Homologs in group_2519

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01525 FBDBKF_01525 28.5 Morganella morganii S1 dapA 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase
EHELCC_00020 EHELCC_00020 28.5 Morganella morganii S2 dapA 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase
NLDBIP_03440 NLDBIP_03440 28.5 Morganella morganii S4 dapA 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase
LHKJJB_04955 LHKJJB_04955 28.5 Morganella morganii S3 dapA 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase
HKOGLL_02090 HKOGLL_02090 28.5 Morganella morganii S5 dapA 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase

Distribution of the homologs in the orthogroup group_2519

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2519

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9HS19 1.21e-44 157 32 2 289 3 dapAL Uncharacterized DapA-like lyase VNG_0444G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R3D6 1.21e-44 157 32 2 289 3 dapAL Uncharacterized DapA-like lyase OE_1665R Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
B5EGX4 4.42e-42 149 34 4 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C6E9Q9 4.52e-42 149 34 4 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Geobacter sp. (strain M21)
Q9KC32 5.03e-41 147 33 3 281 3 dapA1 4-hydroxy-tetrahydrodipicolinate synthase 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q74GT6 1.69e-40 145 34 6 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q39Z67 2.53e-40 145 33 4 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B9M380 4.84e-40 144 32 4 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B8GKG7 6.67e-40 144 31 5 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q04796 1.18e-39 143 31 3 290 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bacillus subtilis (strain 168)
Q3A1U7 1.73e-39 143 32 3 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q2FNR0 2.1e-39 142 28 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q83CA6 3.89e-39 142 32 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NDT3 3.89e-39 142 32 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFS0 3.89e-39 142 32 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Coxiella burnetii (strain Dugway 5J108-111)
Q8TUZ4 4.97e-39 142 31 4 298 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q07607 8.34e-39 141 33 4 294 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rhizobium meliloti
A5GD89 9.61e-39 141 32 6 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Geotalea uraniireducens (strain Rf4)
Q57695 2.24e-38 140 31 4 293 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P39359 2.46e-38 140 32 3 241 1 yjhH Probable 2-dehydro-3-deoxy-D-pentonate aldolase YjhH Escherichia coli (strain K12)
B4RCW4 3.61e-38 139 32 6 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Phenylobacterium zucineum (strain HLK1)
A4FYQ3 6.79e-38 139 34 7 273 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q8RBI5 7.55e-38 139 30 4 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A9A656 8.48e-38 138 32 5 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
A5FZS7 1.35e-37 138 32 3 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidiphilium cryptum (strain JF-5)
O29352 2.95e-37 137 33 5 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A3DE17 3.75e-37 137 31 5 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B8DKU0 5.32e-37 136 31 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A6VJM9 5.93e-37 136 31 5 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
A7Z4U8 7.4e-37 136 31 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A3CVI7 1.05e-36 135 30 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
O67216 1.44e-36 135 30 3 287 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aquifex aeolicus (strain VF5)
A0B7E1 1.67e-36 135 31 4 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
O58577 2.12e-36 134 33 5 264 3 dapAL Uncharacterized DapA-like lyase PH0847 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P75682 3.13e-36 134 33 3 238 1 yagE Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE Escherichia coli (strain K12)
A5IM62 3.42e-36 134 30 5 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B9KY71 3.82e-36 134 32 4 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
B1GYN1 5.89e-36 134 30 4 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Endomicrobium trichonymphae
B1LBR1 8.12e-36 133 30 5 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermotoga sp. (strain RQ2)
B9K865 1.11e-35 133 30 6 298 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q9X1K9 1.31e-35 132 30 5 297 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B3EMS4 2.55e-35 132 29 6 298 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium phaeobacteroides (strain BS1)
B4U7D7 3.17e-35 132 29 2 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Hydrogenobaculum sp. (strain Y04AAS1)
Q8EQJ1 4.34e-35 131 30 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A0PZM3 4.83e-35 131 31 5 279 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Clostridium novyi (strain NT)
A6UVG7 7.18e-35 130 31 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q5FUW9 8.54e-35 130 30 3 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Gluconobacter oxydans (strain 621H)
A6US71 9.16e-35 130 29 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q6G091 9.24e-35 130 31 3 279 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bartonella quintana (strain Toulouse)
B0K4I3 1.17e-34 130 29 5 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermoanaerobacter sp. (strain X514)
B0KAL7 1.17e-34 130 29 5 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q8XJ56 1.48e-34 130 31 4 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Clostridium perfringens (strain 13 / Type A)
Q0SRS5 1.51e-34 130 30 4 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Clostridium perfringens (strain SM101 / Type A)
Q891S3 1.83e-34 130 29 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Clostridium tetani (strain Massachusetts / E88)
