Homologs in group_690

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02905 FBDBKF_02905 66.6 Morganella morganii S1 uup ATPase components of ABC transporters with duplicated ATPase domains
EHELCC_03375 EHELCC_03375 66.6 Morganella morganii S2 uup ATPase components of ABC transporters with duplicated ATPase domains
NLDBIP_00085 NLDBIP_00085 66.6 Morganella morganii S4 uup ATPase components of ABC transporters with duplicated ATPase domains
LHKJJB_01950 LHKJJB_01950 66.6 Morganella morganii S3 uup ATPase components of ABC transporters with duplicated ATPase domains
HKOGLL_01990 HKOGLL_01990 66.6 Morganella morganii S5 uup ATPase components of ABC transporters with duplicated ATPase domains
F4V73_RS05350 F4V73_RS05350 67.2 Morganella psychrotolerans - ABC-F family ATP-binding cassette domain-containing protein

Distribution of the homologs in the orthogroup group_690

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_690

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P63389 8.7e-62 218 31 11 510 1 yheS Probable ATP-binding protein YheS Escherichia coli (strain K12)
P63389 3.01e-27 120 34 4 206 1 yheS Probable ATP-binding protein YheS Escherichia coli (strain K12)
P63390 8.7e-62 218 31 11 510 3 yheS Probable ATP-binding protein YheS Escherichia coli O157:H7
P63390 3.01e-27 120 34 4 206 3 yheS Probable ATP-binding protein YheS Escherichia coli O157:H7
A0A0H2VBH0 1.21e-61 218 31 11 510 1 yheS Probable ATP-binding protein YheS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A0A0H2VBH0 1.65e-27 120 35 4 206 1 yheS Probable ATP-binding protein YheS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P39115 8.77e-59 208 29 11 521 1 vmlR Ribosome protection protein VmlR Bacillus subtilis (strain 168)
O05519 1.86e-58 209 29 10 537 3 ydiF Putative ATP-binding protein YdiF Bacillus subtilis (strain 168)
O05519 4.93e-16 85 29 6 252 3 ydiF Putative ATP-binding protein YdiF Bacillus subtilis (strain 168)
P44808 5.35e-57 205 30 15 593 1 yheS Probable ATP-binding protein YheS Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9M1H3 1.2e-56 206 31 22 552 2 ABCF4 ABC transporter F family member 4 Arabidopsis thaliana
Q9M1H3 4.82e-24 110 30 3 202 2 ABCF4 ABC transporter F family member 4 Arabidopsis thaliana
O34512 1.48e-56 201 28 13 525 3 yfmM Uncharacterized ABC transporter ATP-binding protein YfmM Bacillus subtilis (strain 168)
O34512 3.32e-12 72 26 7 238 3 yfmM Uncharacterized ABC transporter ATP-binding protein YfmM Bacillus subtilis (strain 168)
O59672 9.03e-53 195 29 15 552 3 SPBC29A3.09c Uncharacterized ABC transporter ATP-binding protein C29A3.09c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O59672 2.28e-18 92 31 4 209 3 SPBC29A3.09c Uncharacterized ABC transporter ATP-binding protein C29A3.09c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9FJH6 6.24e-51 187 30 16 511 2 ABCF1 ABC transporter F family member 1 Arabidopsis thaliana
Q9FJH6 3.15e-23 107 33 2 184 2 ABCF1 ABC transporter F family member 1 Arabidopsis thaliana
Q8K268 2.04e-50 188 27 14 534 1 Abcf3 ATP-binding cassette sub-family F member 3 Mus musculus
O06476 5.63e-50 186 31 22 547 3 yfmR Uncharacterized ABC transporter ATP-binding protein YfmR Bacillus subtilis (strain 168)
Q8K9I3 9.87e-50 184 29 17 518 3 uup ATP-binding protein Uup Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P43535 1.46e-49 186 29 13 547 1 GCN20 Protein GCN20 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P43535 3.22e-20 98 31 6 204 1 GCN20 Protein GCN20 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8T6B7 1.13e-48 181 29 18 530 3 abcF2 ABC transporter F family member 2 Dictyostelium discoideum
P0A9U3 1.57e-48 180 28 11 517 1 ybiT Probable ATP-binding protein YbiT Escherichia coli (strain K12)
P0A9U4 1.57e-48 180 28 11 517 1 ybiT Probable ATP-binding protein YbiT Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9U5 1.57e-48 180 28 11 517 3 ybiT Probable ATP-binding protein YbiT Escherichia coli O157:H7
Q99LE6 4.96e-48 180 31 16 512 1 Abcf2 ATP-binding cassette sub-family F member 2 Mus musculus
Q99LE6 4.77e-18 91 31 3 201 1 Abcf2 ATP-binding cassette sub-family F member 2 Mus musculus
Q99LE6 2.01e-09 63 25 4 195 1 Abcf2 ATP-binding cassette sub-family F member 2 Mus musculus
Q66H39 1.02e-47 181 27 12 531 2 Abcf3 ATP-binding cassette sub-family F member 3 Rattus norvegicus
Q5R9Z5 1.62e-47 180 27 14 531 2 ABCF3 ATP-binding cassette sub-family F member 3 Pongo abelii
Q8T6B4 1.68e-47 182 28 13 528 3 abcF4 ABC transporter F family member 4 Dictyostelium discoideum
Q8T6B4 1.67e-16 87 29 7 206 3 abcF4 ABC transporter F family member 4 Dictyostelium discoideum
Q8T6B4 1.08e-05 52 27 2 118 3 abcF4 ABC transporter F family member 4 Dictyostelium discoideum
Q9UG63 2.68e-47 178 31 16 512 1 ABCF2 ATP-binding cassette sub-family F member 2 Homo sapiens
Q9UG63 6.15e-18 91 31 3 201 1 ABCF2 ATP-binding cassette sub-family F member 2 Homo sapiens
Q9UG63 2.12e-09 63 25 4 193 1 ABCF2 ATP-binding cassette sub-family F member 2 Homo sapiens
Q9NUQ8 2.91e-47 179 27 14 531 1 ABCF3 ATP-binding cassette sub-family F member 3 Homo sapiens
Q8H0V6 4.01e-47 179 28 19 534 1 ABCF3 ABC transporter F family member 3 Arabidopsis thaliana
Q8H0V6 2.69e-19 95 33 6 209 1 ABCF3 ABC transporter F family member 3 Arabidopsis thaliana
Q8H0V6 0.000478 47 27 3 133 1 ABCF3 ABC transporter F family member 3 Arabidopsis thaliana
Q9FIB4 5.59e-47 178 28 15 546 3 ABCF2 ABC transporter F family member 2 Arabidopsis thaliana
O42943 1.41e-46 176 29 21 537 1 SPBC16H5.08c Uncharacterized ABC transporter ATP-binding protein C16H5.08c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O42943 8.64e-25 112 35 5 195 1 SPBC16H5.08c Uncharacterized ABC transporter ATP-binding protein C16H5.08c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P57445 2.24e-46 175 29 16 545 3 uup ATP-binding protein Uup Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q2KJA2 2.32e-46 176 30 16 518 2 ABCF2 ATP-binding cassette sub-family F member 2 Bos taurus
Q2KJA2 9.67e-18 90 31 3 201 2 ABCF2 ATP-binding cassette sub-family F member 2 Bos taurus
Q2KJA2 1.47e-08 61 26 4 196 2 ABCF2 ATP-binding cassette sub-family F member 2 Bos taurus
Q8SRV5 6.85e-46 173 29 13 486 3 ECU05_1190 Probable ATP-binding cassette sub-family F member 3 homolog Encephalitozoon cuniculi (strain GB-M1)
Q8SRV5 1.45e-20 99 32 3 202 3 ECU05_1190 Probable ATP-binding cassette sub-family F member 3 homolog Encephalitozoon cuniculi (strain GB-M1)
P43672 4.08e-45 172 28 16 535 1 uup ATP-binding protein Uup Escherichia coli (strain K12)
P43672 3.55e-22 104 34 2 193 1 uup ATP-binding protein Uup Escherichia coli (strain K12)
Q8NE71 4.84e-45 174 29 16 525 1 ABCF1 ATP-binding cassette sub-family F member 1 Homo sapiens
Q6MG08 7.85e-45 173 29 15 519 1 Abcf1 ATP-binding cassette sub-family F member 1 Rattus norvegicus
Q767L0 8.14e-45 173 29 15 522 3 ABCF1 ATP-binding cassette sub-family F member 1 Sus scrofa
P40024 2.05e-44 170 28 12 523 1 ARB1 ABC transporter ATP-binding protein ARB1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P40024 2.31e-22 104 31 3 200 1 ARB1 ABC transporter ATP-binding protein ARB1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q7YR37 3.79e-44 171 29 16 525 3 ABCF1 ATP-binding cassette sub-family F member 1 Pan troglodytes
Q9LV93 1.37e-42 166 27 14 547 2 ABCF5 ABC transporter F family member 5 Arabidopsis thaliana
Q6P542 3.48e-42 166 28 14 522 1 Abcf1 ATP-binding cassette sub-family F member 1 Mus musculus
Q57242 6.47e-41 160 30 15 528 3 uup ATP-binding protein Uup Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57242 5.37e-15 82 32 2 196 3 uup ATP-binding protein Uup Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57242 2.11e-07 57 24 6 242 3 uup ATP-binding protein Uup Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0DX93 5.04e-39 152 25 14 501 1 msrD Probable macrolide resistance translation factor MsrD Streptococcus pneumoniae
P0DX93 5.03e-23 106 35 6 185 1 msrD Probable macrolide resistance translation factor MsrD Streptococcus pneumoniae
Q9USH9 1.73e-38 154 27 18 544 1 SPCC825.01 Uncharacterized ABC transporter ATP-binding protein C825.01 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O31716 8.23e-38 150 26 15 543 3 ykpA Uncharacterized ABC transporter ATP-binding protein YkpA Bacillus subtilis (strain 168)
P0A9W5 1.01e-37 150 26 14 524 3 ettA Energy-dependent translational throttle protein EttA Shigella flexneri
P0A9W5 9.1e-22 102 34 2 187 3 ettA Energy-dependent translational throttle protein EttA Shigella flexneri
P0A9W3 1.01e-37 150 26 14 524 1 ettA Energy-dependent translational throttle protein EttA Escherichia coli (strain K12)
P0A9W3 9.1e-22 102 34 2 187 1 ettA Energy-dependent translational throttle protein EttA Escherichia coli (strain K12)
P0A9W4 1.01e-37 150 26 14 524 3 ettA Energy-dependent translational throttle protein EttA Escherichia coli O157:H7
P0A9W4 9.1e-22 102 34 2 187 3 ettA Energy-dependent translational throttle protein EttA Escherichia coli O157:H7
A0A0H2VFI8 1.1e-37 150 26 14 524 1 ettA Energy-dependent translational throttle protein EttA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A0A0H2VFI8 1.3e-21 102 34 2 187 1 ettA Energy-dependent translational throttle protein EttA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P25256 6.21e-36 145 26 12 551 3 tlrC Tylosin resistance ATP-binding protein TlrC Streptomyces fradiae
P25256 2.57e-08 60 25 4 223 3 tlrC Tylosin resistance ATP-binding protein TlrC Streptomyces fradiae
P9WQK3 5.17e-35 142 26 17 549 1 ettA Energy-dependent translational throttle protein EttA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQK2 5.17e-35 142 26 17 549 3 ettA Energy-dependent translational throttle protein EttA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q45978 6.2e-35 142 29 14 487 3 uup ATP-binding protein Uup Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q45978 3.57e-14 79 30 3 194 3 uup ATP-binding protein Uup Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q45978 4.07e-09 63 31 7 169 3 uup ATP-binding protein Uup Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P45127 8.97e-35 141 28 18 517 1 ettA Energy-dependent translational throttle protein EttA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45127 2.45e-21 101 32 2 187 1 ettA Energy-dependent translational throttle protein EttA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45127 1.84e-11 70 27 6 221 1 ettA Energy-dependent translational throttle protein EttA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23212 1.7e-34 139 26 12 491 3 msrA Erythromycin resistance ATP-binding protein MsrA Staphylococcus epidermidis
