typhi
Q7NTL2 3.91e-107 312 66 1 236 3 pyrF Orotidine 5'-phosphate decarboxylase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A5UBN7 9.86e-107 310 63 0 230 3 pyrF Orotidine 5'-phosphate decarboxylase Haemophilus influenzae (strain PittEE)
Q9CMM1 1.07e-106 310 63 0 231 3 pyrF Orotidine 5'-phosphate decarboxylase Pasteurella multocida (strain Pm70)
Q65SI1 1.14e-106 310 62 0 232 3 pyrF Orotidine 5'-phosphate decarboxylase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B4EW04 1.39e-106 310 68 0 227 3 pyrF Orotidine 5'-phosphate decarboxylase Proteus mirabilis (strain HI4320)
P43812 7.47e-106 308 63 0 230 3 pyrF Orotidine 5'-phosphate decarboxylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6VPK5 1.37e-105 307 63 0 227 3 pyrF Orotidine 5'-phosphate decarboxylase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0BP16 1.76e-104 305 62 0 227 3 pyrF Orotidine 5'-phosphate decarboxylase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXH2 1.76e-104 305 62 0 227 3 pyrF Orotidine 5'-phosphate decarboxylase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0A0 1.76e-104 305 62 0 227 3 pyrF Orotidine 5'-phosphate decarboxylase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A8FVN0 8.03e-104 303 65 0 229 3 pyrF Orotidine 5'-phosphate decarboxylase Shewanella sediminis (strain HAW-EB3)
B8F472 2.6e-103 301 62 0 227 3 pyrF Orotidine 5'-phosphate decarboxylase Glaesserella parasuis serovar 5 (strain SH0165)
Q482F9 4.89e-102 298 66 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q8EEI4 6.36e-102 298 64 0 227 3 pyrF Orotidine 5'-phosphate decarboxylase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C4LEZ7 4.27e-101 296 61 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q7VLR5 1.81e-100 295 60 0 227 3 pyrF Orotidine 5'-phosphate decarboxylase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A1TZF4 9.8e-100 293 64 0 225 3 pyrF Orotidine 5'-phosphate decarboxylase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q3IGA7 2.41e-96 284 61 0 228 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudoalteromonas translucida (strain TAC 125)
A6W097 1e-94 280 58 0 230 3 pyrF Orotidine 5'-phosphate decarboxylase Marinomonas sp. (strain MWYL1)
C3K758 3.34e-93 276 61 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas fluorescens (strain SBW25)
Q6F9Z3 1.06e-92 275 61 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A3M508 2.6e-92 274 60 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HZE8 2.6e-92 274 60 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain ACICU)
B7I534 6.59e-92 273 60 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain AB0057)
B0VD17 9.01e-92 272 60 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain AYE)
B7H3K6 9.01e-92 272 60 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain AB307-0294)
B0VN04 1.35e-91 272 59 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Acinetobacter baumannii (strain SDF)
Q4KFV3 1.35e-90 270 58 1 229 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1LTG7 6.07e-90 268 58 0 231 3 pyrF Orotidine 5'-phosphate decarboxylase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3K8H1 1.04e-89 267 59 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas fluorescens (strain Pf0-1)
C5BSJ7 1.2e-89 267 57 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q31GC7 1.24e-89 267 58 1 226 3 pyrF Orotidine 5'-phosphate decarboxylase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A6V3L5 2.78e-88 263 60 1 228 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas aeruginosa (strain PA7)
Q5X5E0 2.97e-88 263 57 0 221 3 pyrF Orotidine 5'-phosphate decarboxylase Legionella pneumophila (strain Paris)
Q4FRL9 3.39e-88 263 60 1 229 3 pyrF Orotidine 5'-phosphate decarboxylase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q21IS8 5.15e-88 263 58 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q59654 5.6e-88 263 60 1 228 1 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02P38 5.6e-88 263 60 1 228 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V800 5.6e-88 263 60 1 228 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas aeruginosa (strain LESB58)
A5IBR7 1.8e-87 261 57 0 221 3 pyrF Orotidine 5'-phosphate decarboxylase Legionella pneumophila (strain Corby)
Q5ZVL5 2.72e-87 261 57 0 221 3 pyrF Orotidine 5'-phosphate decarboxylase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q3J8N5 2.82e-87 261 56 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5WWS3 1.42e-86 259 57 0 221 3 pyrF Orotidine 5'-phosphate decarboxylase Legionella pneumophila (strain Lens)
Q3SK77 6.3e-86 258 64 2 233 3 pyrF Orotidine 5'-phosphate decarboxylase Thiobacillus denitrificans (strain ATCC 25259)
Q1QA56 1.55e-85 256 60 1 229 3 pyrF Orotidine 5'-phosphate decarboxylase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B1J5Q0 1.93e-85 256 60 1 212 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas putida (strain W619)