Q0TP55 2.45e-34 129 30 4 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8PXL7 2.89e-34 129 29 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q11JT7 4.37e-34 129 33 2 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chelativorans sp. (strain BNC1)
Q9KA91 4.55e-34 129 30 4 290 3 dapA2 4-hydroxy-tetrahydrodipicolinate synthase 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8THP1 5.16e-34 128 30 6 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B1I383 6.53e-34 128 32 6 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Desulforudis audaxviator (strain MP104C)
A5VPI5 7.02e-34 128 32 2 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YG60 7.02e-34 128 32 2 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57E96 7.02e-34 128 32 2 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Brucella abortus biovar 1 (strain 9-941)
Q46DC4 7.85e-34 128 28 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q310Q2 9.5e-34 128 30 3 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B5YKK4 1.16e-33 127 30 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
B3EH29 1.25e-33 127 30 5 298 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A1ATI8 1.47e-33 127 29 4 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q8U319 1.83e-33 127 33 6 265 3 dapAL Uncharacterized DapA-like lyase PF0657 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A1VCZ9 1.92e-33 127 31 4 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitratidesulfovibrio vulgaris (strain DP4)
Q72AX2 1.92e-33 127 31 4 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A0LEA7 2.04e-33 127 30 5 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
C0QT41 2.11e-33 127 30 4 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Persephonella marina (strain DSM 14350 / EX-H1)
A1US27 2.42e-33 127 32 2 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q8G1R0 3.08e-33 126 30 3 296 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Brucella suis biovar 1 (strain 1330)
Q2LTA1 4.3e-33 126 33 4 283 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Syntrophus aciditrophicus (strain SB)
A9HIW2 5.39e-33 126 27 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q8UGL3 5.97e-33 125 33 2 243 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0IE16 8.94e-33 125 32 4 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain CC9311)
B0JL91 1.13e-32 125 31 5 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
C4L2D2 1.26e-32 125 30 3 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B3E936 1.45e-32 124 30 4 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A0LZ30 1.61e-32 124 29 2 277 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A4VN86 2.03e-32 124 31 4 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Stutzerimonas stutzeri (strain A1501)
Q9A900 2.81e-32 124 31 4 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A8MF40 2.83e-32 124 29 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Alkaliphilus oremlandii (strain OhILAs)
Q9UZ94 2.84e-32 124 34 5 232 3 dapAL Uncharacterized DapA-like lyase PYRAB12600 Pyrococcus abyssi (strain GE5 / Orsay)
Q92BS0 2.96e-32 124 32 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q12ZG2 3.08e-32 124 30 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
B3QM33 4.19e-32 124 29 4 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q5V5D4 4.29e-32 124 28 4 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
A0AIN8 4.79e-32 123 31 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q4ZW75 9.86e-32 122 30 4 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudomonas syringae pv. syringae (strain B728a)
B8JAN5 1.03e-31 122 31 4 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q3ISQ0 1.05e-31 122 31 4 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q2IGX5 1.23e-31 122 31 4 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q72K27 1.32e-31 122 28 3 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B8DE74 1.41e-31 122 31 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria monocytogenes serotype 4a (strain HCC23)
Q71ZN5 1.48e-31 122 30 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria monocytogenes serotype 4b (strain F2365)
C1L2Z1 1.48e-31 122 30 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
B3PC19 1.51e-31 122 30 3 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Cellvibrio japonicus (strain Ueda107)
Q6LZP8 1.96e-31 121 30 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q97GI9 2.01e-31 122 29 4 285 3 dapA1 4-hydroxy-tetrahydrodipicolinate synthase 1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B9EBZ6 2.45e-31 121 30 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Macrococcus caseolyticus (strain JCSC5402)
A4XJU0 2.96e-31 121 29 6 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q48LD5 3.08e-31 121 30 4 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4J5V5 3.08e-31 121 29 3 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A9IRK3 3.28e-31 121 31 3 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q46ID7 4.44e-31 121 31 6 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain NATL2A)
Q5SJQ1 5.36e-31 120 28 3 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q8Y766 7.18e-31 120 30 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A1BE04 7.49e-31 120 29 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B4UHY1 8.22e-31 120 30 4 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaeromyxobacter sp. (strain K)
A4XSW1 8.3e-31 120 30 3 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudomonas mendocina (strain ymp)
A4SG05 8.57e-31 120 28 5 298 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q66H59 9.67e-31 120 32 9 283 2 Npl N-acetylneuraminate lyase Rattus norvegicus
A9BD97 1.02e-30 120 33 7 300 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain MIT 9211)
B0THT2 1.17e-30 120 32 6 300 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q0A5S1 1.22e-30 119 31 3 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C5CHX9 1.44e-30 119 27 5 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q6MDD9 1.47e-30 119 28 3 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Protochlamydia amoebophila (strain UWE25)