P23212 7.07e-20 96 34 5 187 3 msrA Erythromycin resistance ATP-binding protein MsrA Staphylococcus epidermidis
P23212 4.92e-13 75 31 6 166 3 msrA Erythromycin resistance ATP-binding protein MsrA Staphylococcus epidermidis
D0MYB4 5.3e-28 123 29 14 371 1 TEF3 Elongation factor 3 Phytophthora infestans (strain T30-4)
D0MYB4 2.97e-08 60 28 1 97 1 TEF3 Elongation factor 3 Phytophthora infestans (strain T30-4)
D0MYB4 8.55e-08 59 36 0 68 1 TEF3 Elongation factor 3 Phytophthora infestans (strain T30-4)
D0MYB4 1.3e-07 58 27 4 168 1 TEF3 Elongation factor 3 Phytophthora infestans (strain T30-4)
O93796 7.53e-25 113 27 12 376 3 TEF3 Elongation factor 3 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O93796 1.14e-09 65 27 4 137 3 TEF3 Elongation factor 3 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O93796 3.24e-09 63 26 2 180 3 TEF3 Elongation factor 3 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O93796 1.26e-06 55 31 0 79 3 TEF3 Elongation factor 3 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O93796 8.95e-05 49 34 0 63 3 TEF3 Elongation factor 3 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O14134 5.04e-23 107 37 6 191 1 elf1 mRNA export factor elf1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O14134 1.15e-08 62 34 0 76 1 elf1 mRNA export factor elf1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O14134 3.34e-08 60 32 3 168 1 elf1 mRNA export factor elf1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O14134 2.77e-06 54 33 0 71 1 elf1 mRNA export factor elf1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P53978 1.32e-22 106 26 12 376 1 HEF3 Elongation factor 3B Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P53978 5.82e-09 62 28 0 80 1 HEF3 Elongation factor 3B Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P53978 2.34e-08 60 27 5 188 1 HEF3 Elongation factor 3B Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P53978 5.6e-07 56 31 0 79 1 HEF3 Elongation factor 3B Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P53978 0.000343 47 31 0 63 1 HEF3 Elongation factor 3B Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P16521 5.04e-22 104 25 12 374 1 YEF3 Elongation factor 3A Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P16521 1.09e-08 62 26 4 137 1 YEF3 Elongation factor 3A Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P16521 3.18e-07 57 27 3 182 1 YEF3 Elongation factor 3A Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P16521 4.8e-07 56 31 0 79 1 YEF3 Elongation factor 3A Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P16521 0.000495 47 31 0 63 1 YEF3 Elongation factor 3A Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P29551 2.31e-21 102 38 6 186 3 TEF3 Elongation factor 3 Pneumocystis carinii
P29551 2.28e-09 64 33 0 77 3 TEF3 Elongation factor 3 Pneumocystis carinii
P29551 2.37e-06 54 26 6 181 3 TEF3 Elongation factor 3 Pneumocystis carinii
P29551 1.38e-05 52 29 0 79 3 TEF3 Elongation factor 3 Pneumocystis carinii
P29551 0.000137 48 41 0 55 3 TEF3 Elongation factor 3 Pneumocystis carinii
Q6FFL0 3.78e-21 96 34 5 184 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6FFL0 9.54e-08 57 24 6 212 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O94489 5.93e-21 101 26 13 371 1 tef3 Elongation factor 3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O94489 3.01e-11 70 33 3 114 1 tef3 Elongation factor 3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O94489 9.38e-07 55 30 5 173 1 tef3 Elongation factor 3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O94489 1.15e-06 55 33 0 75 1 tef3 Elongation factor 3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O94489 9.26e-05 49 36 1 74 1 tef3 Elongation factor 3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q75EV6 9.19e-21 100 25 11 366 3 TEF3 Elongation factor 3 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q75EV6 5.76e-10 66 27 4 137 3 TEF3 Elongation factor 3 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q75EV6 1.21e-06 55 31 0 79 3 TEF3 Elongation factor 3 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q75EV6 8.86e-06 52 26 6 188 3 TEF3 Elongation factor 3 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q75EV6 0.000814 46 30 1 73 3 TEF3 Elongation factor 3 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q1Q889 1.01e-20 95 34 5 191 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1Q889 2.85e-10 64 30 6 199 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q08972 1.62e-20 100 35 7 201 1 NEW1 [NU+] prion formation protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q08972 8.68e-10 65 40 0 74 1 NEW1 [NU+] prion formation protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q08972 1.58e-08 61 29 4 185 1 NEW1 [NU+] prion formation protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q08972 1.34e-07 58 33 0 75 1 NEW1 [NU+] prion formation protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q08972 0.000309 47 32 0 65 1 NEW1 [NU+] prion formation protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q4FQ27 2.19e-19 91 34 5 191 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q4FQ27 4.9e-10 63 29 6 199 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
P25997 7.16e-19 94 25 13 380 1 CEF3 Elongation factor 3 Candida albicans (strain SC5314 / ATCC MYA-2876)
P25997 1.21e-08 62 27 4 137 1 CEF3 Elongation factor 3 Candida albicans (strain SC5314 / ATCC MYA-2876)
P25997 5.88e-06 53 26 4 172 1 CEF3 Elongation factor 3 Candida albicans (strain SC5314 / ATCC MYA-2876)
P25997 7.73e-06 52 30 0 79 1 CEF3 Elongation factor 3 Candida albicans (strain SC5314 / ATCC MYA-2876)
P25997 0.000195 48 29 2 95 1 CEF3 Elongation factor 3 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q7MMN0 7.35e-18 87 34 4 196 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q7MMN0 7.74e-09 60 30 6 165 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q8DFQ4 7.35e-18 87 34 4 196 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
Q8DFQ4 7.74e-09 60 30 6 165 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
Q87RE5 7.84e-18 87 34 3 191 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87RE5 4.26e-09 61 28 7 204 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5ZT78 2.09e-17 85 34 9 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WUF8 2.26e-17 84 34 9 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Lens)
Q5WUF8 4.05e-05 48 24 6 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Lens)
Q5E6M2 2.55e-17 85 33 5 193 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E6M2 1.83e-12 71 32 7 174 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1R5D8 6.81e-17 84 29 4 224 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q1R5D8 3e-07 55 26 7 199 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 6.81e-17 84 29 4 224 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FCM9 3e-07 55 26 7 199 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 6.81e-17 84 29 4 224 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TBX8 3e-07 55 26 7 199 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q6D4A8 7.68e-17 84 34 5 189 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D4A8 5.34e-12 69 32 5 165 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
O34392 9e-17 83 33 7 186 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
O34392 1.04e-05 50 24 6 209 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q3M5J9 9.42e-17 83 37 6 178 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q31I51 1.12e-16 83 30 4 206 3 znuC Zinc import ATP-binding protein ZnuC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q31I51 3.09e-07 55 25 6 240 3 znuC Zinc import ATP-binding protein ZnuC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q89AJ0 1.15e-16 83 33 4 188 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q89AJ0 1.9e-10 64 26 7 212 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q57554 1.24e-16 83 29 8 249 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q57554 0.000102 47 25 6 204 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q48KI4 1.7e-16 82 33 8 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48KI4 7.36e-08 57 26 5 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5X2Z8 1.85e-16 82 33 8 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Paris)
Q5X2Z8 3.02e-05 49 24 6 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Paris)
Q28VN1 2.03e-16 82 34 3 160 3 znuC Zinc import ATP-binding protein ZnuC Jannaschia sp. (strain CCS1)
Q28VN1 2.08e-11 67 28 4 177 3 znuC Zinc import ATP-binding protein ZnuC Jannaschia sp. (strain CCS1)
Q4ZV73 2.06e-16 82 33 8 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas syringae pv. syringae (strain B728a)
Q4ZV73 2.09e-08 58 26 5 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas syringae pv. syringae (strain B728a)
Q32AQ1 2.07e-16 83 29 5 224 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
Q32AQ1 2.3e-07 56 25 7 203 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