C1D549 3.65e-85 256 59 2 227 3 pyrF Orotidine 5'-phosphate decarboxylase Laribacter hongkongensis (strain HLHK9)
Q4ZVD9 3.72e-85 256 60 1 212 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas syringae pv. syringae (strain B728a)
Q48KP5 4.99e-85 255 60 1 212 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q884R0 8.72e-85 254 59 1 212 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B0KUJ6 6.36e-84 253 60 1 212 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas putida (strain GB-1)
Q1ID82 9.74e-84 252 60 1 212 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas entomophila (strain L48)
Q2SCG0 1.16e-83 252 57 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Hahella chejuensis (strain KCTC 2396)
A5W7B0 1.87e-83 251 60 1 212 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88LW2 2.63e-83 251 60 1 212 3 pyrF Orotidine 5'-phosphate decarboxylase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B4RKA3 4.75e-82 248 56 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria gonorrhoeae (strain NCCP11945)
Q5F9J2 4.75e-82 248 56 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q8D2J1 5.06e-82 248 50 1 223 3 pyrF Orotidine 5'-phosphate decarboxylase Wigglesworthia glossinidia brevipalpis
Q5QZ42 5.59e-82 248 55 1 226 3 pyrF Orotidine 5'-phosphate decarboxylase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0VNQ9 7.34e-82 247 60 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1QVK2 1.41e-81 247 57 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9JV18 4.49e-81 246 55 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3Q3 7.5e-81 245 55 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria meningitidis serogroup C (strain 053442)
A1KT74 1.66e-80 244 55 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K005 1.66e-80 244 55 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q2Y7B1 3.42e-80 243 54 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q0AIZ1 1.59e-77 236 52 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8K9Q1 3.18e-75 231 45 2 235 3 pyrF Orotidine 5'-phosphate decarboxylase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q82TD8 1.84e-74 228 55 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B8D963 4.11e-73 225 47 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D7G7 4.25e-73 225 47 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57358 4.25e-73 225 47 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q83E06 1.94e-71 221 50 2 229 1 pyrF Orotidine 5'-phosphate decarboxylase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NC23 1.94e-71 221 50 2 229 3 pyrF Orotidine 5'-phosphate decarboxylase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KCT0 1.94e-71 221 50 2 229 3 pyrF Orotidine 5'-phosphate decarboxylase Coxiella burnetii (strain Dugway 5J108-111)
B6J1D4 1.94e-71 221 50 2 229 3 pyrF Orotidine 5'-phosphate decarboxylase Coxiella burnetii (strain CbuG_Q212)
B6J887 1.94e-71 221 50 2 229 3 pyrF Orotidine 5'-phosphate decarboxylase Coxiella burnetii (strain CbuK_Q154)
A5EVH6 4.06e-69 215 53 1 227 3 pyrF Orotidine 5'-phosphate decarboxylase Dichelobacter nodosus (strain VCS1703A)
Q0AA48 1.61e-66 208 56 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q89AL6 3.96e-66 207 40 2 226 3 pyrF Orotidine 5'-phosphate decarboxylase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9CFW9 5.24e-63 199 47 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Lactococcus lactis subsp. lactis (strain IL1403)
P50924 8.01e-63 199 46 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Lactococcus lactis subsp. cremoris (strain MG1363)
Q02YJ4 9.12e-63 199 46 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Lactococcus lactis subsp. cremoris (strain SK11)
Q8DTV1 9.12e-63 199 48 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q3A6R4 1.32e-62 199 48 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A1WUI3 1.61e-62 198 56 1 209 3 pyrF Orotidine 5'-phosphate decarboxylase Halorhodospira halophila (strain DSM 244 / SL1)
C6E497 1.34e-61 196 45 1 231 3 pyrF Orotidine 5'-phosphate decarboxylase Geobacter sp. (strain M21)
Q5M4I0 1.85e-61 195 47 4 226 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
B5EIT8 2.63e-61 195 44 1 231 3 pyrF Orotidine 5'-phosphate decarboxylase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B3E1T2 3.06e-61 195 45 1 230 3 pyrF Orotidine 5'-phosphate decarboxylase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q03KS6 4.81e-61 194 46 4 226 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A1APM0 3.65e-60 192 45 1 229 3 pyrF Orotidine 5'-phosphate decarboxylase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q5LZW9 4.18e-60 192 46 4 226 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus thermophilus (strain CNRZ 1066)
A5G5A2 3.3e-59 190 45 1 230 3 pyrF Orotidine 5'-phosphate decarboxylase Geotalea uraniireducens (strain Rf4)