Q3APU0 1.55e-30 119 29 3 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium chlorochromatii (strain CaD3)
B2V6F1 1.57e-30 119 29 6 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sulfurihydrogenibium sp. (strain YO3AOP1)
Q9DCJ9 1.82e-30 120 31 9 283 1 Npl N-acetylneuraminate lyase Mus musculus
B6YU51 2.08e-30 119 29 8 298 3 dapAL Uncharacterized DapA-like lyase TON_0506 Thermococcus onnurineus (strain NA1)
Q5WUD4 2.48e-30 119 31 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Legionella pneumophila (strain Lens)
Q5ZT51 2.48e-30 119 31 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A0LDB5 2.76e-30 119 29 5 279 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q2NHW2 3.32e-30 119 27 3 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
A8ET60 3.61e-30 118 27 4 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aliarcobacter butzleri (strain RM4018)
B2RMB9 4.05e-30 118 28 5 277 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q3B2G4 4.49e-30 118 28 5 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A5ULF8 4.73e-30 118 29 4 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q92R55 4.94e-30 118 32 2 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rhizobium meliloti (strain 1021)
B0C142 5.2e-30 118 31 6 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acaryochloris marina (strain MBIC 11017)
A5IEB3 7.26e-30 117 31 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Legionella pneumophila (strain Corby)
B9MRD1 7.33e-30 117 29 5 281 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B4S5J5 8.13e-30 117 28 2 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q55513 8.29e-30 117 30 4 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6AR63 9.8e-30 117 30 8 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
C6BSH4 1.41e-29 117 29 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B7IF13 1.43e-29 117 30 5 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermosipho africanus (strain TCF52B)
A6LA57 1.47e-29 117 28 3 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A9NGC2 1.5e-29 117 29 6 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acholeplasma laidlawii (strain PG-8A)
Q2S3M1 1.54e-29 117 31 2 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salinibacter ruber (strain DSM 13855 / M31)
O86841 1.6e-29 117 30 4 289 3 dapA2 4-hydroxy-tetrahydrodipicolinate synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A4WNS1 2.03e-29 116 31 4 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q9BXD5 2.1e-29 117 31 8 283 1 NPL N-acetylneuraminate lyase Homo sapiens
Q8F132 2.43e-29 116 30 7 298 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72U22 2.43e-29 116 30 7 298 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A6LP58 2.48e-29 116 32 9 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q67P59 2.53e-29 116 28 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q1INQ6 2.63e-29 116 29 5 298 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Koribacter versatilis (strain Ellin345)
A5FE82 2.81e-29 116 28 3 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q9HJ17 3.08e-29 116 26 9 297 3 dapAL Uncharacterized DapA-like lyase Ta1157 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
A1WZ50 3.3e-29 116 31 4 277 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Halorhodospira halophila (strain DSM 244 / SL1)
Q2RJK7 3.42e-29 115 29 4 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2JQ67 3.46e-29 116 30 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain JA-2-3B'a(2-13))
A1W4S3 3.67e-29 115 30 3 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidovorax sp. (strain JS42)
B9MER6 3.67e-29 115 30 3 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidovorax ebreus (strain TPSY)
A7HX36 3.84e-29 115 33 4 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
C5BQD1 4.08e-29 115 29 3 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Teredinibacter turnerae (strain ATCC 39867 / T7901)
A0LV15 4.15e-29 116 31 7 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q3B8E8 4.48e-29 115 31 10 283 2 npl-a N-acetylneuraminate lyase A Xenopus laevis
Q3J869 4.72e-29 115 31 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5RDY1 4.91e-29 116 30 8 283 2 NPL N-acetylneuraminate lyase Pongo abelii
A7HJ56 4.97e-29 115 27 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
A2SIX7 5.99e-29 115 28 4 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q3YSK1 6.04e-29 115 28 4 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ehrlichia canis (strain Jake)
Q73VZ7 6.68e-29 115 27 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8KC06 7.21e-29 115 27 5 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q29RY9 1.03e-28 115 31 10 284 2 NPL N-acetylneuraminate lyase Bos taurus
A9KHY6 1.16e-28 114 28 3 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A6L5G7 2.12e-28 114 27 5 278 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A6H0M8 2.22e-28 114 27 2 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A5UG62 2.23e-28 114 29 5 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haemophilus influenzae (strain PittGG)
P9WP25 2.27e-28 114 27 3 287 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP24 2.27e-28 114 27 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U6A6 2.27e-28 114 27 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AFL5 2.27e-28 114 27 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KM94 2.27e-28 114 27 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P63946 2.27e-28 114 27 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B0SL58 2.43e-28 113 31 9 300 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SCT0 2.43e-28 113 31 9 300 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A5UAN5 2.6e-28 113 29 5 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haemophilus influenzae (strain PittEE)