P45167 2.32e-16 85 32 3 213 3 uup-B ATP-binding protein Uup-like Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45167 9.69e-15 80 29 11 343 3 uup-B ATP-binding protein Uup-like Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8DY60 2.37e-16 85 24 19 537 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY60 7.27e-11 68 27 9 227 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q31VE6 2.64e-16 82 29 5 224 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q31VE6 1.66e-07 56 25 7 203 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q6HBS0 3.06e-16 84 31 6 213 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q8E3S6 3.17e-16 85 24 18 528 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8E3S6 3.72e-11 69 28 9 227 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q160Y9 3.28e-16 82 34 3 155 3 znuC Zinc import ATP-binding protein ZnuC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q160Y9 1.22e-10 65 30 6 186 3 znuC Zinc import ATP-binding protein ZnuC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q15TB1 3.67e-16 81 29 4 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q15TB1 0.00062 45 26 8 203 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8X4L6 3.71e-16 82 29 5 224 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
Q8X4L6 2.24e-07 56 26 7 199 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
Q21XJ9 4.42e-16 82 35 6 172 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q21XJ9 7.53e-08 57 26 8 238 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q81XL3 4.55e-16 83 31 6 213 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus anthracis
Q815Y7 4.68e-16 83 31 6 213 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q631Y4 4.72e-16 83 31 6 213 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ZK / E33L)
Q72Y96 4.86e-16 83 31 6 213 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q3YW48 4.96e-16 82 29 5 224 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
Q3YW48 3.03e-07 55 26 7 199 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
Q7N545 5.14e-16 81 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N545 3.38e-09 61 30 5 165 3 znuC Zinc import ATP-binding protein ZnuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q88KY4 6.02e-16 80 31 7 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88KY4 9.54e-11 65 29 4 177 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q884I3 6.25e-16 80 32 8 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q884I3 4.25e-08 57 26 4 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4KKK4 7.15e-16 81 29 7 238 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4KKK4 3.04e-11 67 26 6 215 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48PV0 7.49e-16 81 28 7 238 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48PV0 2.16e-09 62 25 7 216 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A0A0H2ZLL3 7.52e-16 80 28 4 211 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A0A0H2ZLL3 1.43e-06 53 25 7 203 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q87UI3 7.67e-16 81 29 10 275 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P33594 7.72e-16 81 29 5 224 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
P33594 3.03e-07 55 26 7 199 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q32HA3 8.17e-16 80 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Shigella dysenteriae serotype 1 (strain Sd197)
Q32HA3 4.83e-13 72 33 5 165 3 znuC Zinc import ATP-binding protein ZnuC Shigella dysenteriae serotype 1 (strain Sd197)
Q0S0X2 8.32e-16 81 34 7 197 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Rhodococcus jostii (strain RHA1)
A1JRI2 8.88e-16 80 33 5 189 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A1JRI2 7.48e-12 69 32 5 165 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q5PIA5 8.89e-16 80 31 3 186 3 znuC Zinc import ATP-binding protein ZnuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PIA5 1.07e-09 62 30 5 167 3 znuC Zinc import ATP-binding protein ZnuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57NA5 8.89e-16 80 31 3 186 3 znuC Zinc import ATP-binding protein ZnuC Salmonella choleraesuis (strain SC-B67)
Q57NA5 1.07e-09 62 30 5 167 3 znuC Zinc import ATP-binding protein ZnuC Salmonella choleraesuis (strain SC-B67)
Q3IWB5 9.34e-16 80 31 4 187 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3IWB5 1.08e-11 68 31 6 177 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q04DA7 9.83e-16 82 29 10 242 3 metN2 Methionine import ATP-binding protein MetN 2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q3KKA1 1.01e-15 80 29 7 238 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain Pf0-1)
Q3KKA1 9.44e-11 66 26 8 217 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain Pf0-1)
Q87UN0 1.04e-15 80 28 7 238 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q87UN0 7.63e-09 60 24 4 184 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5NFU5 1.07e-15 82 32 6 220 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q8Z5W6 1.15e-15 80 31 3 186 3 znuC Zinc import ATP-binding protein ZnuC Salmonella typhi
Q8Z5W6 5.34e-10 63 30 5 167 3 znuC Zinc import ATP-binding protein ZnuC Salmonella typhi
Q3Z2L6 1.21e-15 80 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Shigella sonnei (strain Ss046)
Q3Z2L6 2.23e-12 70 32 5 167 3 znuC Zinc import ATP-binding protein ZnuC Shigella sonnei (strain Ss046)
Q322E8 1.21e-15 80 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Shigella boydii serotype 4 (strain Sb227)
Q322E8 2.23e-12 70 32 5 167 3 znuC Zinc import ATP-binding protein ZnuC Shigella boydii serotype 4 (strain Sb227)
Q1RAS6 1.21e-15 80 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain UTI89 / UPEC)
Q1RAS6 2.23e-12 70 32 5 167 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain UTI89 / UPEC)
P0A9X1 1.21e-15 80 32 4 188 1 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain K12)
P0A9X1 2.23e-12 70 32 5 167 1 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain K12)
P0A9X2 1.21e-15 80 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9X2 2.23e-12 70 32 5 167 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGX4 1.21e-15 80 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TGX4 2.23e-12 70 32 5 167 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC19 1.21e-15 80 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O1:K1 / APEC
A1AC19 2.23e-12 70 32 5 167 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O1:K1 / APEC
P0A9X3 1.21e-15 80 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O157:H7
P0A9X3 2.23e-12 70 32 5 167 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O157:H7
Q88AS5 1.22e-15 81 31 5 198 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88AS5 4.55e-06 52 23 6 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8ZNV7 1.31e-15 80 31 3 186 2 znuC Zinc import ATP-binding protein ZnuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZNV7 1.34e-09 62 30 5 167 2 znuC Zinc import ATP-binding protein ZnuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q14H97 1.34e-15 82 32 6 220 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q38WL5 1.37e-15 82 34 5 185 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q9Z8Q8 1.39e-15 82 30 7 221 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
Q9Z8Q8 4.51e-05 49 21 4 205 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
Q7VZ31 1.56e-15 79 31 6 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W8T0 1.56e-15 79 31 6 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WK40 1.56e-15 79 31 6 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q63GR8 1.94e-15 81 27 6 219 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
O34900 1.97e-15 80 30 6 203 1 tcyN L-cystine import ATP-binding protein TcyN Bacillus subtilis (strain 168)
Q0BMC9 2.08e-15 81 32 6 220 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q0BMC9 0.00082 45 27 10 199 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 2.08e-15 81 32 6 220 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q2A3Z2 0.00082 45 27 10 199 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
P77622 2.18e-15 80 37 7 174 2 ddpF Probable D,D-dipeptide transport ATP-binding protein DdpF Escherichia coli (strain K12)
A1B9K8 2.25e-15 79 30 4 186 3 znuC Zinc import ATP-binding protein ZnuC Paracoccus denitrificans (strain Pd 1222)
A1B9K8 5.35e-13 72 30 6 202 3 znuC Zinc import ATP-binding protein ZnuC Paracoccus denitrificans (strain Pd 1222)
Q55463 2.42e-15 80 30 8 199 2 cmpD Bicarbonate transport ATP-binding protein CmpD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1CDR0 2.45e-15 80 31 7 188 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDR0 0.000167 47 29 7 185 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 2.45e-15 80 31 7 188 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q74PI5 0.000167 47 29 7 185 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 2.45e-15 80 31 7 188 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C1S0 0.000167 47 29 7 185 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q5X627 2.51e-15 81 36 7 183 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q81IN8 2.91e-15 80 26 6 219 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q39T41 3.06e-15 78 29 7 225 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q39T41 0.001 44 27 4 167 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q83KR7 3.46e-15 79 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri
Q83KR7 7.59e-12 69 33 5 165 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri
Q0T3U8 3.46e-15 79 32 4 188 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri serotype 5b (strain 8401)
Q0T3U8 7.59e-12 69 33 5 165 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri serotype 5b (strain 8401)
Q65F80 3.88e-15 80 29 8 218 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q65F80 0.000173 47 23 7 273 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
O51587 4.35e-15 80 33 8 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
O51587 8.24e-05 48 23 7 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8PP41 4.54e-15 78 31 6 216 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Xanthomonas axonopodis pv. citri (strain 306)
Q2J3T0 4.59e-15 79 31 5 183 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain HaA2)
Q2J3T0 1.36e-06 53 25 6 211 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain HaA2)
Q74AT2 4.64e-15 78 29 5 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8RI39 4.68e-15 80 32 5 182 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5WKG4 4.76e-15 78 34 7 189 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Shouchella clausii (strain KSM-K16)