Q2RK39 3.39e-59 190 48 2 219 3 pyrF Orotidine 5'-phosphate decarboxylase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q4L5Q6 1.34e-58 188 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus haemolyticus (strain JCSC1435)
Q5HPY7 2.38e-58 187 43 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2RNS7 3.24e-58 187 46 2 232 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8CPJ3 3.56e-58 187 43 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q834E3 2.47e-57 185 46 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Enterococcus faecalis (strain ATCC 700802 / V583)
B9DUH9 3.02e-57 184 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A8AXM8 3.05e-57 184 44 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B9LZK2 3.26e-57 185 45 1 215 3 pyrF Orotidine 5'-phosphate decarboxylase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A6QGA5 3.51e-57 184 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain Newman)
Q5HGM8 3.51e-57 184 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain COL)
Q2FZ71 3.51e-57 184 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHN4 3.51e-57 184 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain USA300)
P58639 6.27e-57 184 45 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q0AXG7 1.49e-56 183 45 5 231 3 pyrF Orotidine 5'-phosphate decarboxylase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A4VV36 1.57e-56 183 44 4 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus suis (strain 05ZYH33)
A4W1D9 1.57e-56 183 44 4 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus suis (strain 98HAH33)
Q74D58 2.13e-56 182 46 1 223 3 pyrF Orotidine 5'-phosphate decarboxylase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B7KL53 2.24e-56 182 43 3 222 3 pyrF Orotidine 5'-phosphate decarboxylase Gloeothece citriformis (strain PCC 7424)
Q2LQ82 2.42e-56 183 46 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Syntrophus aciditrophicus (strain SB)
Q2YXG4 2.67e-56 182 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5FJB3 2.79e-56 182 44 3 227 1 pyrF Orotidine 5'-phosphate decarboxylase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
P65596 2.98e-56 182 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain MW2)
Q6GA09 2.98e-56 182 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain MSSA476)
Q6GHN1 2.98e-56 182 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain MRSA252)
P99145 2.98e-56 182 45 3 224 1 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain N315)
P65595 2.98e-56 182 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X1F5 2.98e-56 182 45 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A3CN89 3.11e-56 182 43 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus sanguinis (strain SK36)
Q49WY5 3.25e-56 182 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B7JJX0 3.55e-56 182 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain AH820)
P0DC81 3.74e-56 182 46 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48U10 3.74e-56 182 46 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JM65 3.74e-56 182 46 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JC81 3.74e-56 182 46 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0DC80 3.74e-56 182 46 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q6HET1 4.32e-56 182 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q636E3 5.31e-56 182 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain ZK / E33L)
C1EPP7 5.98e-56 181 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain 03BB102)
Q732I6 5.98e-56 181 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q39VY5 7.25e-56 181 47 1 210 3 pyrF Orotidine 5'-phosphate decarboxylase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A2RF05 8.72e-56 181 46 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J729 8.72e-56 181 46 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHB0 8.72e-56 181 46 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5XCK8 8.72e-56 181 46 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A9VTC3 1.05e-55 181 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus mycoides (strain KBAB4)
B7HLL7 1.06e-55 181 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain AH187)
A7GRK8 1.1e-55 181 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q119B9 1.16e-55 181 43 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Trichodesmium erythraeum (strain IMS101)
Q7NK22 1.16e-55 181 49 4 214 3 pyrF Orotidine 5'-phosphate decarboxylase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
C1CQG7 1.25e-55 181 46 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CJF5 1.25e-55 181 46 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain P1031)
B5E301 1.25e-55 181 46 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae serotype 19F (strain G54)
B7IUP3 1.36e-55 181 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain G9842)
Q819S6 1.66e-55 180 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H6L9 1.66e-55 180 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain B4264)