A5D2Q5 2.96e-28 113 29 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B4SE03 3.31e-28 113 28 3 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A9FHA5 3.73e-28 113 30 4 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sorangium cellulosum (strain So ce56)
Q0BYG4 4.08e-28 113 33 4 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Hyphomonas neptunium (strain ATCC 15444)
C1F658 4.72e-28 113 28 7 300 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B1Y7F0 6.05e-28 112 28 4 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q5JGK8 6.06e-28 112 30 6 268 3 dapAL Uncharacterized DapA-like lyase TK1237 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9BEC7 6.1e-28 113 31 10 284 1 NPL N-acetylneuraminate lyase Sus scrofa
Q8DJK4 6.22e-28 112 30 5 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q0VRH4 7.67e-28 112 29 3 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B1JDB7 8.71e-28 112 29 3 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudomonas putida (strain W619)
P58207 1.3e-27 111 28 4 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
C0R176 1.62e-27 111 27 4 280 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
B5ELM5 1.62e-27 111 31 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J6C4 1.62e-27 111 31 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A1S0T1 1.67e-27 111 27 6 304 3 dapAL Uncharacterized DapA-like lyase Tpen_1666 Thermofilum pendens (strain DSM 2475 / Hrk 5)
A6Q2V4 1.93e-27 111 28 4 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitratiruptor sp. (strain SB155-2)
A7B555 1.97e-27 111 26 5 297 1 nanA N-acetylneuraminate lyase Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9)
Q9PPB4 2.02e-27 111 28 4 272 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5HUY6 2.13e-27 111 28 4 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter jejuni (strain RM1221)
A1VZF4 2.13e-27 111 28 4 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A2SQU8 2.15e-27 111 28 7 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Q2JWL7 2.18e-27 111 29 7 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain JA-3-3Ab)
Q836D1 2.43e-27 110 28 3 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Enterococcus faecalis (strain ATCC 700802 / V583)
B9KI57 2.5e-27 111 28 2 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaplasma marginale (strain Florida)
A8FLL9 2.7e-27 110 28 4 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q1QL43 3.43e-27 110 30 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A8H415 3.44e-27 110 29 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q5PB64 3.62e-27 110 28 2 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaplasma marginale (strain St. Maries)
Q6NYR8 4.17e-27 110 28 5 243 2 npl N-acetylneuraminate lyase Danio rerio
O69782 4.55e-27 110 30 6 296 2 dapAL Uncharacterized DapA-like lyase Rhizobium meliloti
B1VDC4 6.2e-27 110 29 5 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
B2G6M9 6.3e-27 110 29 3 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJ58 6.3e-27 110 29 3 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Limosilactobacillus reuteri (strain DSM 20016)
A7H443 7.11e-27 109 28 4 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A5GQ13 7.25e-27 109 30 6 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain RCC307)
B2IT87 7.61e-27 109 30 7 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q1MPX7 1.05e-26 109 29 7 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lawsonia intracellularis (strain PHE/MN1-00)
Q28WG2 1.08e-26 109 28 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Jannaschia sp. (strain CCS1)
Q8Y099 1.14e-26 109 26 3 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A0RP26 1.18e-26 109 28 4 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter fetus subsp. fetus (strain 82-40)
Q3B0T8 1.78e-26 108 32 5 278 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain CC9902)
Q15SZ4 2.05e-26 108 28 5 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A7GYB0 2.1e-26 108 27 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter curvus (strain 525.92)
B8CMS5 2.12e-26 108 30 4 277 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
B6YQ20 2.73e-26 108 29 5 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q8RQM8 2.73e-26 108 28 5 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q92WP0 3e-26 108 26 2 271 3 nanA N-acetylneuraminate lyase Rhizobium meliloti (strain 1021)
A7I0Y0 3.04e-26 108 26 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q4QNT3 3.97e-26 107 28 5 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haemophilus influenzae (strain 86-028NP)
A8AQB6 4.37e-26 107 30 7 258 3 nanA N-acetylneuraminate lyase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7H773 4.57e-26 107 29 4 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaeromyxobacter sp. (strain Fw109-5)
O26892 4.9e-26 107 28 4 268 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
F9VPG1 5.84e-26 107 28 7 298 1 kdgA 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q17WU7 6.03e-26 107 28 3 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter acinonychis (strain Sheeba)
B6JL09 8.04e-26 107 28 3 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain P12)
Q2YVB1 8.08e-26 107 28 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7MIL2 8.09e-26 107 27 5 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Vibrio vulnificus (strain YJ016)
Q5M905 8.11e-26 107 30 10 283 2 npl N-acetylneuraminate lyase Xenopus tropicalis
B9DP23 8.31e-26 107 29 9 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus carnosus (strain TM300)
Q1QTP6 8.49e-26 107 28 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8CP96 9.12e-26 106 29 7 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q082V3 9.8e-26 106 30 5 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella frigidimarina (strain NCIMB 400)
Q8DBB0 1.11e-25 106 27 5 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Vibrio vulnificus (strain CMCP6)
Q5MZT3 1.12e-25 106 29 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31M42 1.12e-25 106 29 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A8Z3X3 1.28e-25 106 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain USA300 / TCH1516)