Q5WKG4 8.84e-05 48 25 5 184 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Shouchella clausii (strain KSM-K16)
A0A0H2ZH52 4.87e-15 80 27 8 227 1 dppF Di/tripeptide transport ATP-binding protein DppF Pseudomonas aeruginosa (strain UCBPP-PA14)
Q4ZZS2 5e-15 79 28 7 238 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. syringae (strain B728a)
Q4ZZS2 6.95e-10 63 26 5 187 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. syringae (strain B728a)
Q5LUR8 5.08e-15 78 31 6 191 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5LUR8 4.28e-13 73 32 7 186 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q660M8 5.18e-15 80 33 8 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q660M8 9.4e-05 48 23 7 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q73EL7 5.48e-15 80 26 6 219 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6LTB1 5.84e-15 78 33 7 198 3 znuC Zinc import ATP-binding protein ZnuC Photobacterium profundum (strain SS9)
Q6LTB1 3.24e-12 70 34 7 179 3 znuC Zinc import ATP-binding protein ZnuC Photobacterium profundum (strain SS9)
Q5NN23 5.87e-15 78 33 7 204 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A0KPH6 6.11e-15 78 31 5 191 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A0KPH6 1.41e-07 56 29 6 189 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q0SZJ3 6.62e-15 78 28 5 224 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
Q0SZJ3 2.79e-07 55 26 9 204 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
Q6HP89 6.65e-15 79 26 6 219 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q665B6 6.68e-15 78 31 7 188 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q665B6 0.00022 47 29 7 185 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
O32169 7.3e-15 79 29 9 236 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q080S4 7.59e-15 77 28 6 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella frigidimarina (strain NCIMB 400)
Q080S4 1.8e-06 53 29 9 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella frigidimarina (strain NCIMB 400)
Q88R93 8.71e-15 78 34 7 188 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P12622 9.2e-15 78 31 11 263 3 chvD ATP-binding protein ChvD (Fragment) Rhizobium radiobacter
P12622 1.96e-07 56 32 0 70 3 chvD ATP-binding protein ChvD (Fragment) Rhizobium radiobacter
P12622 2.16e-05 50 42 0 64 3 chvD ATP-binding protein ChvD (Fragment) Rhizobium radiobacter
Q83J77 9.73e-15 78 28 5 224 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
Q83J77 3.56e-08 58 26 9 204 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
Q2YQP3 9.89e-15 77 30 5 233 3 BAB1_1388 Putative ABC transporter ATP-binding protein BAB1_1388 Brucella abortus (strain 2308)
Q2YQP3 7.85e-07 53 29 7 189 3 BAB1_1388 Putative ABC transporter ATP-binding protein BAB1_1388 Brucella abortus (strain 2308)
Q8FZV2 9.89e-15 77 30 5 233 3 BR1368 Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363 Brucella suis biovar 1 (strain 1330)
Q8FZV2 6.12e-07 54 29 7 189 3 BR1368 Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363 Brucella suis biovar 1 (strain 1330)
Q57CD8 9.89e-15 77 30 5 233 3 BruAb1_1365 Putative ABC transporter ATP-binding protein BruAb1_1365 Brucella abortus biovar 1 (strain 9-941)
Q57CD8 7.85e-07 53 29 7 189 3 BruAb1_1365 Putative ABC transporter ATP-binding protein BruAb1_1365 Brucella abortus biovar 1 (strain 9-941)
Q4KFA2 1.05e-14 77 30 6 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4KFA2 4.45e-08 57 27 7 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5MZ54 1.13e-14 80 35 7 177 3 cmpC Bicarbonate transport ATP-binding protein CmpC Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q55107 1.13e-14 80 35 7 177 1 cmpC Bicarbonate transport ATP-binding protein CmpC Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5ZWE4 1.17e-14 79 34 6 181 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5ZWE4 9.12e-05 48 23 7 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q6MU19 1.27e-14 79 29 5 194 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q6MU19 1.23e-06 54 24 5 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q81ZF5 1.37e-14 79 26 6 219 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q48CA0 1.42e-14 77 29 10 275 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P37313 1.43e-14 78 26 5 223 1 dppF Dipeptide transport ATP-binding protein DppF Escherichia coli (strain K12)
Q6ADG4 1.47e-14 77 28 8 218 3 pstB Phosphate import ATP-binding protein PstB Leifsonia xyli subsp. xyli (strain CTCB07)
Q2SSS4 1.51e-14 79 29 5 194 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q2SSS4 1.56e-06 54 24 5 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
P37494 1.52e-14 76 32 7 190 3 yybJ Uncharacterized ABC transporter ATP-binding protein YybJ Bacillus subtilis (strain 168)
Q0SML1 1.69e-14 78 33 8 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q0SML1 9.16e-05 48 23 7 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q9A9P4 1.69e-14 76 29 8 195 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q3IL62 1.83e-14 76 28 4 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudoalteromonas translucida (strain TAC 125)
Q3IL62 1.91e-05 49 26 7 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudoalteromonas translucida (strain TAC 125)
Q8KZQ6 2.16e-14 77 35 7 171 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida
Q3BV68 2.23e-14 77 27 8 239 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PM59 2.23e-14 77 27 8 239 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas axonopodis pv. citri (strain 306)
Q07LQ4 2.28e-14 77 34 7 186 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Rhodopseudomonas palustris (strain BisA53)
Q8U8D6 2.29e-14 77 34 7 185 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0BFQ0 2.29e-14 77 33 5 169 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q831K6 2.32e-14 78 30 7 216 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q831K6 2.74e-05 50 25 7 208 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q9RYZ3 2.46e-14 76 28 8 218 3 pstB Phosphate import ATP-binding protein PstB Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q82MV1 2.58e-14 76 34 5 167 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q82MV1 1.7e-06 53 26 6 195 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
O34946 2.6e-14 76 30 5 202 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
O34946 3.47e-05 48 23 7 176 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
Q1IGY7 2.6e-14 76 28 7 238 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas entomophila (strain L48)
Q1IGY7 5.72e-09 60 25 6 212 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas entomophila (strain L48)
Q722B1 2.77e-14 78 28 8 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
D4GSY7 2.84e-14 77 28 6 226 3 HVO_1886 Probable anion import ATP-binding protein HVO_1886 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P07821 2.92e-14 76 30 6 231 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
A1TXH7 3.13e-14 78 27 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8RD07 3.14e-14 76 30 11 235 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8RD07 5.53e-14 75 27 6 221 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q46ZU5 3.15e-14 77 32 6 173 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7A7E3 3.16e-14 77 25 5 201 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q7A7E3 0.000382 46 19 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 3.16e-14 77 25 5 201 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q99WE1 0.000382 46 19 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q1R155 3.25e-14 75 37 3 159 3 znuC Zinc import ATP-binding protein ZnuC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1R155 2.09e-10 64 30 5 178 3 znuC Zinc import ATP-binding protein ZnuC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q3K506 3.29e-14 76 29 9 242 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas fluorescens (strain Pf0-1)
Q6GJL2 3.44e-14 77 25 6 201 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
Q7VI92 3.64e-14 77 28 6 208 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q7VI92 1.69e-05 50 26 11 211 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q92DL6 3.92e-14 77 28 8 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9WXX8 4.39e-14 75 29 8 203 3 TM_0124 Probable metal transport system ATP-binding protein TM_0124 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9WXX8 1.62e-08 59 28 9 195 3 TM_0124 Probable metal transport system ATP-binding protein TM_0124 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q928L8 4.4e-14 77 27 7 226 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q928L8 9.81e-06 51 24 7 208 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q3K9F9 4.43e-14 75 30 8 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas fluorescens (strain Pf0-1)
Q3K9F9 1.47e-06 53 28 5 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas fluorescens (strain Pf0-1)
Q81V82 4.55e-14 76 29 7 244 1 fpuD Petrobactin import ATP-binding protein FpuD Bacillus anthracis
Q9KQB8 4.76e-14 75 32 3 185 3 znuC Zinc import ATP-binding protein ZnuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KQB8 7.02e-10 63 32 7 173 3 znuC Zinc import ATP-binding protein ZnuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q0K9I2 4.93e-14 76 32 6 179 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q2YVT7 4.95e-14 77 25 6 201 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2YVT7 0.00028 47 19 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5WXF0 4.97e-14 77 34 6 181 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q5WXF0 7.52e-05 48 23 7 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
A0AGP9 5.05e-14 77 30 9 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q4ZLS1 5.26e-14 75 29 10 261 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. syringae (strain B728a)
A0LCH8 5.26e-14 75 30 5 196 3 znuC Zinc import ATP-binding protein ZnuC Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A0LCH8 4e-11 67 29 4 186 3 znuC Zinc import ATP-binding protein ZnuC Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q1BWL4 5.3e-14 76 33 5 169 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia orbicola (strain AU 1054)