Q81WF5 1.66e-55 180 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus anthracis
C3L743 1.66e-55 180 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P653 1.66e-55 180 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus anthracis (strain A0248)
P0CB75 1.85e-55 180 46 5 224 1 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q5FNS8 2.09e-55 180 45 2 224 3 pyrF Orotidine 5'-phosphate decarboxylase Gluconobacter oxydans (strain 621H)
B8E2K1 2.23e-55 180 41 2 231 3 pyrF Orotidine 5'-phosphate decarboxylase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B5XL15 2.44e-55 180 45 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M49 (strain NZ131)
Q8DQL6 2.76e-55 180 46 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IN86 2.76e-55 180 46 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain CGSP14)
Q04LJ3 2.76e-55 180 46 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B5YFH2 3.23e-55 180 41 2 231 3 pyrF Orotidine 5'-phosphate decarboxylase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B1IAM6 3.43e-55 179 46 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain Hungary19A-6)
C1CD54 4.36e-55 179 45 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain JJA)
B8ZMZ9 4.36e-55 179 45 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C651 4.7e-55 179 45 5 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pneumoniae (strain 70585)
Q9A077 4.84e-55 179 45 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M1
Q8P1C0 7.31e-55 179 46 5 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus pyogenes serotype M18 (strain MGAS8232)
C6BZZ8 8.06e-55 178 43 4 234 3 pyrF Orotidine 5'-phosphate decarboxylase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A1VF83 1.91e-54 177 50 3 213 3 pyrF Orotidine 5'-phosphate decarboxylase Nitratidesulfovibrio vulgaris (strain DP4)
Q72DM8 1.91e-54 177 50 3 213 3 pyrF Orotidine 5'-phosphate decarboxylase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B9IVW0 2e-54 177 43 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus cereus (strain Q1)
Q3MEN8 2.52e-54 177 44 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q3AC06 3.17e-54 177 42 1 226 3 pyrF Orotidine 5'-phosphate decarboxylase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q043A6 3.63e-54 177 43 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
C0ME50 4.14e-54 177 45 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus equi subsp. zooepidemicus (strain H70)
Q3YSH4 4.64e-54 176 41 3 229 3 pyrF Orotidine 5'-phosphate decarboxylase Ehrlichia canis (strain Jake)
Q30XT2 5.12e-54 176 45 4 231 3 pyrF Orotidine 5'-phosphate decarboxylase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B4U3E1 2.22e-53 175 44 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M7X0 2.22e-53 175 44 4 225 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus equi subsp. equi (strain 4047)
B8DKC9 3.44e-53 175 48 5 239 3 pyrF Orotidine 5'-phosphate decarboxylase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q3AHU2 5.83e-53 174 46 3 234 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain CC9605)
A5GN53 7.93e-53 174 45 4 241 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain WH7803)
P58641 1.06e-52 173 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q0I824 1.81e-52 173 45 3 229 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain CC9311)
Q6A911 2.17e-52 172 46 4 229 3 pyrF Orotidine 5'-phosphate decarboxylase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A4IM36 2.17e-52 172 45 2 228 3 pyrF Orotidine 5'-phosphate decarboxylase Geobacillus thermodenitrificans (strain NG80-2)
Q2N9N4 3.18e-52 171 40 2 229 3 pyrF Orotidine 5'-phosphate decarboxylase Erythrobacter litoralis (strain HTCC2594)
C5D8Q3 3.94e-52 172 44 2 227 3 pyrF Orotidine 5'-phosphate decarboxylase Geobacillus sp. (strain WCH70)
Q7U8P3 5.57e-52 172 46 3 225 3 pyrF Orotidine 5'-phosphate decarboxylase Parasynechococcus marenigrum (strain WH8102)
Q2JTW6 9.37e-52 171 44 6 229 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain JA-3-3Ab)
B3CN77 9.64e-52 170 41 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q049E0 9.75e-52 171 41 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G991 9.75e-52 171 41 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q92AH6 9.86e-52 171 44 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P77888 1.02e-51 171 44 4 229 3 pyrF Orotidine 5'-phosphate decarboxylase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q3AZD9 1.04e-51 171 44 3 231 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain CC9902)
Q74J28 1.63e-51 170 40 3 230 3 pyrF Orotidine 5'-phosphate decarboxylase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A8FD20 1.8e-51 170 44 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus pumilus (strain SAFR-032)