A6QGU6 1.28e-25 106 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain Newman)
Q5HG25 1.28e-25 106 28 9 295 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain COL)
Q9EZ12 1.28e-25 106 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH43 1.28e-25 106 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain USA300)
Q6KZI8 1.31e-25 105 31 5 216 1 PTO1279 2-dehydro-3-deoxy-D-gluconate/2-dehydro-3-deoxy-phosphogluconate aldolase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q8EFT7 1.33e-25 106 30 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6GH13 1.52e-25 106 28 9 295 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain MRSA252)
B8HYL7 1.62e-25 106 30 5 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B5Z6I0 1.68e-25 106 28 3 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain G27)
Q7VFP9 1.73e-25 105 27 5 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q8NWS5 1.85e-25 105 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain MW2)
Q6G9G6 1.85e-25 105 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain MSSA476)
O25657 1.89e-25 106 28 3 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q8NYC7 2e-25 105 28 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain MW2)
A8YZD9 2e-25 105 28 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GCF6 2e-25 105 28 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain MSSA476)
Q6GK01 2e-25 105 28 10 298 1 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain MRSA252)
A6QDU7 2e-25 105 28 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain Newman)
Q5HJ53 2e-25 105 28 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain COL)
Q2G160 2e-25 105 28 10 298 1 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJU9 2e-25 105 28 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain USA300)
Q21HE7 2.41e-25 105 29 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5FKQ9 2.61e-25 105 28 3 281 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q0HU08 2.85e-25 105 29 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella sp. (strain MR-7)
A0KVS0 2.97e-25 105 29 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella sp. (strain ANA-3)
A5WHC3 3.2e-25 105 28 5 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Psychrobacter sp. (strain PRwf-1)
Q8YQY1 3.92e-25 105 28 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q0HHQ6 4.39e-25 105 29 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella sp. (strain MR-4)
B2USR7 4.79e-25 105 28 3 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain Shi470)
A1AVV3 4.79e-25 105 28 3 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ruthia magnifica subsp. Calyptogena magnifica
P43797 4.87e-25 105 29 5 280 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q21WN2 5.19e-25 104 28 3 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2YXX4 5.33e-25 104 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9X9W0 5.51e-25 105 28 5 296 3 dapA1 4-hydroxy-tetrahydrodipicolinate synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9ZM13 6.01e-25 104 28 3 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain J99 / ATCC 700824)
A8YUT3 6.05e-25 105 29 5 283 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lactobacillus helveticus (strain DPC 4571)
A1RKF2 6.23e-25 104 29 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella sp. (strain W3-18-1)
A4Y644 6.23e-25 104 29 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q7M7L6 6.41e-25 104 27 4 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q6NGP4 6.64e-25 104 26 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A8LKQ5 6.81e-25 104 29 4 273 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B2A3B2 8.03e-25 104 28 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q7V990 8.72e-25 104 32 3 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain MIT 9313)
A9L573 9.1e-25 103 29 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella baltica (strain OS195)
A6WPI6 9.1e-25 103 29 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella baltica (strain OS185)
A3D5N2 9.1e-25 103 29 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E724 9.1e-25 103 29 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella baltica (strain OS223)
Q1CU72 1.01e-24 103 28 3 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain HPAG1)
Q2GG09 1.04e-24 103 27 4 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q11VI2 1.13e-24 103 25 3 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q9CBW4 1.27e-24 103 26 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycobacterium leprae (strain TN)
B8ZRR3 1.27e-24 103 26 3 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycobacterium leprae (strain Br4923)
Q60B13 1.38e-24 103 28 4 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5F849 1.51e-24 103 26 3 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A2C5R9 1.7e-24 103 32 3 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain MIT 9303)
Q4L6A0 1.7e-24 103 28 7 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus haemolyticus (strain JCSC1435)
Q9I4W3 1.76e-24 103 29 3 289 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8ZLQ6 1.99e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TWJ0 1.99e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella schwarzengrund (strain CVM19633)
A1U1A6 2.01e-24 103 30 4 273 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B5F7J9 2.03e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella agona (strain SL483)
C0PZN4 2.05e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella paratyphi C (strain RKS4594)
A9N833 2.05e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T750 2.05e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella newport (strain SL254)
B4TJR3 2.05e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella heidelberg (strain SL476)
B5RET7 2.05e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0L2 2.05e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella enteritidis PT4 (strain P125109)