A0K739 5.3e-14 76 33 5 169 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia cenocepacia (strain HI2424)
Q217B2 5.43e-14 75 33 4 180 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
Q217B2 1.57e-05 50 26 7 202 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
Q5NZT6 5.56e-14 75 29 6 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q5NZT6 3.86e-06 52 24 5 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q3IM24 5.58e-14 75 28 4 183 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
O66646 5.96e-14 74 31 7 217 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Aquifex aeolicus (strain VF5)
Q9AT00 6.12e-14 77 35 6 169 1 TGD3 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic Arabidopsis thaliana
Q0I3C2 6.35e-14 74 31 6 216 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Histophilus somni (strain 129Pt)
Q0I3C2 3.83e-08 57 27 7 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Histophilus somni (strain 129Pt)
Q6F9A8 6.63e-14 77 31 5 197 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9EUS2 6.63e-14 75 27 11 248 3 pstB Phosphate import ATP-binding protein PstB Streptomyces griseus
Q1IGL4 6.76e-14 75 31 9 229 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas entomophila (strain L48)
Q5H002 6.79e-14 75 27 8 239 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P2Y5 6.79e-14 75 27 8 239 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
P57032 6.84e-14 75 32 7 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xylella fastidiosa (strain 9a5c)
Q5KVK2 6.89e-14 76 29 6 213 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
P57383 6.91e-14 74 30 4 189 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q32EX7 7.83e-14 74 31 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q32EX7 3.88e-05 48 25 5 182 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q8Y8T6 7.88e-14 76 29 8 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q5HIL5 8.19e-14 76 25 5 190 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q5HIL5 0.000329 47 19 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 8.19e-14 76 25 5 190 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2G0V2 0.000329 47 19 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 8.19e-14 76 25 5 190 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q2FJI0 0.000329 47 19 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q8NY21 8.65e-14 76 25 5 190 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q8NY21 0.000266 47 19 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 8.65e-14 76 25 5 190 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q6GC27 0.000266 47 19 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q2S3A3 8.75e-14 75 30 4 185 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salinibacter ruber (strain DSM 13855 / M31)
Q87EF4 9.34e-14 74 32 7 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P33916 9.48e-14 77 29 8 222 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 1.46e-06 54 25 9 231 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 1.54e-06 54 24 6 215 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 7.2e-06 52 25 8 206 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
Q5L3Q9 9.48e-14 75 29 3 158 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Geobacillus kaustophilus (strain HTA426)
P97027 1e-13 74 33 7 192 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus subtilis (strain 168)
Q2J534 1.02e-13 74 25 7 223 3 pstB Phosphate import ATP-binding protein PstB Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q49W48 1.03e-13 76 30 7 213 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q1GL85 1.08e-13 74 32 5 182 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria sp. (strain TM1040)
Q1GL85 2.18e-11 67 31 6 193 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria sp. (strain TM1040)
Q1RDS4 1.08e-13 74 32 7 188 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain UTI89 / UPEC)
Q1RDS4 0.000646 45 26 7 189 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain UTI89 / UPEC)
A1A9L0 1.08e-13 74 32 7 188 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O1:K1 / APEC
A1A9L0 0.000646 45 26 7 189 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O1:K1 / APEC
Q5L222 1.08e-13 76 25 5 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q3Z300 1.09e-13 74 31 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q3Z300 3.95e-05 48 25 5 182 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q1RD37 1.09e-13 74 31 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q1RD37 3.95e-05 48 25 5 182 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q8FIM7 1.09e-13 74 31 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FIM7 3.95e-05 48 25 5 182 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIV6 1.09e-13 74 31 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TIV6 3.95e-05 48 25 5 182 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q31ZH4 1.1e-13 74 31 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella boydii serotype 4 (strain Sb227)
Q31ZH4 0.000106 47 27 6 185 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella boydii serotype 4 (strain Sb227)
Q1CJG3 1.12e-13 74 31 5 189 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CJG3 1.21e-10 65 31 6 165 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CIC2 1.12e-13 74 31 5 189 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q7CIC2 1.21e-10 65 31 6 165 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q1C812 1.12e-13 74 31 5 189 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C812 1.21e-10 65 31 6 165 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
Q1AXT9 1.15e-13 75 26 7 217 3 pstB Phosphate import ATP-binding protein PstB Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
P39459 1.17e-13 74 31 5 191 3 nasD Nitrate transport protein NasD Klebsiella oxytoca
Q3AAA4 1.18e-13 74 27 9 236 3 pstB Phosphate import ATP-binding protein PstB Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3AAA4 0.000785 45 24 4 201 3 pstB Phosphate import ATP-binding protein PstB Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q1BG75 1.2e-13 75 33 4 172 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia orbicola (strain AU 1054)
A0KE71 1.2e-13 75 33 4 172 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia cenocepacia (strain HI2424)
Q45460 1.2e-13 76 31 7 199 2 opuBA Choline transport ATP-binding protein OpuBA Bacillus subtilis (strain 168)
Q45460 2.32e-05 50 25 7 194 2 opuBA Choline transport ATP-binding protein OpuBA Bacillus subtilis (strain 168)
Q66AT7 1.27e-13 74 31 5 189 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66AT7 1.27e-10 65 31 6 165 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8PKT0 1.3e-13 74 32 6 193 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas axonopodis pv. citri (strain 306)
Q1LNM0 1.37e-13 75 32 6 177 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P45022 1.37e-13 74 29 9 221 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5H0G3 1.37e-13 74 32 6 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P3E1 1.37e-13 74 32 6 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q71WH8 1.43e-13 75 29 2 158 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q8Y455 1.46e-13 75 29 2 158 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q927N9 1.5e-13 75 29 2 158 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q3A6U0 1.5e-13 74 27 7 225 3 pstB Phosphate import ATP-binding protein PstB Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
P75957 1.56e-13 73 31 7 192 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
P75957 5.06e-05 48 25 5 182 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
Q832Y6 1.63e-13 75 27 6 213 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832Y6 2.01e-05 50 25 10 205 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q9HZL7 1.68e-13 73 31 7 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HZL7 8.16e-08 57 29 4 174 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6MCV4 1.72e-13 75 32 5 183 3 potA Spermidine/putrescine import ATP-binding protein PotA Protochlamydia amoebophila (strain UWE25)
O28437 1.73e-13 73 28 2 190 3 AF_1841 Putative ABC transporter ATP-binding protein AF_1841 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O28437 1.85e-08 58 27 4 181 3 AF_1841 Putative ABC transporter ATP-binding protein AF_1841 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8G5P8 1.74e-13 76 28 5 196 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
Q6MD10 1.75e-13 73 31 5 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Protochlamydia amoebophila (strain UWE25)
Q6MD10 3.02e-10 63 29 6 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Protochlamydia amoebophila (strain UWE25)
Q9Z8J5 1.82e-13 74 31 7 208 3 CPn_0348 Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 Chlamydia pneumoniae
Q8Y0C6 1.82e-13 73 28 7 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8Y0C6 0.000166 47 26 7 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8R7Y4 1.83e-13 74 28 5 187 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9K789 1.85e-13 75 28 6 220 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8UF79 1.85e-13 74 31 4 185 3 znuC Zinc import ATP-binding protein ZnuC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UF79 4.59e-08 58 30 2 162 3 znuC Zinc import ATP-binding protein ZnuC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8YDJ8 1.86e-13 74 27 4 218 3 znuC Zinc import ATP-binding protein ZnuC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YDJ8 5.29e-09 61 28 5 173 3 znuC Zinc import ATP-binding protein ZnuC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q7NWX3 1.9e-13 75 35 4 166 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7NWX3 0.000358 47 25 7 198 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8FJ95 1.92e-13 73 33 7 193 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q576K0 1.93e-13 74 27 4 218 3 znuC Zinc import ATP-binding protein ZnuC Brucella abortus biovar 1 (strain 9-941)
