Homologs in group_1617

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10665 FBDBKF_10665 28.3 Morganella morganii S1 alkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase
EHELCC_15000 EHELCC_15000 28.3 Morganella morganii S2 alkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase
NLDBIP_14830 NLDBIP_14830 28.3 Morganella morganii S4 alkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase
LHKJJB_14515 LHKJJB_14515 28.3 Morganella morganii S3 alkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase
HKOGLL_13135 HKOGLL_13135 28.3 Morganella morganii S5 alkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase
F4V73_RS14375 F4V73_RS14375 28.8 Morganella psychrotolerans - DNA-3-methyladenine glycosylase 2

Distribution of the homologs in the orthogroup group_1617

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1617

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O31544 1.69e-23 97 32 4 187 3 yfjP Putative DNA-3-methyladenine glycosylase YfjP Bacillus subtilis (strain 168)
Q92383 5.28e-20 87 29 5 203 1 mag1 DNA-3-methyladenine glycosylase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O94468 2.92e-18 82 26 6 206 1 mag2 Alkylbase DNA glycosidase-like protein mag2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P22134 2.46e-16 78 28 5 203 1 MAG1 DNA-3-methyladenine glycosylase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P37878 2.83e-12 67 29 5 173 1 alkA DNA-3-methyladenine glycosylase Bacillus subtilis (strain 168)
P04395 2.87e-08 55 25 5 178 1 alkA DNA-3-methyladenine glycosylase 2 Escherichia coli (strain K12)
P9WJW3 7.07e-06 49 25 5 192 1 alkA Probable bifunctional transcriptional activator/DNA repair enzyme AlkA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJW2 7.07e-06 49 25 5 192 3 alkA Probable bifunctional transcriptional activator/DNA repair enzyme AlkA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05980
Feature type CDS
Gene -
Product DNA-3-methyladenine glycosylase
Location 1312164 - 1312775 (strand: 1)
Length 612 (nucleotides) / 203 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1617
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00730 HhH-GPD superfamily base excision DNA repair protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0122 Replication, recombination and repair (L) L 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01247 DNA-3-methyladenine glycosylase II [EC:3.2.2.21] Base excision repair -

Protein Sequence

MYFQYGEKEISFLKQKDKRLAAVMERIGEIKRPLTPDLFTALIKNIIEQQISVAAATTVQQRLLTLCDGIYTPVHIASLSVQDIQQCGMTMRKAGYIKGIADSVINHTLDLDQIPAMSDKAVINTLIKLKGIGIWTAEMLLISSLNRPDILSWGDLAIQRGIMRLYRHQSLDRTRFERYRKRYSPYGSTASLYLWALSKESAD

Flanking regions ( +/- flanking 50bp)

AGTGCACGCTATACTGTTTTAATAAATACCTTAATTAGTAGCGTGATTTTATGTATTTTCAGTATGGTGAAAAAGAGATCTCTTTTTTAAAACAAAAAGATAAGCGTCTAGCCGCGGTGATGGAAAGAATAGGGGAAATTAAACGTCCACTTACCCCTGATTTATTTACAGCATTAATTAAAAATATTATTGAACAGCAAATTTCTGTTGCGGCTGCCACCACGGTTCAGCAACGTTTACTTACCCTATGTGATGGTATTTATACTCCTGTACATATTGCTAGTTTATCAGTGCAAGATATTCAGCAATGTGGAATGACAATGCGTAAAGCCGGTTATATTAAAGGTATCGCAGACTCAGTTATAAATCATACGTTAGATTTAGACCAAATCCCCGCTATGTCTGATAAAGCGGTGATCAATACCCTAATAAAATTAAAAGGTATTGGCATTTGGACCGCTGAAATGTTATTAATTTCATCACTTAATCGTCCTGATATTTTAAGTTGGGGGGATTTAGCTATTCAGCGTGGTATCATGCGTTTATATCGCCATCAAAGCTTAGATAGAACACGCTTTGAACGCTATCGTAAACGTTATTCTCCTTATGGTTCAACGGCTTCACTCTATTTATGGGCATTATCTAAAGAAAGCGCAGACTAAAGAGCAATAATCGGAGTGATCTAAATAGAAGTTTATTGATAATGGACTTC