B5FIR8 2.05e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella dublin (strain CT_02021853)
Q57JC9 2.05e-24 103 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella choleraesuis (strain SC-B67)
B0UTI7 2.4e-24 102 25 3 292 3 nanA N-acetylneuraminate lyase Histophilus somni (strain 2336)
Q0I2T8 2.4e-24 102 25 3 292 3 nanA N-acetylneuraminate lyase Histophilus somni (strain 129Pt)
P99123 2.49e-24 102 27 10 298 1 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain N315)
P63949 2.49e-24 102 27 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IPI2 2.49e-24 102 27 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain JH9)
A6TY99 2.49e-24 102 27 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain JH1)
A7WXZ2 2.49e-24 102 27 10 298 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A5GHT4 2.55e-24 103 31 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain WH7803)
Q5ZKD4 2.77e-24 103 32 9 284 2 NPL N-acetylneuraminate lyase Gallus gallus
B6IN13 2.86e-24 102 29 4 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rhodospirillum centenum (strain ATCC 51521 / SW)
A6Q8F8 3.02e-24 102 27 5 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sulfurovum sp. (strain NBC37-1)
Q4L9T4 3.02e-24 102 26 5 275 3 nanA N-acetylneuraminate lyase Staphylococcus haemolyticus (strain JCSC1435)
Q8Z3F0 3.31e-24 102 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella typhi
B5BGP5 3.31e-24 102 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella paratyphi A (strain AKU_12601)
Q5PLE9 3.31e-24 102 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q07M65 3.72e-24 102 29 5 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rhodopseudomonas palustris (strain BisA53)
Q7UZK9 3.76e-24 102 30 4 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q9RH76 3.99e-24 102 29 3 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P63948 5.33e-24 102 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain N315)
P63947 5.33e-24 102 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISS7 5.33e-24 102 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain JH9)
A6U1L6 5.33e-24 102 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain JH1)
A7X271 5.33e-24 102 28 9 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9JZR4 5.67e-24 102 27 4 284 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q4JV64 5.93e-24 102 26 6 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Corynebacterium jeikeium (strain K411)
B1LGJ0 6.11e-24 102 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli (strain SMS-3-5 / SECEC)
B7NKT6 6.11e-24 102 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q053P3 6.43e-24 102 30 8 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q5HPE7 6.63e-24 101 28 7 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A4G724 6.67e-24 101 26 4 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Herminiimonas arsenicoxydans
Q12NF7 6.99e-24 101 28 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q04U80 7.12e-24 101 30 8 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B1YJ39 7.83e-24 101 28 4 270 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B7LRJ3 8.22e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q3YX23 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Shigella sonnei (strain Ss046)
P0A6L6 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Shigella flexneri
Q0T065 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Shigella flexneri serotype 5b (strain 8401)
Q32BB4 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Shigella dysenteriae serotype 1 (strain Sd197)
B2U1V9 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R6B5 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli (strain UTI89 / UPEC)
P0A6L4 9.39e-24 101 30 7 256 1 nanA N-acetylneuraminate lyase Escherichia coli (strain K12)
B1IQQ4 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TCP1 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGB9 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli O1:K1 / APEC
A8A535 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli O9:H4 (strain HS)
B1XHJ8 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli (strain K12 / DH10B)
C4ZSW3 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0T7 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli O8 (strain IAI1)
B5YSV2 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6L5 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli O157:H7
B7LHT3 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli (strain 55989 / EAEC)
B7MBY7 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJV8 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSB8 9.39e-24 101 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8FD58 9.39e-24 101 30 7 256 3 nanA1 N-acetylneuraminate lyase 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZDQ5 1.11e-23 101 27 4 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter concisus (strain 13826)
Q0SWI8 1.26e-23 100 27 6 285 3 nanA N-acetylneuraminate lyase Clostridium perfringens (strain SM101 / Type A)
Q317Y9 1.28e-23 101 30 4 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain MIT 9312)
Q5XGL8 1.34e-23 100 29 7 242 2 npl-b N-acetylneuraminate lyase B Xenopus laevis
B6I1U3 1.5e-23 100 30 7 256 3 nanA N-acetylneuraminate lyase Escherichia coli (strain SE11)
Q6G468 1.68e-23 100 28 2 287 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q7VXZ8 1.93e-23 100 27 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A9MNY6 2e-23 100 29 7 258 3 nanA N-acetylneuraminate lyase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q9CKB0 2.48e-23 100 26 5 289 1 nanA N-acetylneuraminate lyase Pasteurella multocida (strain Pm70)
Q5E3I3 2.61e-23 100 27 6 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4TMN2 2.66e-23 100 27 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Yersinia pestis (strain Pestoides F)
Q8ZCD0 2.66e-23 100 27 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Yersinia pestis