Q1GU89 5.37e-51 168 41 3 229 3 pyrF Orotidine 5'-phosphate decarboxylase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q1MRK9 9.39e-51 168 42 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Lawsonia intracellularis (strain PHE/MN1-00)
Q71YI4 1.04e-50 168 42 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria monocytogenes serotype 4b (strain F2365)
C1KWD1 1.04e-50 168 42 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q2GG43 1.32e-50 167 39 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q65JU4 1.92e-50 167 42 2 227 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2JPF1 4.33e-50 166 44 5 228 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q8RG83 5.88e-50 166 38 2 226 3 pyrF Orotidine 5'-phosphate decarboxylase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P25971 9.71e-50 166 42 2 224 1 pyrF Orotidine 5'-phosphate decarboxylase Bacillus subtilis (strain 168)
B1HQC3 1.07e-49 166 43 3 225 3 pyrF Orotidine 5'-phosphate decarboxylase Lysinibacillus sphaericus (strain C3-41)
P73761 1.17e-49 165 41 4 232 3 pyrF Orotidine 5'-phosphate decarboxylase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8E5F0 1.43e-49 165 41 4 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus agalactiae serotype III (strain NEM316)
Q8EUY3 1.69e-49 165 37 2 215 3 pyrF Orotidine 5'-phosphate decarboxylase Malacoplasma penetrans (strain HF-2)
Q5GRJ9 1.97e-49 164 39 2 227 3 pyrF Orotidine 5'-phosphate decarboxylase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q3K145 2e-49 165 41 4 219 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5WFJ5 3.05e-49 164 44 2 227 3 pyrF Orotidine 5'-phosphate decarboxylase Shouchella clausii (strain KSM-K16)
B8DDS0 4.41e-49 164 43 3 224 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria monocytogenes serotype 4a (strain HCC23)
P46535 6.11e-49 164 45 2 223 3 pyrF Orotidine 5'-phosphate decarboxylase Bacillus caldolyticus
Q2G8S2 9.47e-49 162 39 2 229 3 pyrF Orotidine 5'-phosphate decarboxylase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q5L0U0 1.82e-48 162 45 2 220 1 pyrF Orotidine 5'-phosphate decarboxylase Geobacillus kaustophilus (strain HTA426)
Q7V0D8 3.08e-48 162 42 3 205 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q8DZQ2 3.19e-48 162 40 4 224 3 pyrF Orotidine 5'-phosphate decarboxylase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q2W019 3.72e-48 161 40 1 233 3 pyrF Orotidine 5'-phosphate decarboxylase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A0AJT7 4.08e-48 161 43 3 223 3 pyrF Orotidine 5'-phosphate decarboxylase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q5N1T9 6.75e-48 161 42 4 227 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31K20 6.75e-48 161 42 4 227 3 pyrF Orotidine 5'-phosphate decarboxylase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5PB36 1.77e-47 159 41 5 233 3 pyrF Orotidine 5'-phosphate decarboxylase Anaplasma marginale (strain St. Maries)
Q9K9W2 1.2e-46 157 43 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B1ZSC4 1.25e-46 157 41 1 229 3 pyrF Orotidine 5'-phosphate decarboxylase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
A2BY35 1.95e-46 157 37 4 239 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9515)
Q1WTX2 2.77e-46 157 39 3 217 3 pyrF Orotidine 5'-phosphate decarboxylase Ligilactobacillus salivarius (strain UCC118)
B0TDZ7 1.52e-45 155 41 2 214 3 pyrF Orotidine 5'-phosphate decarboxylase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B9L788 1.69e-45 154 39 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q7V5Y2 3.16e-45 154 42 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9313)
B2V790 3.2e-45 154 37 3 217 3 pyrF Orotidine 5'-phosphate decarboxylase Sulfurihydrogenibium sp. (strain YO3AOP1)
B8IFW8 5.01e-45 154 41 2 233 3 pyrF Orotidine 5'-phosphate decarboxylase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B1M7M3 5.42e-45 153 42 4 234 3 pyrF Orotidine 5'-phosphate decarboxylase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B6JCI7 6.18e-45 153 40 2 227 3 pyrF Orotidine 5'-phosphate decarboxylase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B9JZC0 7.07e-45 153 40 2 230 3 pyrF Orotidine 5'-phosphate decarboxylase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A8G6D9 1.12e-44 153 38 5 235 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9215)
Q9LCT0 1.42e-44 152 40 2 226 3 pyrF Orotidine 5'-phosphate decarboxylase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q7VAP8 2.43e-44 152 39 4 230 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A6Q2C1 2.86e-44 151 38 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Nitratiruptor sp. (strain SB155-2)
Q07UT0 3.11e-44 151 43 2 209 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain BisA53)
A8Z6D0 4.62e-44 150 37 3 220 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter concisus (strain 13826)
B7KUF7 1.77e-43 149 41 3 232 3 pyrF Orotidine 5'-phosphate decarboxylase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A3PEG2 2.01e-43 149 36 4 236 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9301)