Q576K0 1.02e-08 60 28 5 173 3 znuC Zinc import ATP-binding protein ZnuC Brucella abortus biovar 1 (strain 9-941)
Q2YJH4 1.93e-13 74 27 4 218 3 znuC Zinc import ATP-binding protein ZnuC Brucella abortus (strain 2308)
Q2YJH4 1.02e-08 60 28 5 173 3 znuC Zinc import ATP-binding protein ZnuC Brucella abortus (strain 2308)
Q55462 1.94e-13 77 32 4 180 2 cmpC Bicarbonate transport ATP-binding protein CmpC Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8U648 1.94e-13 73 33 6 171 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8U648 0.000662 45 28 10 226 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9HT73 2.12e-13 74 27 8 252 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HT73 1.3e-09 62 28 6 184 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK9 2.12e-13 74 27 8 252 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain UCBPP-PA14)
Q02DK9 1.3e-09 62 28 6 184 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain UCBPP-PA14)
Q13X01 2.14e-13 73 30 9 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Paraburkholderia xenovorans (strain LB400)
Q13X01 3.79e-07 55 27 8 202 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Paraburkholderia xenovorans (strain LB400)
Q21TG3 2.24e-13 73 28 7 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q21TG3 6.34e-06 51 24 8 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q13ZK7 2.28e-13 75 34 6 173 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paraburkholderia xenovorans (strain LB400)
Q03P57 2.33e-13 75 26 7 233 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q03P57 0.000828 45 26 10 206 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q8PAG0 2.54e-13 73 26 7 239 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UT63 2.54e-13 73 26 7 239 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas campestris pv. campestris (strain 8004)
Q83RS0 2.55e-13 73 31 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella flexneri
Q83RS0 0.000126 47 27 6 185 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella flexneri
Q5E3B8 2.57e-13 73 25 5 227 3 pstB2 Phosphate import ATP-binding protein PstB 2 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7N6Z2 2.67e-13 75 29 6 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N6Z2 0.000494 46 24 7 198 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q88XV1 2.69e-13 74 29 2 158 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88XV1 0.001 45 26 6 186 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q39GW5 2.7e-13 74 33 5 169 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0K4I1 2.71e-13 73 32 6 182 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q97ZT9 2.77e-13 73 26 6 215 3 pstB Phosphate import ATP-binding protein PstB Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97ZT9 3.59e-08 58 28 10 206 3 pstB Phosphate import ATP-binding protein PstB Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q9HYG4 2.82e-13 73 32 8 204 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HYG4 0.000831 45 27 5 188 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q83F44 2.9e-13 75 28 6 224 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q83F44 8.04e-06 52 23 6 207 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q6LPK2 2.93e-13 72 29 5 193 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photobacterium profundum (strain SS9)
Q6LPK2 7.58e-06 50 25 6 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photobacterium profundum (strain SS9)
P31134 2.98e-13 75 32 9 202 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q6D201 3.07e-13 74 32 6 188 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D201 2.23e-07 56 26 7 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q71WH7 3.1e-13 73 32 4 154 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
A0ALT6 3.2e-13 73 29 2 158 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
O34992 3.27e-13 75 34 7 182 1 opuCA Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA Bacillus subtilis (strain 168)
O34992 2.04e-05 50 25 9 217 1 opuCA Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA Bacillus subtilis (strain 168)
Q927N8 3.31e-13 73 32 4 154 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y454 3.37e-13 73 32 4 154 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8YCN7 3.4e-13 73 31 6 194 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 3.4e-13 73 31 6 194 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 3.4e-13 73 31 6 194 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q83HT1 3.4e-13 73 25 8 249 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain TW08/27)
Q3BTD3 3.42e-13 73 32 7 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q9HY19 3.53e-13 74 30 5 191 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q74IV9 3.58e-13 74 25 8 271 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q47L96 3.71e-13 73 27 9 221 3 pstB Phosphate import ATP-binding protein PstB Thermobifida fusca (strain YX)
Q02R79 3.9e-13 74 30 5 191 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1BHS6 3.9e-13 73 30 9 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia orbicola (strain AU 1054)
Q1BHS6 7.9e-06 51 25 7 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia orbicola (strain AU 1054)
P0A9U0 3.98e-13 72 30 6 197 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Shigella flexneri
P0A9U0 7.94e-05 47 27 7 195 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Shigella flexneri
P0A9T8 3.98e-13 72 30 6 197 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Escherichia coli (strain K12)
P0A9T8 7.94e-05 47 27 7 195 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Escherichia coli (strain K12)
P0A9T9 3.98e-13 72 30 6 197 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Escherichia coli O157:H7
P0A9T9 7.94e-05 47 27 7 195 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Escherichia coli O157:H7
Q1MEG2 3.98e-13 73 30 3 185 3 znuC Zinc import ATP-binding protein ZnuC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1MEG2 1.99e-06 53 29 5 166 3 znuC Zinc import ATP-binding protein ZnuC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q83GE8 3.99e-13 73 25 8 249 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain Twist)
Q8XIZ5 3.99e-13 74 30 6 181 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q8XIZ5 0.000339 47 24 5 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 3.99e-13 74 30 6 181 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TNZ3 0.000339 47 24 5 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8FVN0 4.26e-13 73 31 6 194 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q0A8P9 4.34e-13 72 29 6 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q0A8P9 0.000411 45 26 7 193 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q39EV3 4.34e-13 72 30 9 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39EV3 7.55e-06 51 25 7 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A3CRB8 4.38e-13 73 26 7 256 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
A3CRB8 2.57e-05 50 26 8 205 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
Q0SRL2 4.45e-13 74 30 6 181 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
Q0SRL2 0.001 45 23 5 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
P69880 4.48e-13 73 26 11 249 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MW2)
Q6G9H4 4.48e-13 73 26 11 249 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MSSA476)
P69879 4.48e-13 73 26 11 249 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain N315)
P69878 4.48e-13 73 26 11 249 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain Mu50 / ATCC 700699)
P69881 4.48e-13 73 26 11 249 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain COL)
Q2FYQ0 4.48e-13 73 26 11 249 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH51 4.48e-13 73 26 11 249 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain USA300)
Q21PQ7 4.56e-13 73 30 8 207 3 znuC Zinc import ATP-binding protein ZnuC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q21PQ7 9.05e-12 69 33 6 179 3 znuC Zinc import ATP-binding protein ZnuC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q88ZJ6 4.58e-13 74 31 7 183 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9CN78 4.63e-13 72 29 6 203 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pasteurella multocida (strain Pm70)
Q9CN78 4.09e-08 57 29 8 202 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pasteurella multocida (strain Pm70)
O31711 4.65e-13 72 27 6 213 1 yknY Uncharacterized ABC transporter ATP-binding protein YknY Bacillus subtilis (strain 168)
O31711 0.00025 46 23 8 204 1 yknY Uncharacterized ABC transporter ATP-binding protein YknY Bacillus subtilis (strain 168)
Q6GH21 4.65e-13 73 26 11 249 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MRSA252)
Q1MQ44 4.68e-13 74 33 6 177 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q8EUJ1 5.09e-13 73 28 7 208 3 pstB Phosphate import ATP-binding protein PstB Malacoplasma penetrans (strain HF-2)
Q8EUJ1 0.001 45 23 6 216 3 pstB Phosphate import ATP-binding protein PstB Malacoplasma penetrans (strain HF-2)
Q9KZW2 5.17e-13 72 24 8 257 3 pstB Phosphate import ATP-binding protein PstB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q93SH7 5.18e-13 73 30 4 181 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q93SH7 2.88e-06 52 26 7 203 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q71X09 5.47e-13 73 27 7 225 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serotype 4b (strain F2365)
Q71X09 0.000218 47 25 9 208 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serotype 4b (strain F2365)
Q2YXY2 5.5e-13 73 26 11 249 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain bovine RF122 / ET3-1)
A3DJK5 5.51e-13 73 31 2 153 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A3DJK5 0.00078 45 21 4 209 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q03A07 5.64e-13 73 29 7 216 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q03A07 8.59e-07 55 26 8 210 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8X8E3 5.74e-13 72 31 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O157:H7