A7FG49 2.66e-23 100 27 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q9S4K9 3.06e-23 99 27 6 285 1 nanA N-acetylneuraminate lyase Clostridium perfringens (strain 13 / Type A)
Q0TUP8 3.06e-23 99 27 6 285 3 nanA N-acetylneuraminate lyase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q89AY0 3.19e-23 100 28 6 300 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B5FGX4 3.54e-23 99 27 6 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aliivibrio fischeri (strain MJ11)
Q0AI27 3.63e-23 99 30 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q31W94 3.79e-23 99 29 7 256 3 nanA N-acetylneuraminate lyase Shigella boydii serotype 4 (strain Sb227)
Q5LMK7 3.84e-23 99 30 4 269 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A6TCA1 4.54e-23 99 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q668F7 4.67e-23 99 27 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q04FS1 4.88e-23 99 29 5 270 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8P9V6 6.01e-23 99 27 4 276 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q49XJ7 6.42e-23 99 27 6 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9JUU9 6.78e-23 99 26 3 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M4C8 8.14e-23 99 26 3 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Neisseria meningitidis serogroup C (strain 053442)
B3GZ05 8.37e-23 99 25 3 274 3 nanA N-acetylneuraminate lyase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N352 8.37e-23 99 25 3 274 3 nanA N-acetylneuraminate lyase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BSI2 9.65e-23 98 25 3 274 3 nanA N-acetylneuraminate lyase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B9KFX0 1e-22 98 26 4 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
B2FL61 1.13e-22 98 27 4 276 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Stenotrophomonas maltophilia (strain K279a)
A4WF38 1.15e-22 98 28 6 254 3 nanA N-acetylneuraminate lyase Enterobacter sp. (strain 638)
P44539 1.29e-22 98 24 3 290 1 nanA N-acetylneuraminate lyase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A8G7F8 1.32e-22 98 30 5 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain MIT 9215)
Q9CF61 1.51e-22 98 27 5 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lactococcus lactis subsp. lactis (strain IL1403)
P19808 1.6e-22 98 28 5 295 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q02XU7 1.61e-22 98 27 5 270 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lactococcus lactis subsp. cremoris (strain SK11)
A1KTJ9 1.82e-22 97 26 3 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q16BK4 2.03e-22 97 31 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B8GN57 2.1e-22 97 28 3 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q2Y8S8 2.24e-22 97 30 4 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
P49423 2.44e-22 97 32 7 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q6MRM9 2.45e-22 97 27 7 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B1LTD9 2.9e-22 97 31 6 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q97D80 3.14e-22 97 27 8 293 3 dapA2 4-hydroxy-tetrahydrodipicolinate synthase 2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B4SRX7 3.55e-22 97 27 4 276 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Stenotrophomonas maltophilia (strain R551-3)
P59407 3.65e-22 97 26 4 273 1 nanA N-acetylneuraminate lyase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q3ZXV3 4.21e-22 97 27 3 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Dehalococcoides mccartyi (strain CBDB1)
A2RJL6 4.39e-22 97 27 5 270 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lactococcus lactis subsp. cremoris (strain MG1363)
Q8KA24 4.77e-22 96 26 4 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B6JGA4 5.62e-22 96 28 5 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q8ZN71 5.77e-22 96 29 5 271 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TR62 5.77e-22 96 29 5 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella schwarzengrund (strain CVM19633)
B5BB16 5.77e-22 96 29 5 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PLS1 5.77e-22 96 29 5 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z4R8 5.95e-22 96 29 5 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella typhi
A5F699 6.07e-22 96 26 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A9MHQ2 6.32e-22 96 29 5 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A5FQT5 6.39e-22 96 27 3 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A1JL07 7.71e-22 96 27 5 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q30R77 7.9e-22 96 28 5 278 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B6EJT2 8.11e-22 96 28 5 278 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aliivibrio salmonicida (strain LFI1238)
B2VE56 8.92e-22 95 28 4 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A5EXM4 9.19e-22 95 28 6 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Dichelobacter nodosus (strain VCS1703A)
Q1WU86 9.46e-22 95 27 3 280 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ligilactobacillus salivarius (strain UCC118)
Q5QU03 1.2e-21 95 27 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q32D87 1.21e-21 95 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella dysenteriae serotype 1 (strain Sd197)
C3LPG2 1.32e-21 95 26 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KQ47 1.32e-21 95 26 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3Z7V3 1.41e-21 95 26 3 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q2NS74 1.48e-21 95 27 4 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sodalis glossinidius (strain morsitans)
A2BZ39 1.6e-21 95 30 4 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain MIT 9515)
B0UVZ8 1.7e-21 95 29 3 231 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Histophilus somni (strain 2336)
Q8FDU7 1.71e-21 95 26 5 267 3 nanA2 N-acetylneuraminate lyase 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B9DS79 1.8e-21 95 26 5 273 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B3QUT2 1.82e-21 95 28 4 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q82SD7 1.83e-21 95 30 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A6W828 1.9e-21 95 30 6 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