A2BSQ0 2.03e-43 149 36 4 236 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain AS9601)
Q30QK7 3.89e-43 148 38 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
P58638 4.46e-43 148 40 2 221 3 pyrF Orotidine 5'-phosphate decarboxylase Agrobacterium fabrum (strain C58 / ATCC 33970)
A0RQJ5 4.52e-43 148 36 3 220 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter fetus subsp. fetus (strain 82-40)
A9W2W3 6.17e-43 148 41 2 231 3 pyrF Orotidine 5'-phosphate decarboxylase Methylorubrum extorquens (strain PA1)
B4UGH8 1.36e-42 147 43 1 208 3 pyrF Orotidine 5'-phosphate decarboxylase Anaeromyxobacter sp. (strain K)
Q2IGK0 1.51e-42 147 44 1 205 3 pyrF Orotidine 5'-phosphate decarboxylase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q8ER36 2.05e-42 147 39 3 228 3 pyrF Orotidine 5'-phosphate decarboxylase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q38X21 2.08e-42 147 36 4 237 3 pyrF Orotidine 5'-phosphate decarboxylase Latilactobacillus sakei subsp. sakei (strain 23K)
Q21CH8 2.9e-42 146 42 2 209 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain BisB18)
Q319F9 4.45e-42 146 36 4 239 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9312)
Q04H28 7.4e-42 145 37 4 226 3 pyrF Orotidine 5'-phosphate decarboxylase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A5E8J8 1.09e-41 145 41 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q8DLT3 1.23e-41 145 44 3 218 3 pyrF Orotidine 5'-phosphate decarboxylase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q3SRG9 1.36e-41 145 39 2 223 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A9BBV1 1.91e-41 144 39 4 233 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain MIT 9211)
B8J9L8 1.94e-41 144 43 1 205 3 pyrF Orotidine 5'-phosphate decarboxylase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A6Q826 2.13e-41 144 38 4 224 3 pyrF Orotidine 5'-phosphate decarboxylase Sulfurovum sp. (strain NBC37-1)
B0UL68 6.06e-41 143 39 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase Methylobacterium sp. (strain 4-46)
Q6NCY0 6.29e-41 143 42 2 208 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q1QMP2 7.36e-41 143 39 2 223 3 pyrF Orotidine 5'-phosphate decarboxylase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B3DVI6 8.53e-41 142 39 2 220 3 pyrF Orotidine 5'-phosphate decarboxylase Methylacidiphilum infernorum (isolate V4)
Q47R19 1.05e-40 142 42 3 221 3 pyrF Orotidine 5'-phosphate decarboxylase Thermobifida fusca (strain YX)
B3Q976 1.12e-40 142 42 2 208 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain TIE-1)
Q9PIC1 1.3e-40 143 36 4 222 1 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B9J7M8 3e-40 141 37 2 225 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A4YJQ1 3.15e-40 141 41 3 210 3 pyrF Orotidine 5'-phosphate decarboxylase Bradyrhizobium sp. (strain ORS 278)
A1VYA1 3.33e-40 141 35 4 222 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FKG8 3.33e-40 141 35 4 222 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A2C4A1 4.74e-40 141 32 4 240 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain NATL1A)
Q46JD8 5.23e-40 140 33 4 240 3 pyrF Orotidine 5'-phosphate decarboxylase Prochlorococcus marinus (strain NATL2A)
A6UFC6 5.31e-40 140 38 3 225 3 pyrF Orotidine 5'-phosphate decarboxylase Sinorhizobium medicae (strain WSM419)
Q5HW86 8.41e-40 141 36 4 222 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter jejuni (strain RM1221)
Q1MMI1 1.08e-39 140 37 1 221 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q92SN8 1.16e-39 140 38 3 225 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium meliloti (strain 1021)
Q44843 1.3e-39 139 36 1 225 3 pyrF Orotidine 5'-phosphate decarboxylase (Fragment) Bartonella bacilliformis
B1ZFB1 2.52e-39 139 39 2 231 3 pyrF Orotidine 5'-phosphate decarboxylase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q9EYV3 3.48e-39 138 38 4 229 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium fredii (strain HH103)
Q2J838 5.09e-39 139 39 3 245 3 pyrF Orotidine 5'-phosphate decarboxylase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q2KDF0 5.73e-39 138 37 2 229 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A7H4Z6 5.82e-39 137 34 4 222 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q98DD5 1e-38 137 37 3 225 3 pyrF Orotidine 5'-phosphate decarboxylase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B3PYJ5 1e-38 137 37 1 221 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium etli (strain CIAT 652)
Q13E64 1.38e-38 137 39 2 215 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain BisB5)
Q2J316 1.6e-38 137 39 2 215 3 pyrF Orotidine 5'-phosphate decarboxylase Rhodopseudomonas palustris (strain HaA2)
A7GWZ8 1.61e-38 136 36 4 222 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter curvus (strain 525.92)