Q8X8E3 8.62e-05 47 25 5 182 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O157:H7
Q24QI5 6.1e-13 73 28 5 222 3 metN Methionine import ATP-binding protein MetN Desulfitobacterium hafniense (strain Y51)
Q0SK28 6.23e-13 72 31 6 206 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Rhodococcus jostii (strain RHA1)
Q0SK28 0.000105 47 26 5 181 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Rhodococcus jostii (strain RHA1)
Q1AS06 6.3e-13 74 30 5 192 3 potA Spermidine/putrescine import ATP-binding protein PotA Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q045Z7 6.48e-13 73 27 2 158 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q045Z7 3.28e-07 55 24 8 235 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q2JUA1 6.55e-13 72 25 9 254 3 pstB1 Phosphate import ATP-binding protein PstB 1 Synechococcus sp. (strain JA-3-3Ab)
Q830W6 6.61e-13 73 30 7 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q8EEV5 7.25e-13 71 27 4 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q88HL0 7.27e-13 72 33 3 185 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88HL0 9.21e-06 51 25 9 212 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KHT9 7.34e-13 73 27 10 285 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes
G2JZ44 7.34e-13 73 27 10 285 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q55740 7.56e-13 72 28 4 202 3 sll0385 Putative ABC transporter ATP-binding protein sll0385 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q55740 2.31e-08 59 26 7 241 3 sll0385 Putative ABC transporter ATP-binding protein sll0385 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8FUU5 7.72e-13 72 27 4 218 3 znuC Zinc import ATP-binding protein ZnuC Brucella suis biovar 1 (strain 1330)
Q8FUU5 4.68e-08 58 28 5 173 3 znuC Zinc import ATP-binding protein ZnuC Brucella suis biovar 1 (strain 1330)
Q04G50 7.99e-13 73 28 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
O06980 8.06e-13 72 30 7 204 3 yvcR Uncharacterized ABC transporter ATP-binding protein YvcR Bacillus subtilis (strain 168)
O06980 0.000449 45 25 8 213 3 yvcR Uncharacterized ABC transporter ATP-binding protein YvcR Bacillus subtilis (strain 168)
Q3JDJ6 8.1e-13 72 27 6 217 3 pstB1 Phosphate import ATP-binding protein PstB 1 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
P54537 8.23e-13 72 28 4 182 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
P54537 0.000473 45 21 9 204 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q0BUR6 8.35e-13 71 31 5 184 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q832R5 8.39e-13 74 22 20 542 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 2.42e-11 70 28 10 239 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q2RS22 8.41e-13 72 28 4 211 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q5F8K2 8.5e-13 71 29 8 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q8Y7R4 8.57e-13 72 27 7 220 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8Y7R4 1.27e-07 57 25 5 189 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q6CYU2 8.66e-13 72 30 4 186 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q58283 8.69e-13 72 24 5 231 3 MJ0873 Uncharacterized ABC transporter ATP-binding protein MJ0873 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8GDV4 8.85e-13 72 26 6 219 3 pstB Phosphate import ATP-binding protein PstB (Fragment) Heliobacterium mobile
P72477 8.98e-13 72 28 4 176 3 abcX Putative ABC transporter ATP-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P72477 0.000508 45 25 8 202 3 abcX Putative ABC transporter ATP-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q63TW1 9.37e-13 73 32 5 169 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain K96243)
Q5WBL0 9.63e-13 71 29 6 205 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q5PBX2 1.01e-12 71 31 7 180 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Anaplasma marginale (strain St. Maries)
Q5PBX2 0.000372 45 24 5 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Anaplasma marginale (strain St. Maries)
Q3JSR6 1.02e-12 73 32 5 169 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain 1710b)
Q0S6U9 1.02e-12 71 31 5 170 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Rhodococcus jostii (strain RHA1)
Q720M2 1.03e-12 72 27 7 220 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q720M2 1.36e-07 56 25 5 189 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q13LD8 1.06e-12 73 27 7 206 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q13LD8 0.000829 45 20 4 207 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q8Y4L8 1.07e-12 73 26 7 226 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8Y4L8 0.000112 48 25 9 208 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q5HQ70 1.13e-12 73 26 5 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1J0N0 1.15e-12 71 26 8 223 3 pstB Phosphate import ATP-binding protein PstB Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q2JMJ0 1.16e-12 72 27 8 224 3 pstB1 Phosphate import ATP-binding protein PstB 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q0TJC1 1.18e-12 71 32 5 186 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJC1 0.000121 47 26 7 189 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q73YZ5 1.19e-12 71 34 7 176 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QFE1 1.19e-12 71 34 7 176 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium avium (strain 104)
Q62K56 1.22e-12 72 32 5 169 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia mallei (strain ATCC 23344)
Q87R20 1.23e-12 71 28 5 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87R20 9.16e-06 50 28 8 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q02QT1 1.26e-12 72 31 8 204 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6D5H7 1.28e-12 72 25 5 213 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D5H7 6.35e-05 48 27 9 207 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q57QD7 1.28e-12 71 30 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
Q57QD7 8.46e-05 47 25 5 182 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
A0ALT7 1.31e-12 72 31 4 154 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q39LW7 1.34e-12 72 30 9 247 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q3IQI3 1.34e-12 72 31 4 179 3 pstB2 Phosphate import ATP-binding protein PstB 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q0HVQ0 1.36e-12 70 27 4 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-7)
P39456 1.36e-12 71 28 7 210 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q325U1 1.37e-12 72 28 6 210 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q325U1 3.27e-05 50 21 7 206 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q12BB2 1.39e-12 71 28 9 208 3 pstB Phosphate import ATP-binding protein PstB Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q12BB2 1.79e-06 53 25 5 211 3 pstB Phosphate import ATP-binding protein PstB Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q4L5B3 1.41e-12 72 25 5 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q0HJG0 1.41e-12 70 27 4 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-4)
Q2IYS5 1.43e-12 72 29 7 207 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q82CD3 1.48e-12 71 33 7 181 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q4K441 1.49e-12 71 33 6 174 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5QU46 1.51e-12 70 30 7 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q5QU46 1.1e-05 50 26 7 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9CKL2 1.54e-12 73 22 23 566 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5WDP1 1.66e-12 72 26 6 231 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q9KLQ5 1.67e-12 72 33 6 166 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q88RL1 1.69e-12 71 27 7 238 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88RL1 1.36e-08 59 24 6 212 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8CPA1 1.7e-12 72 25 11 247 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q492R2 1.7e-12 70 29 6 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Blochmanniella pennsylvanica (strain BPEN)
Q492R2 4.89e-07 54 25 5 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Blochmanniella pennsylvanica (strain BPEN)
Q63SP4 1.71e-12 71 30 9 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia pseudomallei (strain K96243)
Q63SP4 1.93e-06 53 25 7 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia pseudomallei (strain K96243)
Q62J04 1.71e-12 71 30 9 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia mallei (strain ATCC 23344)
Q62J04 1.93e-06 53 25 7 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia mallei (strain ATCC 23344)
Q44613 1.76e-12 70 31 5 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q44613 1.84e-05 49 26 5 184 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q5PCG9 1.77e-12 72 28 4 190 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P61482 1.83e-12 70 30 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61482 9.02e-05 47 25 5 182 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61481 1.83e-12 70 30 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhi
P61481 9.02e-05 47 25 5 182 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhi
Q5PGR6 1.83e-12 70 30 7 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGR6 9.02e-05 47 25 5 182 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
O32188 1.86e-12 71 28 4 169 1 yusV Probable siderophore transport system ATP-binding protein YusV Bacillus subtilis (strain 168)
Q9CM80 1.91e-12 72 29 3 167 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
Q2JGF5 1.92e-12 72 31 5 172 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q6F0V4 1.97e-12 72 28 6 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q6F0V4 0.000372 46 25 8 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