C3PH04 2.7e-21 94 28 5 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q3YZ74 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella sonnei (strain Ss046)
Q31Y13 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella boydii serotype 4 (strain Sb227)
B2TXQ4 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LNC8 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I548 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli (strain SE11)
P63943 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A2X1 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O9:H4 (strain HS)
B7MYB7 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O81 (strain ED1a)
B7NQL6 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z015 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P63944 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O157:H7
B7LCL6 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli (strain 55989 / EAEC)
A7ZPS4 3.01e-21 94 28 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q9CLZ7 3.02e-21 94 28 5 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pasteurella multocida (strain Pm70)
B2GC11 3.12e-21 94 30 6 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q97U28 3.48e-21 94 26 5 281 1 eda 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
C5B7A2 3.63e-21 94 30 5 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Edwardsiella ictaluri (strain 93-146)
O54288 3.95e-21 94 26 5 281 1 None 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase Saccharolobus solfataricus
A3PFE1 4.05e-21 94 29 4 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain MIT 9301)
A2BTN4 4.38e-21 94 29 4 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain AS9601)
Q0T239 4.5e-21 94 27 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella flexneri serotype 5b (strain 8401)
A8Z624 4.84e-21 94 24 4 278 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Karelsulcia muelleri (strain GWSS)
Q1RIJ3 6.17e-21 93 26 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia bellii (strain RML369-C)
A4TCJ3 6.7e-21 94 26 4 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycolicibacterium gilvum (strain PYR-GCK)
B7LKG3 8.59e-21 93 28 5 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P0A6L3 9.04e-21 93 27 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella flexneri
P0A6L2 9.04e-21 93 27 6 296 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli (strain K12)
B1IWI1 9.04e-21 93 27 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7M7I1 9.04e-21 93 27 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O8 (strain IAI1)
Q9AKE4 9.51e-21 93 25 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q03HT2 9.87e-21 93 28 6 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B1YB29 1.51e-20 92 26 8 307 3 dapAL Uncharacterized DapA-like lyase Tneu_1812 Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)
B8D8P8 1.56e-20 92 27 4 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B9DIJ2 2.3e-20 92 24 10 297 3 nanA N-acetylneuraminate lyase Staphylococcus carnosus (strain TM300)
A7MP70 2.43e-20 92 27 3 230 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Cronobacter sakazakii (strain ATCC BAA-894)
B8D702 2.43e-20 92 27 4 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57197 2.43e-20 92 27 4 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q3ANI5 2.99e-20 92 32 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain CC9605)
Q5P838 3.03e-20 91 28 3 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1RRA5 3.4e-20 91 25 8 307 3 dapAL Uncharacterized DapA-like lyase Pisl_0309 Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
A8GWS1 3.49e-20 91 26 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia bellii (strain OSU 85-389)
Q7UA33 3.66e-20 91 32 5 279 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Parasynechococcus marenigrum (strain WH8102)
C1CK93 3.69e-20 92 25 4 279 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae (strain P1031)
Q97R25 3.69e-20 92 25 4 279 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05950
Feature type CDS
Gene -
Product dihydrodipicolinate synthase family protein
Location 1306389 - 1307300 (strand: 1)
Length 912 (nucleotides) / 303 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2519
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00701 Dihydrodipicolinate synthetase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0329 Amino acid transport and metabolism (E)
Cell wall/membrane/envelope biogenesis (M)		 EM 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase

Protein Sequence

MKKLFGVTVAMVTPFDSNDHVDINALSALTNMLITKGVDCLYPCGTTGEMLRLSASERKSVAQTVVETANKRLPVFIHVGAMTVTETIELAKHAVEIGADGIGVVTPQFFAATDRELEHYFVTIANSVPENFPIYLYNIPQCAANNIKPELAAKIQQQCKNVIGIKYSFADNNTTLGYLAVTDNFSVLHGYDKLFLGLLDAGCDGTVSGCACVFPEPFVNMYQAYITGNYQEAKHWQQFCVKFSDALKSGANMAIFKSALTMRGLNGGHMRLPQLDLLPEENQQLKEDLTQLCKEAGIAFSIN

Flanking regions ( +/- flanking 50bp)

ATTAACGTTATTGTTGAAGCAATTTGATTGAATAAATAAAAGGCTCTTACATGAAAAAATTATTTGGCGTTACAGTGGCGATGGTTACTCCGTTTGATTCAAATGATCATGTGGACATCAACGCGTTGTCTGCATTAACTAATATGTTGATCACTAAAGGTGTTGATTGCCTTTATCCTTGTGGCACGACCGGAGAAATGTTGCGTTTATCTGCATCAGAGCGTAAAAGTGTGGCACAAACCGTAGTAGAGACGGCAAATAAACGTTTACCTGTTTTTATTCATGTTGGCGCAATGACGGTAACAGAAACCATTGAACTCGCCAAACATGCTGTAGAAATTGGTGCCGATGGTATTGGTGTAGTGACGCCACAATTTTTTGCTGCCACAGACAGAGAATTAGAGCACTATTTTGTGACTATCGCCAATAGCGTACCAGAGAATTTCCCAATCTATCTTTATAACATTCCACAATGTGCGGCTAATAATATCAAGCCTGAATTAGCGGCTAAAATTCAGCAACAATGCAAAAATGTGATTGGTATAAAATACAGTTTTGCCGATAACAATACGACACTTGGCTATTTAGCGGTTACAGATAATTTTTCAGTACTTCATGGCTACGATAAATTATTCCTTGGTTTATTAGATGCAGGCTGTGATGGCACAGTTTCAGGATGTGCCTGTGTTTTCCCTGAGCCATTTGTGAATATGTATCAAGCCTATATTACGGGTAATTATCAAGAAGCGAAGCACTGGCAACAATTTTGTGTGAAATTTAGTGATGCTTTGAAATCAGGCGCGAACATGGCGATATTTAAGTCAGCATTAACTATGCGTGGCTTAAATGGTGGTCATATGCGTTTACCTCAACTTGATTTATTACCTGAAGAAAACCAACAATTGAAAGAAGATCTAACGCAATTATGCAAAGAAGCGGGGATCGCTTTTTCAATTAATTAACAGAGACTCAGCTTCAAAATATCTTTATTATATTAAGCAGTATAAAAAAC