B5ZYG6 1.95e-38 136 37 2 229 3 pyrF Orotidine 5'-phosphate decarboxylase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A7HZG2 9.16e-37 132 35 5 225 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q8FXW9 4.71e-36 130 37 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella suis biovar 1 (strain 1330)
B0CJX7 4.71e-36 130 37 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M9W1 4.71e-36 130 37 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B8GXJ5 6.15e-36 130 37 4 232 3 pyrF Orotidine 5'-phosphate decarboxylase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9ABW5 6.15e-36 130 37 4 232 3 pyrF Orotidine 5'-phosphate decarboxylase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7MAE8 1.41e-35 129 37 5 223 3 pyrF Orotidine 5'-phosphate decarboxylase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8YE79 2.87e-35 128 36 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RG13 2.87e-35 128 36 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella melitensis biotype 2 (strain ATCC 23457)
Q3BMA4 4.78e-35 128 39 6 230 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5H6B9 1.63e-34 127 39 3 210 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SHJ1 1.63e-34 127 39 3 210 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P8Z6 1.63e-34 127 39 3 210 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q609Y2 3.09e-34 126 37 6 234 3 pyrF Orotidine 5'-phosphate decarboxylase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q57AD4 5.83e-34 125 36 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella abortus biovar 1 (strain 9-941)
Q2YQU9 5.83e-34 125 36 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella abortus (strain 2308)
B2S9C4 5.83e-34 125 36 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Brucella abortus (strain S19)
B2FU58 1.07e-33 124 36 4 228 3 pyrF Orotidine 5'-phosphate decarboxylase Stenotrophomonas maltophilia (strain K279a)
Q8P3D7 1.88e-33 124 37 3 216 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UNV9 1.88e-33 124 37 3 216 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas campestris pv. campestris (strain 8004)
B9KFP1 3.5e-33 122 32 4 221 3 pyrF Orotidine 5'-phosphate decarboxylase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A8ZWP0 3.74e-33 123 36 6 238 3 pyrF Orotidine 5'-phosphate decarboxylase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q9PHB0 6.01e-33 122 35 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Xylella fastidiosa (strain 9a5c)
B0RZ30 7.91e-33 122 37 3 216 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas campestris pv. campestris (strain B100)
B0T410 1.51e-32 121 36 4 228 3 pyrF Orotidine 5'-phosphate decarboxylase Caulobacter sp. (strain K31)
O67520 4.8e-32 120 34 3 195 3 pyrF Orotidine 5'-phosphate decarboxylase Aquifex aeolicus (strain VF5)
Q8PER4 1.05e-31 119 39 6 213 3 pyrF Orotidine 5'-phosphate decarboxylase Xanthomonas axonopodis pv. citri (strain 306)
P56155 1.07e-31 119 32 3 215 3 pyrF Orotidine 5'-phosphate decarboxylase Helicobacter pylori (strain ATCC 700392 / 26695)
Q28K56 1.44e-31 119 38 7 230 3 pyrF Orotidine 5'-phosphate decarboxylase Jannaschia sp. (strain CCS1)
Q87FA3 1.75e-31 119 34 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I656 1.75e-31 119 34 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Xylella fastidiosa (strain M23)
B0U1D6 2.46e-31 118 34 5 232 3 pyrF Orotidine 5'-phosphate decarboxylase Xylella fastidiosa (strain M12)
B6JPA4 3.39e-31 117 33 4 218 3 pyrF Orotidine 5'-phosphate decarboxylase Helicobacter pylori (strain P12)
B2UW09 4.72e-31 117 33 4 218 3 pyrF Orotidine 5'-phosphate decarboxylase Helicobacter pylori (strain Shi470)
Q5LND3 1.08e-30 117 38 9 232 3 pyrF Orotidine 5'-phosphate decarboxylase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9ZN53 6.88e-30 114 32 4 218 3 pyrF Orotidine 5'-phosphate decarboxylase Helicobacter pylori (strain J99 / ATCC 700824)
B4SRN9 4.23e-29 112 36 4 211 3 pyrF Orotidine 5'-phosphate decarboxylase Stenotrophomonas maltophilia (strain R551-3)
Q3IY00 1.02e-26 106 36 6 230 3 pyrF Orotidine 5'-phosphate decarboxylase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q97CS3 2.87e-14 72 27 7 219 3 pyrF Orotidine 5'-phosphate decarboxylase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q9UZ35 9.2e-14 71 26 3 222 3 pyrF Orotidine 5'-phosphate decarboxylase Pyrococcus abyssi (strain GE5 / Orsay)
Q8PV88 1.4e-12 68 27 5 220 3 pyrF Orotidine 5'-phosphate decarboxylase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q46GE2 2.12e-12 67 25 3 227 3 pyrF Orotidine 5'-phosphate decarboxylase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8U1U1 3.89e-11 63 23 3 226 3 pyrF Orotidine 5'-phosphate decarboxylase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q977X5 3.96e-11 63 26 5 228 3 pyrF Orotidine 5'-phosphate decarboxylase Methanosarcina thermophila