P44531 1.98e-12 72 29 3 167 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57213 2e-12 69 36 5 148 3 HI_1474 Uncharacterized ABC transporter ATP-binding protein HI_1474 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q18AM3 2.03e-12 72 27 4 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q2W4W1 2.04e-12 71 33 8 199 3 znuC Zinc import ATP-binding protein ZnuC Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2W4W1 7.75e-12 69 29 6 197 3 znuC Zinc import ATP-binding protein ZnuC Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P0AAI1 2.07e-12 70 32 5 186 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain K12)
P0AAI2 2.07e-12 70 32 5 186 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O157:H7
Q32JQ8 2.08e-12 72 28 5 200 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q32JQ8 3.05e-05 50 21 6 203 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q8YCG3 2.11e-12 72 29 6 203 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q92CK1 2.16e-12 71 29 8 220 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q92CK1 4.45e-07 55 26 6 189 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5HPF5 2.18e-12 71 25 11 247 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7NTU0 2.21e-12 70 30 6 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q88CL2 2.29e-12 72 28 5 198 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88CL2 4.65e-06 52 22 7 263 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q04FM1 2.31e-12 71 28 2 159 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q04FM1 3.34e-05 49 26 6 194 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q6FFZ1 2.31e-12 71 34 5 171 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P15031 2.32e-12 70 32 3 173 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
Q8TUR7 2.35e-12 70 26 6 207 3 pstB Phosphate import ATP-binding protein PstB Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q03ZQ0 2.36e-12 72 24 10 309 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q03ZQ0 0.000603 46 25 11 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q7N0N3 2.37e-12 70 26 6 202 3 plu3849 Putative ABC transporter ATP-binding protein plu3849 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N0N3 1.11e-05 50 24 5 179 3 plu3849 Putative ABC transporter ATP-binding protein plu3849 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q97T09 2.38e-12 72 28 7 214 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97T09 0.000416 46 25 10 251 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8RCU0 2.41e-12 70 24 5 225 3 pstB1 Phosphate import ATP-binding protein PstB 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q0RT43 2.47e-12 70 30 4 168 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q2L219 2.52e-12 70 29 6 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella avium (strain 197N)
Q2L219 6.86e-06 51 28 7 193 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella avium (strain 197N)
Q93DA2 2.53e-12 72 27 7 219 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93DA2 0.000399 46 25 8 208 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q07LU3 2.62e-12 70 30 4 176 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q07LU3 2.44e-08 58 27 9 216 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q8EPK1 2.62e-12 72 27 6 215 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8EPK1 1.52e-05 50 24 6 203 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q89ER4 2.69e-12 70 34 7 179 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9MUN1 2.72e-12 72 31 6 203 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q3Z3I7 2.77e-12 70 32 5 186 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Shigella sonnei (strain Ss046)
P35116 2.79e-12 70 27 8 250 3 nocP Nopaline permease ATP-binding protein P Agrobacterium fabrum (strain C58 / ATCC 33970)
P72297 2.81e-12 70 31 5 172 3 occP Octopine permease ATP-binding protein P Rhizobium meliloti
Q8NR42 2.82e-12 70 36 6 173 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q47YG8 2.86e-12 70 28 3 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q92P76 2.88e-12 71 31 3 182 3 znuC Zinc import ATP-binding protein ZnuC Rhizobium meliloti (strain 1021)
Q92P76 5.37e-08 58 31 4 163 3 znuC Zinc import ATP-binding protein ZnuC Rhizobium meliloti (strain 1021)
O83078 3e-12 70 34 3 152 3 TP_0035 Probable metal transport system ATP-binding protein TP_0035 Treponema pallidum (strain Nichols)
Q8F6L8 3.01e-12 70 26 7 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q8F6L8 0.00033 46 24 6 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q65UG3 3.02e-12 70 31 4 224 3 znuC Zinc import ATP-binding protein ZnuC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65UG3 6.94e-06 51 29 5 184 3 znuC Zinc import ATP-binding protein ZnuC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q2JTU3 3.03e-12 70 24 10 253 3 pstB2 Phosphate import ATP-binding protein PstB 2 Synechococcus sp. (strain JA-3-3Ab)
Q2SVN0 3.04e-12 71 30 5 174 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q64Z80 3.04e-12 69 29 7 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides fragilis (strain YCH46)
Q1IKM7 3.09e-12 69 32 5 156 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Koribacter versatilis (strain Ellin345)
Q62L74 3.12e-12 70 28 8 213 3 pstB Phosphate import ATP-binding protein PstB Burkholderia mallei (strain ATCC 23344)
Q62L74 0.000192 47 23 6 211 3 pstB Phosphate import ATP-binding protein PstB Burkholderia mallei (strain ATCC 23344)
Q8ENU2 3.13e-12 71 28 5 213 3 metN2 Methionine import ATP-binding protein MetN 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ENU2 0.000521 46 23 12 277 3 metN2 Methionine import ATP-binding protein MetN 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8P8V9 3.14e-12 70 31 7 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UV71 3.14e-12 70 31 7 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas campestris pv. campestris (strain 8004)
Q8T664 3.17e-12 72 31 6 187 3 abcH2 ABC transporter H family member 2 Dictyostelium discoideum
Q72PP0 3.19e-12 70 26 7 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q72PP0 0.00041 45 24 6 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q5LI72 3.22e-12 69 29 7 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q4QK92 3.24e-12 70 27 10 218 3 pstB Phosphate import ATP-binding protein PstB Haemophilus influenzae (strain 86-028NP)
Q4QK92 0.000331 46 23 6 213 3 pstB Phosphate import ATP-binding protein PstB Haemophilus influenzae (strain 86-028NP)
Q07LY2 3.24e-12 70 31 3 176 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisA53)
Q20ZP0 3.3e-12 70 31 4 182 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisB18)
Q043Y8 3.31e-12 71 26 7 252 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q6YRJ4 3.45e-12 72 29 7 212 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q6D3Q6 3.47e-12 71 28 5 195 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q60AI1 3.53e-12 72 30 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0TLD2 3.55e-12 71 28 5 200 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TLD2 3.51e-05 50 21 7 206 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q6N6K5 3.56e-12 70 31 8 196 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2SUW7 3.57e-12 70 29 8 202 3 pstB Phosphate import ATP-binding protein PstB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2SUW7 0.000212 47 23 6 211 3 pstB Phosphate import ATP-binding protein PstB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05995
Feature type CDS
Gene -
Product ABC-F family ATP-binding cassette domain-containing protein
Location 1314187 - 1315929 (strand: -1)
Length 1743 (nucleotides) / 580 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_690
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0488 General function prediction only (R) R ATPase components of ABC transporters with duplicated ATPase domains

Protein Sequence

MSTLLSTQNLSFHNNHGILLSNISLALTKGEKIGLIGYNGCGKSTLLKLLSHQLIPTDGSITIANQVIMAYVEQQLPSELQSMRLIDAVLHKLPEELRISESWRSELLLSEMGFKTNEINLLVSQLSGGQHTRLLLARALILQPDLLLLDEPSNHLDLPTILWLETFLTQWRGSFILVSHDNRLLDKVTNCTWIIRDKTLSVFRLPCSQARQEQEAQDISAQHRCDAQQKEIDRIAQSAKQLAIWGKVYDNESLSRKAKQMEKQIVRLKDEQVDVTEGNQWTLQLSGTILRADRLLELHQLSVIPAPDAPILYTIDNQRIKSGDRVAIVGANGTGKSSLLKMIWSSFHGSTTSTENVIRLHPRVELGYYDQSLAQLNDNDTLADALKPFAPLLDEQRKMALINAGFVYSRHNQQVKSLSGGERARLLFIGLSLAKYSLLMLDEPTNHLDMEGKQALAEQIQQFSGGILLVSHDRELIEKSCNRFWYIHNGILSEHHDIETIYQLISQQDMSLVSNEQNGHHAPSVEIVKHHNEDELLMKLIALEDKLNADLARKSAHQKPILQAQWQAEIEILKQQLDLA

Flanking regions ( +/- flanking 50bp)

ATCGCGTGATATTACCCAAAGCATTTTTATGCTTAAAAAATGAGTAAGCTATGAGCACATTATTATCTACACAAAATCTCTCTTTTCATAATAATCACGGTATATTGCTGAGTAATATTTCTTTGGCCCTCACTAAAGGTGAGAAAATTGGTTTAATTGGCTACAACGGTTGTGGAAAAAGTACACTATTAAAACTTTTATCACACCAATTAATACCAACAGATGGCTCTATTACTATCGCCAATCAAGTCATTATGGCTTATGTCGAACAACAGTTACCAAGTGAGCTACAGTCAATGCGTCTCATTGATGCGGTTCTTCATAAATTACCTGAAGAGCTACGCATATCTGAAAGTTGGCGCAGTGAATTATTATTAAGTGAAATGGGATTTAAAACCAATGAAATCAATCTATTAGTCTCACAATTAAGTGGTGGTCAACATACTCGTTTATTACTTGCGAGAGCATTGATTTTGCAACCAGACTTACTGCTATTAGATGAGCCAAGTAACCACTTAGATCTACCGACTATCTTGTGGTTAGAAACATTTTTAACACAGTGGCGAGGAAGTTTTATTCTGGTTTCACATGACAATAGGTTGTTAGATAAAGTGACCAATTGTACGTGGATCATTCGTGATAAAACCCTATCTGTTTTTCGCTTGCCCTGCTCTCAGGCAAGACAAGAGCAAGAAGCACAAGATATCAGTGCGCAACATCGTTGTGATGCACAACAAAAAGAGATAGATCGTATTGCACAAAGTGCGAAGCAATTGGCCATCTGGGGAAAAGTGTATGATAACGAAAGTTTGTCACGTAAAGCCAAACAAATGGAAAAACAAATTGTTCGTTTAAAAGACGAACAAGTCGATGTAACAGAAGGCAATCAATGGACGTTACAGTTATCAGGAACAATATTACGGGCAGATAGATTGCTTGAGCTGCATCAGCTTTCAGTGATCCCTGCGCCAGATGCACCGATTTTATATACCATCGATAATCAACGGATCAAAAGTGGTGATCGAGTCGCTATTGTTGGTGCTAATGGGACAGGTAAGTCATCATTATTAAAAATGATTTGGTCATCATTTCATGGTTCAACCACATCAACAGAAAATGTGATCAGGCTGCATCCCAGAGTTGAGTTAGGTTATTACGATCAAAGTCTCGCACAACTTAATGATAATGATACCCTTGCCGATGCACTAAAGCCCTTTGCACCGCTATTAGATGAGCAAAGGAAAATGGCATTAATAAATGCAGGTTTTGTTTATTCTCGCCATAATCAGCAAGTAAAGTCATTAAGTGGTGGTGAACGAGCTCGTTTACTTTTTATTGGTCTCAGTTTGGCAAAATATTCATTATTAATGCTAGATGAACCAACAAACCATCTTGATATGGAAGGTAAACAGGCATTAGCTGAGCAAATTCAACAATTTTCAGGGGGAATTTTACTCGTCAGCCATGATAGAGAATTGATAGAGAAAAGCTGTAATCGTTTTTGGTATATTCACAATGGTATTCTTAGCGAACATCATGATATTGAAACAATTTATCAGCTTATTTCTCAACAAGATATGTCATTGGTCTCTAATGAGCAAAATGGCCATCATGCTCCATCTGTTGAAATAGTAAAACATCATAATGAAGATGAATTGCTAATGAAATTGATAGCACTTGAAGATAAATTGAATGCTGATTTAGCAAGAAAATCTGCTCATCAAAAGCCTATATTACAGGCTCAATGGCAAGCAGAAATAGAGATCTTAAAGCAGCAACTTGATTTAGCTTAATTTTTCTAACGATTACCCTATTGATTTTAAGTTATAATACAAAGCGGAGG