O58462 9.23e-11 62 25 3 222 1 pyrF Orotidine 5'-phosphate decarboxylase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q12X87 1.18e-10 62 27 6 224 3 pyrF Orotidine 5'-phosphate decarboxylase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
O74110 2.95e-10 61 25 6 228 3 pyrF Orotidine 5'-phosphate decarboxylase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q8TS37 7.9e-10 60 26 5 228 3 pyrF Orotidine 5'-phosphate decarboxylase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9WYG7 9.97e-10 59 27 11 225 1 pyrF Orotidine 5'-phosphate decarboxylase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O26232 1.12e-09 60 24 5 234 1 pyrF Orotidine 5'-phosphate decarboxylase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q2NHA5 2.32e-09 58 21 4 236 3 pyrF Orotidine 5'-phosphate decarboxylase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q5JDB0 8.64e-09 57 25 4 220 3 pyrF Orotidine 5'-phosphate decarboxylase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P10652 1.45e-08 57 27 10 233 3 pyrG Orotidine 5'-phosphate decarboxylase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q4VWW3 9.7e-08 55 26 9 233 3 URA3 Orotidine 5'-phosphate decarboxylase Coccidioides posadasii (strain RMSCC 757 / Silveira)
Q1E9A1 3.66e-07 53 26 9 233 3 URA3 Orotidine 5'-phosphate decarboxylase Coccidioides immitis (strain RS)
Q9HFV8 1.05e-06 52 24 10 235 3 PYR1 Orotidine 5'-phosphate decarboxylase Passalora fulva
O13416 1.59e-06 51 25 11 238 3 pyrG Orotidine 5'-phosphate decarboxylase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P09556 2.21e-06 51 23 8 224 1 pyr56 Uridine 5'-monophosphate synthase Dictyostelium discoideum
Q7Z8L4 5.23e-06 50 24 9 231 3 pyrG Orotidine 5'-phosphate decarboxylase Penicillium camembertii
Q01637 5.87e-06 50 28 12 229 2 r-l Uridine 5'-monophosphate synthase Drosophila melanogaster
O13410 5.96e-06 49 25 10 235 3 pyrG Orotidine 5'-phosphate decarboxylase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P07817 8.69e-06 49 25 11 237 3 pyrG Orotidine 5'-phosphate decarboxylase Aspergillus niger
Q8J269 1e-05 48 25 9 231 3 pyrG Orotidine 5'-phosphate decarboxylase Penicillium nalgiovense
Q5J2D0 1.38e-05 48 25 11 237 3 pyrG Orotidine 5'-phosphate decarboxylase Aspergillus awamori
Q57700 2.34e-05 47 23 7 217 1 pyrF Orotidine 5'-phosphate decarboxylase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q96WP7 3.87e-05 47 25 11 237 3 pyrG Orotidine 5'-phosphate decarboxylase Aspergillus kawachii
P31754 5.27e-05 47 26 10 219 2 UMPS Uridine 5'-monophosphate synthase Bos taurus
P32430 5.83e-05 46 21 6 213 3 URA3 Orotidine 5'-phosphate decarboxylase Candida maltosa
Q757S1 0.000139 45 25 7 213 3 URA3 Orotidine 5'-phosphate decarboxylase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q9P8X9 0.000491 43 21 7 227 3 URA3 Orotidine 5'-phosphate decarboxylase Aureobasidium pullulans
Q12604 0.000671 43 21 6 230 3 URA3 Orotidine 5'-phosphate decarboxylase Magnusiomyces magnusii
Q9LDN2 0.00075 43 24 8 229 2 UMPS1 Uridine 5'-monophosphate synthase Oryza sativa subsp. japonica

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_11330
Feature type CDS
Gene pyrF
Product orotidine-5'-phosphate decarboxylase
Location 160312 - 161046 (strand: 1)
Length 735 (nucleotides) / 244 (amino acids)

Contig

Accession ZDB_688
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_934
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00215 Orotidine 5'-phosphate decarboxylase / HUMPS family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0284 Nucleotide transport and metabolism (F) F Orotidine-5'-phosphate decarboxylase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01591 orotidine-5'-phosphate decarboxylase [EC:4.1.1.23] Pyrimidine metabolism
Metabolic pathways
Biosynthesis of cofactors
De novo pyrimidine biosynthesis, glutamine (+ PRPP) => UMP

Protein Sequence

MTSLSSHTGRADIASPVIVALDYDNPDDALAFADRIDPAQCRLKVGKELFTFCGPECVRALQQRGFEVFLDLKFHDIPNTAAHAVRAAAELGVWMVNVHAAGGERMMTAAKEILLPYGNDAPLLIAVTVLTSMEQSDLAGTGIDATPAEHALRLAKLTQNCGLDGVVCSAHEAKLMKETLGREFKLVTPGIRPEGSDAGDQRRIMTPPQAVSAGVDYMVIGRPITRSDNPQAALQAINASVGVL

Flanking regions ( +/- flanking 50bp)

ATCCGTAATTATTTACCCGTATTAATTCACCAACCACAGGTAATACATTCATGACATCTCTTTCTTCGCATACAGGCCGTGCAGATATCGCATCGCCTGTTATTGTTGCGCTCGATTACGACAACCCGGATGATGCGCTGGCTTTTGCCGACCGTATCGATCCGGCACAGTGCCGTCTGAAAGTCGGTAAAGAGCTGTTTACCTTCTGCGGGCCGGAATGTGTCCGCGCGTTACAGCAGCGCGGGTTTGAGGTCTTTCTTGACCTGAAATTCCATGATATTCCGAATACCGCAGCGCATGCGGTGCGGGCAGCGGCTGAGCTGGGTGTGTGGATGGTTAACGTCCACGCGGCAGGTGGTGAACGCATGATGACAGCGGCAAAAGAGATCCTGCTGCCGTACGGCAACGATGCGCCGCTGCTGATCGCTGTGACCGTGCTGACCAGCATGGAGCAGTCCGACCTGGCCGGTACCGGTATTGATGCCACACCAGCAGAGCACGCGCTGCGTCTGGCAAAATTAACACAGAACTGCGGGCTGGATGGCGTGGTCTGTTCTGCTCATGAAGCGAAACTGATGAAAGAGACCCTGGGCCGGGAATTTAAACTGGTCACGCCGGGGATCCGCCCTGAAGGCAGTGATGCCGGTGACCAGCGCCGTATCATGACACCACCGCAGGCAGTCAGTGCCGGGGTGGATTATATGGTTATCGGGCGGCCAATCACCCGCAGTGATAACCCGCAGGCGGCATTACAGGCGATTAATGCTTCAGTGGGAGTATTATAAGATGGACAATAATTCACGGCTGGTTTATTCCACCGATGCCGGCCGTATTG